Sindbad~EG File Manager

Current Path : /var/lib/rpm/
Upload File :
Current File : //var/lib/rpm/__db.003

(�����������������P�`���������������������������������������������������������(-��p� ��m�� ��������������������������� �0hP�L�gJj�4;���nh+�����L�(sU
�[�4�	i�*�����:�WČ�DҪM*X!p!8!8!8���������������p�������8����������������8�������������������������������������������������	��������
������������������������
���������������������������������������������������������x�����������������P����������
(�
��������H?
`?
����[�[��
�ph�Z	(G(�����	�i���U 8�!����"XHpH#H�`�$��������%P��&��������'���E(�(`)X��*���+���1,����-��	8�.�K�/^(^0�0�,1@
H�2�\�\3�K�k4�y��5}pr6�X]
7�?�8 jȂ9`(��:��������;H`<@�X�=`�@�>��?P��@�7��A��^B�r��C�r	��D�
Pb	EH�`�F�0�G�E�EH����I��������J`��MK/	�	L0HM��������N��������O0�H�P�#��Q��������R��������S��������T@�X�U��������V��������W��������X��������YH�`�Z�D�D[��������\�
XQ
]p��^��������_��������`P��
a��������b8�P�c�
(�
d�XieP�PJf�(xg[��h.�`i���j�7�7k�0
�0
l��	�m���wnPx�o88@�p��0�q�eh7	r`���
s�:XEt�U��u�v�
xw����xH��
yȦ��z
@�{��(%|] ]}8�x~Xvpv��ȟ���hS�����8�T�� �������(
�� i
�����
��	�Xd��
�H���
�s�	���p)��Xz�
0
�x�����`��������������
����� P���``����������������������������(�������������x�������x�������������������������������X�����������������������X3#�gJj����PC
�����������G�������������������
8h?d���$�	0�	q���������	����$(	*
,0q
tx}���
D
{
(�8�9�:�G�H�I�X�Y�\]^bDd�e�f�l��
(�TX\g`hdCcpanel-perl-536-eval-closure0.141.cp108~el7CPAN module - safely and cleanly create closures via string evalCpanel build perl module 'Eval::Closure'safely and cleanly create closures via string evalb���bh-centos-7.dev.cpanel.net&�perlcpanel/perlhttps://metacpan.orglinuxnoarch&��$WJs^97467b134801412fd6011cf85640d7bac45a19b5c651382194e4bdcb9a62bd46rootrootcpanel-perl-536-eval-closure-0.14-1.cp108~el7.src.rpm����cpanel-perl(Eval::Closure)cpanel-perl-eval-closurecpanel-perl-536-eval-closure




cpanel-perl-536cpanel-perl-536-carpcpanel-perl-536-constantcpanel-perl-536-exportercpanel-perl-536-overloadcpanel-perl-536-scalar-utilcpanel-perl-536-strictcpanel-perl-536-warningsrpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(CompressedFileNames)rpmlib(PayloadIsXz)rpmlib(TildeInVersions)4.6.0-14.0-13.0.4-15.2-14.10.0-14.11.1b�@`-@W��@V<�@S>��Q+R@Busy Camels <bc@cpanel.net> - 0.14-1.cp108Busy Camels <bc@cpanel.net> - 0.14-1.cp1198Todd Rinaldo <toddr@cpan.org> - 0.14-1.cp1162Todd Rinaldo <toddr@cpan.org> - 0.13-1.cp1156Todd Rinaldo <toddr@cpanel.net> - 0.11-1.cp1146Todd Rinaldo <toddr@cpanel.net> - 0.08-1.cp1136- Bump to 1.cp108 for re-build- Bump to 1.cp1198 for debian re-build- Update from upstream: Eval-Closure 0.14- Update from upstream: Eval-Closure 0.13- Update from upstream: Eval-Closure 0.11- Update from upstream: Eval-Closure 0.080.140.140.14-1.cp108~el7Closure.pm/usr/local/cpanel/3rdparty/perl/536/cpanel-lib/Eval/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches   -m64 -mtune=genericcpioxz2noarch-redhat-linux-gnu?����p����d`�M�ՙa�_�b1d709a2f44bb0232474dfefff193ebcf233bc8ec�VB'�c�VAity2.confmodsec_auditmodsecurity.versionmod_security2.soea-apache24-mod_security2-2.9.6CHANGESLICENSENOTICEREADME.md/etc/apache2/conf.d/modsec//etc/apache2/conf.d//etc/apache2/conf.modules.d//etc/apache2/logs//etc/cpanel/ea4//usr/lib64/apache2/modules//usr/share/doc//usr/share/doc/ea-apache24-mod_security2-2.9.6/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches   -m64 -mtune=generic -O3obs://private/EA4-production/CentOS_7/2f02dc068f8eb8450ff919d74d925b39-mod_security2cpioxz2x86_64-redhat-linux-gnuemptyASCII textdirectoryASCII text, with no line terminatorsELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=8673de7b3c9886444971d3a8743d49d7836849d7, strippedUTF-8 Unicode text, with very long linesUTF-8 Unicode text"R(R)R'R&R%RRRR!RRRRRRRR RRR"R#RRR
R$R+RRRRRR*RR0��lɝ`q
��'o��?������c�*#x��~�|,<�z��x��������������������X�#�fJj��������H�
�������`�����������������������kas Czerner <lczerner@redhat.com> - 1.42.9-4Daniel Mach <dmach@redhat.com> - 1.42.9-3Eric Sandeen <sandeen@redhat.com> 1.42.9-2Eric Sandeen <sandeen@redhat.com> 1.42.9-1Daniel Mach <dmach@redhat.com> - 1.42.8-3Stef walter <stefw@redhat.com> 1.42.8-2Eric Sandeen <sandeen@redhat.com> 1.42.8-1Eric Sandeen <sandeen@redhat.com> 1.42.7-2Eric Sandeen <sandeen@redhat.com> 1.42.7-1Eric Sandeen <sandeen@redhat.com> 1.42.6-2Eric Sandeen <sandeen@redhat.com> 1.42.6-1Eric Sandeen <sandeen@redhat.com> 1.42.5-2Eric Sandeen <sandeen@redhat.com> 1.42.5-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.42.4-2Eric Sandeen <sandeen@redhat.com> 1.42.4-1Eric Sandeen <sandeen@redhat.com> 1.42.3-2Eric Sandeen <sandeen@redhat.com> 1.42.3-1Eric Sandeen <sandeen@@redhat.com> 1.42.2-6Eric Sandeen <sandeen@@redhat.com> 1.42.2-5Eric Sandeen <sandeen@@redhat.com> 1.42.2-4Richard W.M. Jones <rjones@redhat.com> 1.42.2-3Eric Sandeen <sandeen@redhat.com> 1.42.2-2Eric Sandeen <sandeen@redhat.com> 1.42.2-1Eric Sandeen <sandeen@redhat.com> 1.42.1-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.42-2Eric Sandeen <sandeen@redhat.com> 1.42-1Eric Sandeen <sandeen@redhat.com> 1.42-0.9.WIP.1120Eric Sandeen <sandeen@redhat.com> 1.42-0.8.WIP.1120Eric Sandeen <sandeen@redhat.com> 1.42-0.7.WIP.1016Eric Sandeen <sandeen@redhat.com> 1.42-0.6.WIP.1016Eric Sandeen <sandeen@redhat.com> 1.42-0.5.WIP.1016Eric Sandeen <sandeen@redhat.com> 1.42-0.4.WIP.2011.1009Eric Sandeen <sandeen@redhat.com> 1.42-0.3.WIP.0925Eric Sandeen <sandeen@redhat.com> 1.42-0.2.WIP.0702Eric Sandeen <sandeen@redhat.com> 1.42-0.1.WIP.0702Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.41.14-2Eric Sandeen <sandeen@redhat.com> 1.41.14-1Dan Horák <dan[at]danny.cz> 1.41.13-2Eric Sandeen <sandeen@redhat.com> 1.41.13-1Eric Sandeen <sandeen@redhat.com> 1.41.12-7Eric Sandeen <sandeen@redhat.com> 1.41.12-6Eric Sandeen <sandeen@redhat.com> 1.41.12-5Eric Sandeen <sandeen@redhat.com> 1.41.12-4Eric Sandeen <sandeen@redhat.com> 1.41.12-3Eric Sandeen <sandeen@redhat.com> 1.41.12-2Eric Sandeen <sandeen@redhat.com> 1.41.12-1Eric Sandeen <sandeen@redhat.com> 1.41.11-1Eric Sandeen <sandeen@redhat.com> 1.41.10-5Eric Sandeen <sandeen@redhat.com> 1.41.10-4Eric Sandeen <sandeen@redhat.com> 1.41.10-3Eric Sandeen <sandeen@redhat.com> 1.41.10-2Eric Sandeen <sandeen@redhat.com> 1.41.10-1Eric Sandeen <sandeen@redhat.com> 1.41.9-10Eric Sandeen <sandeen@redhat.com> 1.41.9-9Eric Sandeen <sandeen@redhat.com> 1.41.9-8Eric Sandeen <sandeen@redhat.com> 1.41.9-7Eric Sandeen <sandeen@redhat.com> 1.41.9-6Eric Sandeen <sandeen@redhat.com> 1.41.9-5Eric Sandeen <sandeen@redhat.com> 1.41.9-4Eric Sandeen <sandeen@redhat.com> 1.41.9-3Josef Bacik <josef@toxicpanda.com> 1.41.9-2Eric Sandeen <sandeen@redhat.com> 1.41.9-1Eric Sandeen <sandeen@redhat.com> 1.41.8-6Karel Zak <kzak@redhat.com> 1.41.8-5Karel Zak <kzak@redhat.com> 1.41.8-4Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.41.8-3Eric Sandeen <sandeen@redhat.com> 1.41.8-2Eric Sandeen <sandeen@redhat.com> 1.41.8-1Eric Sandeen <sandeen@redhat.com> 1.41.7-1Eric Sandeen <sandeen@redhat.com> 1.41.6-6Eric Sandeen <sandeen@redhat.com> 1.41.6-5Karel Zak <kzak@redhat.com> 1.41.6-4Karel Zak <kzak@redhat.com> 1.41.6-3Karel Zak <kzak@redhat.com> 1.41.6-2Eric Sandeen <sandeen@redhat.com> 1.41.6-1Eric Sandeen <sandeen@redhat.com> 1.41.5-1Eric Sandeen <sandeen@redhat.com> 1.41.4-8Eric Sandeen <sandeen@redhat.com> 1.41.4-7Eric Sandeen <sandeen@redhat.com> 1.41.4-6Eric Sandeen <sandeen@redhat.com> 1.41.4-5Eric Sandeen <sandeen@redhat.com> 1.41.4-4Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.41.4-3Eric Sandeen <sandeen@redhat.com> 1.41.4-2Eric Sandeen <sandeen@redhat.com> 1.41.4-1Eric Sandeen <sandeen@redhat.com> 1.41.3-4Eric Sandeen <sandeen@redhat.com> 1.41.3-3Eric Sandeen <sandeen@redhat.com> 1.41.3-2Eric Sandeen <sandeen@redhat.com> 1.41.3-1Eric Sandeen <sandeen@redhat.com> 1.41.2-2Eric Sandeen <sandeen@redha�x����������������������X�#8gJj�X}�s�����v�����������������s�n�s�.) dependicies, as side effect of
  rubygem-rkerberos using private interfaces in libkadmclnt.- fix the problem where the %license file has been a dangling symlink
- ksu: pull in fix from pull #206 to avoid breakage when the
  default_ccache_name doesn't include a cache type as a prefix
- ksu: pull in a proposed fix for pull #207 to avoid breakage when the
  invoking user doesn't already have a ccache- pull in patch from master to load plugins with RTLD_NODELETE, when
  defined (RT#7947)- backport patch to make the client skip checking the server's reply
  address when processing responses to password-change requests, which
  between NAT and upcoming HTTPS support, can cause us to erroneously
  report an error to the user when the server actually reported success
  (RT#7886)
- backport support for accessing KDCs and kpasswd services via HTTPS
  proxies (marked by being specified as https URIs instead as hostnames
  or hostname-and-port), such as the one implemented in python-kdcproxy
  (RT#7929, #109919), and pick up a subsequent patch to build HTTPS
  as a plugin- backport fix for trying all compatible keys when not being strict about
  acceptor names while reading AP-REQs (RT#7883, #1078888)
- define _GNU_SOURCE in files where we use EAI_NODATA, to make sure that
  it's declared (#1059730,#1084068,#1109102)- kpropd hasn't bothered with -S since 1.11; stop trying to use that flag
  in the systemd unit file- pull in upstream fix for an incorrect check on the value returned by a
  strdup() call (#1132062)- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_22_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_22_Mass_Rebuild- update to 1.12.2
  - drop patch for RT#7820, fixed in 1.12.2
  - drop patch for #231147, fixed as RT#3277 in 1.12.2
  - drop patch for RT#7818, fixed in 1.12.2
  - drop patch for RT#7836, fixed in 1.12.2
  - drop patch for RT#7858, fixed in 1.12.2
  - drop patch for RT#7924, fixed in 1.12.2
  - drop patch for RT#7926, fixed in 1.12.2
  - drop patches for CVE-2014-4341/CVE-2014-4342, included in 1.12.2
  - drop patch for CVE-2014-4343, included in 1.12.2
  - drop patch for CVE-2014-4344, included in 1.12.2
  - drop patch for CVE-2014-4345, included in 1.12.2
- replace older proposed changes for ksu with backports of the changes
  after review and merging upstream (#1015559, #1026099, #1118347)- incorporate fix for MITKRB5-SA-2014-001 (CVE-2014-4345)- gssapi: pull in upstream fix for a possible NULL dereference
  in spnego (CVE-2014-4344)- gssapi: pull in proposed fix for a double free in initiators (David
  Woodhouse, CVE-2014-4343, #1117963)- fix license handling- pull in fix for denial of service by injection of malformed GSSAPI tokens
  (CVE-2014-4341, CVE-2014-4342, #1116181)- pull in changes from upstream which add processing of the contents of
  /etc/gss/mech.d/*.conf when loading GSS modules (#1102839)- pull in fix for building against tcl 8.6 (#1107061)- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_Mass_Rebuild- Backport fix for change password requests when using FAST (RT#7868)- spnego: pull in patch from master to restore preserving the OID of the
  mechanism the initiator requested when we have multiple OIDs for the same
  mechanism, so that we reply using the same mechanism OID and the initiator
  doesn't get confused (#1066000, RT#7858)- pull in patch from master to move the default directory which the KDC uses
  when computing the socket path for a local OTP daemon from the database
  directory (/var/kerberos/krb5kdc) to the newly-added run directory
  (/run/krb5kdc), in line with what we're expecting in 1.13 (RT#7859, more
  of #1040056 as #1063905)
- add a tmpfiles.d configuration file to have /run/krb5kdc created at
  boot-time
- own /var/run/krb5kdc- refresh nss_wrapper and add socket_wrapper to the %check environment- add currently-proposed changes to teach ksu about credential cache
  collections and the default_ccache_name setting (#1015559,#1026099)- pull in multiple changes to allow replay caches to be ad�x���������������������X�#�gJjX���������m�����^�����������������m�m�?��?�<d��� �	0�	Q�����������	4�J�^�dlp	r
tx�
������4%�%�%(�8�@9�@:A�@F�jG�|H��I��X��Y��\��]��^��b��c��d�e�f�l�
z�%��8�L�P�h�x
���������g��h��Cea-php55-php-litespeed5.5.3864.65.14.cpanelLiteSpeed Web Server PHP supportThe ea-php55-php-litespeed package provides the /opt/cpanel/ea-php55/root/usr/bin/lsphp command
used by the LiteSpeed Web Server (LSAPI enabled PHP).i��hou-2?�0EA4-production / CentOS_7cPanel, Inc.PHP and Zend and BSDDevelopment/Languageshttp://www.php.net/linuxx86_64?�0��i��\91d1ac624bc65e6b9f41586abba181fac1969cc211a389a9aa5d5eb914d674acrootrootea-php55-php-5.5.38-64.65.14.cpanel.src.rpm����ea-php55-php-litespeedea-php55-php-litespeed(x86-64)


@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@
ea-php55-php-commonrpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(CompressedFileNames)libc.so.6()(64bit)libc.so.6(GLIBC_2.11)(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.15)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.3)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libc.so.6(GLIBC_2.7)(64bit)libc.so.6(GLIBC_2.8)(64bit)libcom_err.so.2()(64bit)libcrypt.so.1()(64bit)libcrypto.so.1.0.0()(64bit)libcrypto.so.1.0.0(OPENSSL_1.0.2)(64bit)libcrypto.so.1.0.0(libcrypto.so.1.0.0)(64bit)libdl.so.2()(64bit)libdl.so.2(GLIBC_2.2.5)(64bit)libgssapi_krb5.so.2()(64bit)libk5crypto.so.3()(64bit)libkrb5.so.3()(64bit)libm.so.6()(64bit)libm.so.6(GLIBC_2.2.5)(64bit)libnsl.so.1()(64bit)libpcre.so.1()(64bit)libresolv.so.2()(64bit)libresolv.so.2(GLIBC_2.2.5)(64bit)librt.so.1()(64bit)libssl.so.1.0.0()(64bit)libssl.so.1.0.0(libssl.so.1.0.0)(64bit)libxml2.so.16()(64bit)libz.so.1()(64bit)rtld(GNU_HASH)rpmlib(PayloadIsXz)5.5.38-64.65.14.cpanel4.6.0-14.0-13.0.4-15.2-14.11.3h�;@f�)@e\��dd��d[�@b\@a�@`ٹ�`B@_�]@_R,@_�@^|�@^`�^^F�]��]��]z3@]5�@]#0@]�\��@\���\��\J�@[O+�[{@Z�3@ZԐ@Z���Z���Za�ZX�@ZWQ�ZN@Z)-@ZN�Y�@Y�Y�A@Y�3�Yw2�YS�@YK�@Y;@Y�Y�@Yi@X�:@X��@X�P@X�C�X��@X�e@X�p�X�*�XEV�X.�@X.�@X-��W�W��@W�@W�
�Wv[@Wu	�Wq@Wg�W_�W^�@WM|�WF�@W!�@WK�V�b�V�'@V��V��@V�=@V��@V�S@Vr��Vr��Vj��Vh�VE�V��V
 @U�U�@U�L@U�n�U�n�Um��Ud`@U:�Ut@T�	�TH�TD�@T5'@Sr	@S,)�S?�S��R�@R��@R��@R��R�R�R�R�R_�@R:�@R��Q��@Q�Y@Q�Y@Q��Q��Q��@Q��@Q��Qy�Qf��Q@j@P��@PѬ@P��P�@P�@P�*�P��@P��@P�)�P�)�P���P���P���P���P���P�5@P{��Px@Pl(�Pj�@Pi��Pi��Pe�@P`K@PY��PY��PY��PXb@PW�PS@P2&�P.2@P	H@O�@O�@O��O��@O�\@O�s@O��@O��@Ov�OtN�OpZ@OpZ@OP�@O?��O-�O�O�@O	�@N��N��N��@N��@N�@NoE�NS�@NL��N7@M���M��M���MT�Mt�Mk�@MfH@MR��M'@M�@M�@Mg�L�8�LΫ�Lʷ@L���LH2�K��@K��@K�C�K�@K
@K��K�@J��@JlE@J_@J_@J\s@JY�@J> �I�'@I��@I��I��@I��@I}��I|T@Iy�@IC��I>]�I:i@I9�I*�@I9@H˫@H�(�H{?�Hv@G��G�Z@Gt�@GV��GV��GV@F��Fڥ�F�@F�S@F�S@F�]�F��Fw�@FiD�FA��F@f@F; @F�@F@Eّ@E�K@E��E�3@Eu_@El$�El$�Ej�@E[@E[@EG:�E#�@D�,@D��@D�b�D�b�D�(@DtJ�Dla�D_2�DX�@D;@C�@C�C�Q@Cˊ�Cǖ@C�
@C��C�f@C�q�C� @C��@C�7@C��@Cs6@CoA�CgX�C(�B�i�B{\@Bwg�Bl�B]	�B]	�B]	�B[�@BZf�BQ,@BM7�BJ��BB��B�B	�@A�@A��A��A�_�A�_�A�_�AJ�AJ�AJ�A@�x����������������������X�#efJj�
��I�����!����������������IJH�hat.com> 1.2.3-1Fedora Release Engineering <rel-eng@fedoraproject.org> - 1.2.2-3parag <paragn@fedoraproject.org> 1.2.2-2Adam Jackson <ajax@redhat.com> 1.2.2-1Adam Jackson <ajax@redhat.com> - 1.2.0-5Matthias Clasen <mclasen@redhat.com> 1.2.0-4Adam Jackson <ajax@redhat.com> 1.2.0-3Adam Jackson <ajax@redhat.com> 1.2.0-2Adam Jackson <ajax@redhat.com> 1.2.0-1Adam Jackson <ajax@redhat.com> 1.1.1-2.1Jesse Keating <jkeating@redhat.com> 1.1.1-3.1Mike A. Harris <mharris@redhat.com> 1.1.1-3Mike A. Harris <mharris@redhat.com> 1.1.1-2Adam Jackson <ajackson@redhat.com> 1.1.1-1Jesse Keating <jkeating@redhat.com> - 1.1.0.2-2.2Jesse Keating <jkeating@redhat.com> - 1.1.0.2-2.1Mike A. Harris <mharris@redhat.com> 1.1.0.2-2Mike A. Harris <mharris@redhat.com> 1.1.0.2-1Mike A. Harris <mharris@redhat.com> 1.1.0.1-1Jesse Keating <jkeating@redhat.com>Mike A. Harris <mharris@redhat.com> 0.99.2-1Mike A. Harris <mharris@redhat.com> 0.99.1-1Mike A. Harris <mharris@redhat.com> 0.99.0-3Mike A. Harris <mharris@redhat.com> 0.99.0-2Mike A. Harris <mharris@redhat.com> 0.99.0-1- rebuild for new build of libXrender- libXrandr 1.5.1- Rebuilt for https://fedoraproject.org/wiki/Fedora_24_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_23_Mass_Rebuild- libXrandr 1.5.0 - fixup requires/br- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_22_Mass_Rebuild- libXrandr 1.4.2- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_20_Mass_Rebuild- libXrandr 1.4.1- Require libX11 1.6RC2 for _XEatDataWords- Update to git snapshot to fix CVEs listed below:
- CVE-2013-1986- autoreconf for aarch64- Rebuilt for https://fedoraproject.org/wiki/Fedora_19_Mass_Rebuild- libXrandr 1.4.0 upstream release.- Rebuilt for https://fedoraproject.org/wiki/Fedora_18_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_17_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_15_Mass_Rebuild- libXrandr 1.3.1- randr-git.patch: Update to git- Rebuilt for https://fedoraproject.org/wiki/Fedora_12_Mass_Rebuild- Un-require xorg-x11-filesystem
- Remove useless %dir- libXrandr 1.3.0- Rebuilt for https://fedoraproject.org/wiki/Fedora_11_Mass_Rebuild- libXrandr-1.2.99.4-gop.patch: Fix encoding of GetOutputPrimary.- libXrandr 1.2.99.4- Fix Requires in -devel subpackage- Fix BuildRequires.- libXrandr 1.2.3- Autorebuild for GCC 4.3- Merge-Review #226083
- Removed BR:pkgconfig 
- Removed XFree86-libs, xorg-x11-libs XFree86-devel, xorg-x11-devel as Obsoletes
- Removed zero-length README file- libXrandr 1.2.2- Rebuild for build id- Don't install INSTALL- BuildRequire on the randrproto virtual instead of a magic x-x-p-d version.
- Fix -devel package to require sufficiently new randrproto.- libXrandr-1.2.0-appease-cee-plus-plus.patch: don't use C++ keywords as
  function argument names.- libXrandr 1.2.0- Update to 1.1.2- rebuild- Added "Requires: xorg-x11-proto-devel" to devel pkg for xrandr.pc- Added "BuildRequires: pkgconfig" for (#193428)
- Replace "makeinstall" with "make install DESTDIR=..." for (#192724)
- Remove package ownership of mandir/libdir/etc.- Update to 1.1.1- bump again for double-long bug on ppc(64)- rebuilt for new gcc4.1 snapshot and glibc changes- Bumped and rebuilt- Updated libXrandr to version 1.1.0.2 from X11R7 RC4- Updated libXrandr to version 1.1.0.1 from X11R7 RC3
- Added "Requires(pre): xorg-x11-filesystem >= 0.99.2-3", to ensure
  that /usr/lib/X11 and /usr/include/X11 pre-exist.
- Removed 'x' suffix from manpage directories to match RC3 upstream.- rebuilt- Updated libXrandr to version 0.99.2 from X11R7 RC2
- Changed 'Conflicts: XFree86-devel, xorg-x11-devel' to 'Obsoletes'
- Changed 'Conflicts: XFree86-libs, xorg-x11-libs' to 'Obsoletes'- Updated libXrandr to version 0.99.1 from X11R7 RC1
- Updated file manifest to find manpages in "man3x"- Renamed package to remove xorg-x11 from the name due to unanimous decision
  between developers.
- Use Fedora Extras style BuildRoot tag.
- D�x����������������������X�#�gJjX*ب9�����Q����������������9:�R?������S��$ƨ���)��uV}��6c�bP5a��BT�$!�7o;n�
4Pz9�0Y��*:�ɸbI47�x�5x��.�|p�K�:�����B��/��]6���1vffC���w��]�v��ۙ��+��Z��D@��PV֒H�/2��.�\u��:������J^OtPP�A�/�l��v�%=��M��RON�EP0�5�r=��W�$z����k�)��WV��0��\?z����f�y���3R�׺:�b<���G!3Z���g�C���<m������Ğo�J.w����7'��k.�~�[<^��WȆ�L�f��W�;Fm[}�RQ�o����w���֞��W�1��N���}�F�M���`�
-�s� [��,n��֙_n�
���/�xMn@�&^4�D�1~�����N��m�_k5M���G��MȫK��=վn�ՌC�W2�܄�RĽ�#�D�$���L`U���z�M��]�|�{�`�).
�#.Y�y�wz�O@][��߻��#��Q��K�/�~�,v{�1�S��$ƨ����CȻӴ�av�RN+�ڃ��ڼ�(%Pe��3��1��b
�Ĕb���ſVh���ԑ��I@
-llmUS1Bs�*�֯E��e"�M"�}>C�5�4.�h͝`!/5�v
�	���5)@b�?����q7��d��t��ǟCr�pj��kM��h�5+�T�a0+u�dܫ���,�,��o>�j�j�Sp�>���i�<��+%�j>���Qt��@�x�	��9�z�Rz7��
���|��j��w�W6�|���!o��!��l�v�b?���k���I\�;i���ź-�T�����}
�0�˅�����C����k�ŋ!e����4,�vHܮ6�6�ej]ã���e�N�s���|x�i�����w����(�ܑ���N��F5�Q�R=i8�P:����K,�J��V�5����*$�Q�6Ͷ���K!
c�(:�.�ۼM�+�dFk�z����?�i�09���!h�)>��in@�݁��.�K�9FïŰ�c�CP՚Voʃl~�64b968d0890402aff193398e2019d5350e46ad83bL����bL��PERCENT_HITS_GLOBAL percent value (Jiri Olsa) [1680072]
- [tools] perf annotate: Switch struct annotation_data::percent to array (Jiri Olsa) [1680072]
- [tools] perf annotate: Loop group events directly in annotation__calc_percent() (Jiri Olsa) [1680072]
- [tools] perf annotate: Rename hist to sym_hist in annotation__calc_percent (Jiri Olsa) [1680072]
- [tools] perf annotate: Rename local sample variables to data (Jiri Olsa) [1680072]
- [tools] perf annotate: Rename struct annotation_line::samples* to data* (Jiri Olsa) [1680072]
- [tools] perf annotate: Get rid of annotation__scnprintf_samples_period() (Jiri Olsa) [1680072]
- [tools] perf annotate: Make annotation_line__max_percent static (Jiri Olsa) [1680072]
- [tools] perf annotate: Make symbol__annotate_fprintf2() local (Jiri Olsa) [1680072]
- [tools] perf tools: Drop unneeded bitmap_zero() calls (Jiri Olsa) [1680072]
- [tools] perf trace: Use perf_evsel__sc_tp_{uint, ptr} for "id"/"args" handling syscalls:* events (Jiri Olsa) [1680072]
- [tools] perf trace: Setup struct syscall_tp for syscalls:sys_{enter, exit}_NAME events (Jiri Olsa) [1680072]
- [tools] perf trace: Rename some syscall_tp methods to raw_syscall (Jiri Olsa) [1680072]
- [tools] perf trace: Allow setting up a syscall_tp struct without a format_field (Jiri Olsa) [1680072]
- [tools] perf trace: Use beautifiers on syscalls:sys_enter_ handlers (Jiri Olsa) [1680072]
- [tools] perf trace: Associate vfs_getname()'ed pathname with fd returned from 'openat' (Jiri Olsa) [1680072]
- [tools] introduce test_and_clear_bit (Jiri Olsa) [1680072]
- [tools] perf trace: Do not require --no-syscalls to suppress strace like output (Jiri Olsa) [1680072]
- [tools] perf tools: Allow overriding MAX_NR_CPUS at compile time (Jiri Olsa) [1680072]
- [tools] perf bpf: Show better message when failing to load an object (Jiri Olsa) [1680072]
- [tools] perf list: Unify metric group description format with PMU event description (Jiri Olsa) [1680072]
- [tools] perf c2c report: Fix crash for empty browser (Jiri Olsa) [1680072]
- [tools] perf tests: Fix indexing when invoking subtests (Jiri Olsa) [1680072]
- [tools] perf trace: Beautify the AF_INET & AF_INET6 'socket' syscall 'protocol' args (Jiri Olsa) [1680072]
- [tools] perf trace beauty: Add beautifiers for 'socket''s 'protocol' arg (Jiri Olsa) [1680072]
- [tools] perf trace beauty: Do not print NULL strarray entries (Jiri Olsa) [1680072]
- [tools] perf beauty: Add a generator for IPPROTO_ socket's protocol constants (Jiri Olsa) [1680072]
- [tools] tools include uapi: Grab a copy of linux/in.h (Jiri Olsa) [1680072]
- [tools] perf tests: Fix complex event name parsing (Jiri Olsa) [1680072]
- [tools] perf evlist: Fix error out while applying initial delay and LBR (Jiri Olsa) [1680072]
- [tools] perf test: Fix subtest number when showing results (Jiri Olsa)�x������Fpx�������X�#CgJj�D �������w0�����������������w07�x0�we build
  with --sysconfdir=/etc, thereby suppressing double-logging (#231147)- remove a patch, to fix problems with interfaces which are "up" but which
  have no address assigned, which conflicted with a different fix for the same
  problem in 1.5 (#200979)- ftp: don't lose track of a descriptor on passive get when the server fails to
  open a file- in login, allow PAM to interact with the user when they've been strongly
  authenticated
- in login, signal PAM when we're changing an expired password that it's an
  expired password, so that when cracklib flags a password as being weak it's
  treated as an error even if we're running as root- drop netdb patch
- kdb_ldap: add patch to treat 'nsAccountLock: true' as an indication that
  the DISALLOW_ALL_TIX flag is set on an entry, for better interop with Fedora,
  Netscape, Red Hat Directory Server (Simo Sorce)- patch to avoid depending on <netdb.h> to define NI_MAXHOST and NI_MAXSERV- enable patch for key-expiration reporting
- enable patch to make kpasswd fall back to TCP if UDP fails (#251206)
- enable patch to make kpasswd use the right sequence number on retransmit
- enable patch to allow mech-specific creds delegated under spnego to be found
  when searching for creds- some init script cleanups
  - drop unquoted check and silent exit for "$NETWORKING" (#426852, #242502)
  - krb524: don't barf on missing database if it looks like we're using kldap,
    same as for kadmin
  - return non-zero status for missing files which cause startup to
    fail (#242502)- allocate space for the nul-terminator in the local pathname when looking up
  a file context, and properly free a previous context (Jose Plans, #426085)- rebuild- update to 1.6.3, dropping now-integrated patches for CVE-2007-3999
  and CVE-2007-4000 (the new pkinit module is built conditionally and goes
  into the -pkinit-openssl package, at least for now, to make a buildreq
  loop with openssl avoidable)- make proper use of pam_loginuid and pam_selinux in rshd and ftpd- make krb5.conf %verify(not md5 size mtime) in addition to
  %config(noreplace), like /etc/nsswitch.conf (#329811)- apply the fix for CVE-2007-4000 instead of the experimental patch for
  setting ok-as-delegate flags- move the db2 kdb plugin from -server to -libs, because a multilib libkdb
  might need it- also perform PAM session and credential management when ftpd accepts a
  client using strong authentication, missed earlier
- also label kadmind log files and files created by the db2 plugin- incorporate updated fix for CVE-2007-3999 (CVE-2007-4743)
- fix incorrect call to "test" in the kadmin init script (#252322,#287291)- incorporate fixes for MITKRB5-SA-2007-006 (CVE-2007-3999, CVE-2007-4000)- cover more cases in labeling files on creation
- add missing gawk build dependency- rebuild- kdc.conf: default to listening for TCP clients, too (#248415)- update to 1.6.2
- add "buildrequires: texinfo-tex" to get texi2pdf- incorporate fixes for MITKRB5-SA-2007-004 (CVE-2007-2442,CVE-2007-2443)
  and MITKRB5-SA-2007-005 (CVE-2007-2798)- reintroduce missing %postun for the non-split_workstation case- rebuild- rebuild- add missing pam-devel build requirement, force selinux-or-fail build- rebuild- label all files at creation-time according to the SELinux policy (#228157)- perform PAM account / session management in krshd (#182195,#195922)
- perform PAM authentication and account / session management in ftpd
- perform PAM authentication, account / session management, and password-
  changing in login.krb5 (#182195,#195922)- preprocess kerberos.ldif into a format FDS will like better, and include
  that as a doc file as well- switch man pages to being generated with the right paths in them
- drop old, incomplete SELinux patch
- add patch from Greg Hudson to make srvtab routines report missing-file errors
  at same point that keytab routines do (#241805)- pull patch from svn to undo unintentional chattiness in ftp
- pull patch from svn to handle NULL krb5_get_init_creds_opt structures
  better in a coupl�x��������������g�������Xz#�gJj`~�~�������=�����H�����������������=�= and icmptype configuration files
- not using any system-config-firewall parts anymore- new version 0.1.3
- restore all firewall features for reload: panic and virt rules and chains
- string fixes for firewall-cmd man page (by Jiri Popelka)
- fixed firewall-cmd port list (by Jiri Popelka)
- added firewall dbus client connect check to firewall-cmd (by Jiri Popelka)
- translation updates: de, es, gu, it, ja, kn, ml, nl, or, pa, pl, ru, ta,
                       uk, zh_CN- fixed package according to package review (rhbz#665395):
  - non executable scripts: dropped shebang
  - using newer GPL license file
  - made /etc/dbus-1/system.d/FirewallD.conf config(noreplace)
  - added requires(post) and (pre) for chkconfig- new version 0.1.1
- fixed source path in POTFILES*
- added missing firewall_config.py.in
- added misssing space for spec_ver line
- using firewall_config.VARLOGFILE
- added date to logging output
- also log fatal and error logs to stderr and firewall_config.VARLOGFILE
- make log message for active_firewalld fatal- initial package (proof of concept implementation)0.6.3-13.el7_9firewalldhelpersicmptypesipsetsserviceszonesmacros.firewalld/usr/lib//usr/lib/firewalld//usr/lib/rpm/macros.d/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches   -m64 -mtune=genericcpioxz2noarch-redhat-linux-gnudirectoryASCII text?���`�`�`��d$ƨ���9V�Y�+IK,�`��giK��=��7���Qf��@@�?�w2�(���,��S4����,��S�=l�b�y��c,j�����Zl���X�հ~��'��
�`%�^�$��hLT�@��ҜC�mv��3_�A�r�OKë4�;(*�K.ȊR;��k�dm¡��C�0:���Q��
�L�<qm�V�һ��܋�m�D���I��OHxb�.&׽V��Ρ����Pξ*<���T����0�����{%[�WEJ��$�-R�^�Ls�鸋�]iih�2��H�X������ۜ5�����fR|F��"tw͂N�=�ԍ���\:g���b��krB?$����4��9���)8��;$��E
���w�_�Xu�K�p�T�RVAN�xC�@�	�:��YbU�m�g�샟q�D�T@�%J�-�dz��19aES�գ��p�æ��(E��a�.�C�$Zj�@���z7�9%M�tk�+&Sx�	�
����J��k�tC��ҵ�vv�ʼ7A	�����ٴҨ��q���:��`��d$ƨ�����p����G�f�2м�]��X<�k��=$��v�^� ]ӻ��/J��>i�1&�n��xY����%�d5tT�OPW׃��$p1�K
�����0~��K�W�[2)�"7>r�7��~
�q�i�+Q
~*t�I#�an<@��ɃIn$M�ڬ�fb�L眖8���Q��Q��n'�9���#�"�h� ῂ�b�'?�2�9�8��szJ�),�o�f
R�,��W��P��Cat��vd����S�U�TR�	�T'oZ�v�]�9�x
M�3s��P��elD���*�#G���{��?��4�R��+����#�F�򭖕 f�3P��U�Fz ���f%@h~���y&�;��[꺢g#is�b��Ɛ�����io"ji�n3j _��̃�����B��;*Qomri�[�#�_�p��;��?����W$æ��-Iz�6���L��<9$�ܹ����C��X�ϒc�,F�MEw�֤=����p�"�(=2��G�B�-�5b2097f364511da8a2b291bc180a34464a0bf228bL��@bL��	thin_trim�(thin_rmap.8.gz8�	thin_rmap�'thin_restore.8.gz�thin_restore�&thin_repair.8.gz�thin_repair�%thin_metadata_size.8.gz�thin_metadata_sizey�$thin_ls.8.gz�thin_ls�#thin_dump.8.gz�
	thin_dump�"thin_delta.8.gz�
thin_delta�!thin_check.8.gz�
thin_check`Dthin-performance.profileD
thin-generic.profile��thinL�thermaltheory.htmlag �8� ��i2themesHr�
thaana.vimr�thaana-phonetic_utf-8.vimtth_THd�Rth.plfU2rthtin��tgtdLotgr192.ko.xz��tgpg���tgammal.3.gz���tgammaf.3.gz���
tgamma.3.gz���tga.mod�tg_TJ��vtg3_tso5.bino��ttg3_tso.bin10��ctg357766.bineL�	tg3.ko.xz��ttg3.bin11�:tg2.bineq�:tg1.bing �x������%`W�������X	#�gJjp	�b�������������������������������������ek <jsynacek@redhat.com> - 2.4.40-6Jan Synáček <jsynacek@redhat.com> - 2.4.40-5Jan Synáček <jsynacek@redhat.com> - 2.4.40-4Jan Synáček <jsynacek@redhat.com> - 2.4.40-3Jan Synáček <jsynacek@redhat.com> - 2.4.40-2Jan Synáček <jsynacek@redhat.com> - 2.4.40-1Jitka Plesnikova <jplesnik@redhat.com> - 2.4.39-12Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2.4.39-11Tom Callaway <spot@fedoraproject.org> - 2.4.39-10Jan Synáček <jsynacek@redhat.com> - 2.4.39-9Jan Synáček <jsynacek@redhat.com> - 2.4.39-8Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2.4.39-7Jan Synáček <jsynacek@redhat.com> - 2.4.39-6Jan Synáček <jsynacek@redhat.com> - 2.4.39-5Jan Synáček <jsynacek@redhat.com> - 2.4.39-4Jan Synáček <jsynacek@redhat.com> - 2.4.39-3Jan Synáček <jsynacek@redhat.com> - 2.4.39-2Jan Synáček <jsynacek@redhat.com> - 2.4.39-1Jan Synáček <jsynacek@redhat.com> - 2.4.38-1Jan Synáček <jsynacek@redhat.com> - 2.4.37-2Jan Synáček <jsynacek@redhat.com> - 2.4.37-1Jan Synáček <jsynacek@redhat.com> - 2.4.36-4Jan Synáček <jsynacek@redhat.com> - 2.4.36-3Jan Synáček <jsynacek@redhat.com> - 2.4.36-2Jan Synáček <jsynacek@redhat.com> - 2.4.36-2Jan Synáček <jsynacek@redhat.com> - 2.4.36-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2.4.35-7Petr Pisar <ppisar@redhat.com> - 2.4.35-6Jan Synáček <jsynacek@redhat.com> - 2.4.35-5Jan Synáček <jsynacek@redhat.com> 2.4.35-4Jan Synáček <jsynacek@redhat.com> 2.4.35-3Jan Synáček <jsynacek@redhat.com> 2.4.35-2Jan Synáček <jsynacek@redhat.com> 2.4.35-1Jan Synáček <jsynacek@redhat.com> 2.4.34-2Jan Synáček <jsynacek@redhat.com> 2.4.34-1Jan Vcelak <jvcelak@fedoraproject.org> 2.4.34-1Jan Synáček <jsynacek@redhat.com> 2.4.33-4Jan Vcelak <jvcelak@redhat.com> 2.4.33-3Jan Vcelak <jvcelak@redhat.com> 2.4.33-2Jan Vcelak <jvcelak@redhat.com> 2.4.33-1Jan Vcelak <jvcelak@redhat.com> 2.4.32-3Jan Vcelak <jvcelak@redhat.com> 2.4.32-2Jan Vcelak <jvcelak@redhat.com> 2.4.32-1Jan Vcelak <jvcelak@redhat.com> 2.4.31-7Jan Vcelak <jvcelak@redhat.com> 2.4.31-6Jan Vcelak <jvcelak@redhat.com> 2.4.31-5Jan Vcelak <jvcelak@redhat.com> 2.4.31-4Jan Vcelak <jvcelak@redhat.com> 2.4.31-3Jan Vcelak <jvcelak@redhat.com> 2.4.31-2Jan Vcelak <jvcelak@redhat.com> 2.4.31-1Jan Vcelak <jvcelak@redhat.com> 2.4.30-3Jan Synáček <jsynacek@redhat.com> 2.4.30-2Jan Vcelak <jvcelak@redhat.com> 2.4.30-1Jan Vcelak <jvcelak@redhat.com> 2.4.29-4Jan Vcelak <jvcelak@redhat.com> 2.4.29-3Jan Vcelak <jvcelak@redhat.com> 2.4.29-2Jan Vcelak <jvcelak@redhat.com> 2.4.29-1Jan Vcelak <jvcelak@redhat.com> 2.4.28-3Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2.4.28-2Jan Vcelak <jvcelak@redhat.com> 2.4.28-1Jan Vcelak <jvcelak@redhat.com> 2.4.26-6Jan Vcelak <jvcelak@redhat.com> 2.4.26-5Jan Vcelak <jvcelak@redhat.com> 2.4.26-4Jan Vcelak <jvcelak@redhat.com> 2.4.26-3Jan Vcelak <jvcelak@redhat.com> 2.4.26-2Rex Dieter <rdieter@fedoraproject.org> - 2.4.26-1.1Jan Vcelak <jvcelak@redhat.com> 2.4.26-1Jan Vcelak <jvcelak@redhat.com> 2.4.25-1Jan Vcelak <jvcelak@redhat.com> 2.4.24-2Jan Vcelak <jvcelak@redhat.com> 2.4.24-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2.4.23-9Jan Vcelak <jvcelak@redhat.com> 2.4.23-8Jan Vcelak <jvcelak@redhat.com> 2.4.23-7Jan Vcelak <jvcelak@redhat.com> 2.4.23-6Jan Vcelak <jvcelak@redhat.com> 2.4.23-5Jan Vcelak <jvcelak@redhat.com> 2.4.23-4Jan Vcelak <jvcelak@redhat.com> 2.4.23-3Jan Vcelak <jvcelak@redhat.com> 2.4.23-2Jan Vcelak <jvcelak@redhat.com> 2.4.23-1Jan Vcelak <jvcelak@redhat.com> 2.4.22-7Jan Vcelak <jvcelak@redhat.com> - 2.4.22-6Jan Zeleny <jzeleny@redhat.com> - 2.4.22-5Jan Zeleny <jzeleny@redhat.com> - 2.4.22-4Rich Megginson <rmeggins@redhat.com> - 2.4.22-3Jan Zeleny <jzeleny@redhat.com> - 2.4.22-2Jan Zeleny <jzeleny@redhat.com> - 2.4.22-1Jan Zeleny <jzeleny@redhat.com> - 2.4.21-6Jan Zeleny <jzeleny@redhat.com> - 2.4.21-5Jan Zeleny <jzeleny@redhat.com> - 2.4.21-4Jan Zeleny <jzeleny@redhat.com> - 2.4.21-3J�x��������������F�������X�#xfJj��������������;�����e�����������������;�;�;�-6.1Tim Waugh <twaugh@redhat.com> 0.4.2-6Elliot Lee <sopwith@redhat.com>Tim Waugh <twaugh@redhat.com> 0.4.2-4.1Tim Waugh <twaugh@redhat.com> 0.4.2-4Tim Waugh <twaugh@redhat.com> 0.4.2-3Florian La Roche <Florian.LaRoche@redhat.de> 0.4.2-2Tim Waugh <twaugh@redhat.com> 0.4.2-1Tim Powers <timp@redhat.com> 0.3.2-5Tim Waugh <twaugh@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 0.3.2-4Tim Waugh <twaugh@redhat.com> 0.3.2-3Nalin Dahyabhai <nalin@redhat.com>Tim Powers <timp@redhat.com> 0.3.2-2Jakub Jelinek <jakub@redhat.com> 0.3.2-1Tim Powers <timp@redhat.com>Tim Powers <timp@redhat.com>Tim Powers <timp@redhat.com>Tim Powers <timp@redhat.com>Preston Brown <pbrown@redhat.com> 0.96-4Bernhard Rosenkraenzer <bero@redhat.com> 0.96-3Bernhard Rosenkraenzer <bero@redhat.com> 0.96-2Bernhard Rosenkraenzer <bero@redhat.com> 0.96-1Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Bernhard Rosenkraenzer <bero@redhat.com>Bernhard Rosenkraenzer <bero@redhat.com>Bernhard Rosenkraenzer <bero@redhat.com>Preston Brown <pbrown@redhat.com>Bernhard Rosenkraenzer <bero@redhat.com>Bernhard Rosenkraenzer <bero@redhat.com>Bernhard Rosenkraenzer <bero@redhat.com>Bernhard Rosenkraenzer <bero@redhat.com>Bernhard Rosenkraenzer <bero@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Prospector <bugzilla@redhat.com>Bernhard Rosenkraenzer <bero@redhat.com>Preston Brown <pbrown@redhat.com>Bernhard Rosenkraenzer <bero@redhat.com>- Rebuilt for js 48-bit VA support (#1439479)- Mass rebuild 2014-01-24- Mass rebuild 2013-12-27- update to latest upstream pre-release
- drop unneeded patches
- fix autoconf warnings
- explicitly disable using OpenSSL and GnuTLS- Rebuilt for https://fedoraproject.org/wiki/Fedora_19_Mass_Rebuild- do not delegate GSSAPI credentials (CVE-2012-4545)- add default "ddg" dumb/smart rewrite prefixes for DuckDuckGo (#856348)- fix specfile issues reported by the fedora-review script- Rebuilt for https://fedoraproject.org/wiki/Fedora_18_Mass_Rebuild- do not crash if add_heartbeat() returned NULL (#798103)- Rebuilt for https://fedoraproject.org/wiki/Fedora_17_Mass_Rebuild- improve the js-1.8.5 patch (upstream commit 218a225)- port to js-1.8.5 API (upstream commits f31cf6f and 2844f8b)- Rebuilt for https://fedoraproject.org/wiki/Fedora_15_Mass_Rebuild- do not print control characters to build logs
- avoid aclocal warnings- remove patch for configure script to find OpenSSL (we use NSS now)
- remove buildrequires for nss-devel (#550770)- add buildrequires for js-devel (#550717) and zlib-devel
- build support for 256 color terminal- Add buildrequires for gpm-devel to enable gpm support(#547064)- Add Requires(post/postun): coreutils for readlink- Rebuilt for https://fedoraproject.org/wiki/Fedora_12_Mass_Rebuild- new upstream bugfix prerelease- new upstream bugfix prerelease
- defuzz patches- try to load default NSS root certificates if the configuration option
  connection.ssl.trusted_ca_file is set to an empty string (#497788)- enable certificate verification by default via configuration
  file(#495532)- use appropriate BuildRequires for nss_compat_ossl (#495532)
- support for trusted CA certificates loading from file in PEM format- use word Elinks instead of Links in package description- new upstream bugfix prerelease
- defuzz patches- use better obsoletes/provides for links, use alternatives for
  links manpage and binary(#470703)- Rebuilt for https://fedoraproject.org/wiki/Fedora_11_Mass_Rebuild- rebuild with new openssl- versioned obsoletes and provides for links- port elinks to use NSS library for cryptography (#346861)- new upstream bugfix prerelease
- Removed already applied patches for tabreload and bittorrent- upstream fix for bittorrent protocol
- upstream fix for out of screen bittorrent dialog texts- get rid off fuzz in patches- fix a crash when opening tab during page reload- unstable elinks-0.12 pre1, solves several long-term issues 
  unsolvable (or very hard to solve) in 0.11.4 (like #173411),
�x�������������P6�������X�#�gJj���������G������X������0����������������X��8?
�d����	(�	j���������	�����(	.
4@
#2`l��:(c8l
9�
:�
G�H�I	X	Y	\	<]	H^	�b	�d
e
�f
�l
��
�
�
�

��
�
�ghCcpanel-php-ioncube12.0.21.cp110~el7IonCube Loader provides PHP Modules to read IonCube Encoded FilesIonCube Loader provides PHP Modules to read IonCube Encoded Filesc\O�bh-centos-7.dev.cpanel.net*+�IonCube LicenseDevelopment/Languageshttps://www.ioncube.comlinuxx86_64�K8,�����c\O�c\O�c\O�5095396328465632dc8a98a91886451e28a0db072d9ff05d501531f607ab285f750f407b7b23fe390c99bb2dfbc80069cac10bb15ddbec9162272ca5441bff7bf2bf42ece659446aef59375a82cac0ce812adb098463a1a5005265f75eeb3865rootrootrootrootrootrootcpanel-php-ioncube-12.0.2-1.cp110~el7.src.rpm������������cpanel-php-ioncubecpanel-php-ioncube(x86-64)




cpanel-phprpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(CompressedFileNames)rpmlib(PayloadIsXz)rpmlib(TildeInVersions)8.14.6.0-14.0-13.0.4-15.2-14.10.0-14.11.1c[�@c�a��`B@]µ�]^@]^@[;e@W�@R�@Ri�RS�O���B. McMahon <b.mcmahon@cpanel.net> - 12.0.2-1.cp110~el7B. McMahon <b.mcmahon@cpanel.net> - 12.0.1-2.cp108B. McMahon <b.mcmahon@cpanel.net> - 11.0.0-1.cp11102Nicolas Rochelemagne <nicolas.rochelemagne@cpanel.net> - 10.3.9-1.cp1198Nicolas Rochelemagne <nicolas.rochelemagne@cpanel.net> - 10.3.9-1.cp1186Thomas Baugh <thomas.baugh@cpanel.net> - 10.3.9-1.cp1184Thomas Baugh <thomas.baugh@cpanel.net> - 10.3.7-1.cp1184Julian Brown <julian.brown@cpanel.net> - 10.2.2-1.cp1176Rikus Goodell <rikus.goodell@cpanel.net> - 5.1.2-1.cp1158Michael Karr <michael.karr@cpanel.net> - 4.5.2-1.cp1142Kyle Lafkoff <kyle.lakfoff@cpanel.net> - 4.4.3-1.cp1142Nicolas Rochelemagne <nicolas.rochelemagne@cpanel.net> - 4.2.2-2.cp1136Kyle Lafkoff <kyle.lafkoff@cpanel.net> - 4.2.2-1.cp1136- Update to upstream release 12.0.2- Packaging new upstream version for PHP 8.1- Packaging new upstream version for PHP 7.4- Add Ubuntu support- Add CentOS 8 support- Updated to upstream release 10.3.9- Updated upstream and using PHP 7.3- Updated upstream and using PHP 7.2- Switch this to be an 11.58 RPM.
- Switch PHP dependency, paths, etc. from 5.4 to 5.6.
- Rename package from php54-ioncube to php56-ioncube.
- Upstream release update to 5.1.2.- Upstream release update to 4.5.2.- Upstream release to support PHP 5.4- add copyright file- Initial build of ioncube rpm12.0.2-1.cp110~el712.0.2-1.cp110~el7ioncube_loader_lin_7.4.soioncube_loader_lin_8.1.socopyright/usr/local/cpanel/3rdparty/php/unversioned/ioncube//usr/local/cpanel/3rdparty/share/php-ioncube/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches   -m64 -mtune=genericcpioxz2x86_64-redhat-linux-gnu?���
�tq�7�΁��x�PX)���4b1ca30b0c1418a4cb1fa8d1a1e27f97650d24efd6A>*.�d6A;�DB[�tI������ƥES�`
�+rj�7��915f3e8a5aeeaa3c289a77f17f2b7e78f40e4060d%�OTd%��x��������������%�������X�#�gJj�pK������p�����������������;<�t nameservers as part of metadata
  * BOO-1145: Collect cpanel service sslinfo as part of metadata
  * BOO-1139: Collect the hostname and resolution as part of metadata- CPANEL-33131: Add ModSecurity ruleset usage info- Added code to gather databases / cpanel user statistics.
- Added code to gather database users / cpanel user statistics.- CPANEL-32911: Add RPM and license data for Imunify products- CPANEL-32848: Handle exceptions caused by missing or stale mysql-db-usage datastores- CPANEL-32562: Fetch database sizes from mysql-db-usage.json datastores
  instead of MySQL's information_schema.- Need to bump minor version due to OBS issues with the versioning- CPANEL-32135: Fetch 'old_password' stats only on systems running MySQL < 5.7- CPANEL-32163: Update cPanel and Webmail icons to match WHM.- Add loading of custom modules
- Moved locale metrics to module- CPANEL-32064: Update look-and-feel and animations to match NPS survey tab.- CPANEL-31889: Changed the summary to write a special version of the index
  page if the issue is with Installatron.- CPANEL-31778: Ignore calls to specific boxtrapper html files.- HB-5318: Add cpanel-plugins RPMs to analytics- CPANEL-31606: Ignore calls to index.htm that only use the LVEInfo::start
  api.- BOO-1024: Add MySQL database size statistics- Update known pages list for DUCK-2726- CPANEL-31238: Ship PHP version per domain home- DUCK-2660: Filter API 1 usage via symlinked files so the report
only shows usage with non-cPanel integrations.- BWG-922: Add clustering information to the metadata gathered.- CPANEL-30957: Revert 'Add MySQL database size statistics' due to dependency issues.- Add MySQL database size statistics- Add cPHulk's enabled status
- Add the output of WHM API 1 load_cphulk_config- Add the existential status of /etc/allowstupidstuff
- Get the count of users where the username starts with a digit
- Get a total count of users for comparison- Fix reporting of domains without inboxes- Added way to filter the API1 calls that are built into the
  product.- Add cron script for summarizing logs
- Updated gatherer to read and send yesterdays summary log- Report disk usage, memory usage, cpu count- Report if backups and legacy backups are enabled
- Report what transport types are enabled, if any- Always report operational analytics data
- Count inboxes by domain
- Remove legacy EasyApache 3 cruft
- Track enablement of email archiving- Convert to using Moo- Updated postgresql detection to use Cpanel::PostgresUtils- Count the number of email accounts- Gather basic MX type statistics as part of the
  Update::Gatherer metadata- Remove trailing colon from timestamps
- Remove the use of Cpanel::FastInstall- Add update gatherer to cpanel-analytics- Remove dependency on cpanel-version- Fix bug where the area underneath the lightbulb is not clickable
- Make the slide-out full width for resolutions < 768px- Fix code to open the documentation link in new window- Update wording in the consent dialog
- Update the link for additional information- Record dialog dismissals as denies when there is no recorded opt-in setting- Update the cPanel include template to use app_key for page title- Update the WHM include template to use the app_key for the page title- Update Webmail analytics include to report page title and default webmail client- Use the correct tracking codes for analytics- Restrict installation of this RPM to cpanel versions greater than 74- Added a user consent widget to the cpanel, webmail, and whm templates
- Stores the user setting in nvdata for the appropriate app (cpanel, webmail, whm)
- Grabs the setting from nvdata using template toolkit
- Strip out the cpsession and just sends the path for the page and location
- Turn on the anonymize ip setting- Update the name of the RPM- Update the templates to include the OS and company ID
- Update the include point for WHM
- Update cpanel and webmail templates to grab the current style
- Update the webmail template to get the cpanel version properly- Initial commit�x�������������@�������X�#fgJj������x2�������������f���������������������,�5 and CVE-2013-1643
- make php-mysql package optional (and disabled)
- make ZTS build optional (and disabled)
- always try to load mod_php (apache warning is usefull)
- Hardened build (links with -z now option)
- Remove %config from /etc/rpm/macros.php- update to 5.4.11
- fix php.conf to allow MultiViews managed by php scripts- update to 5.4.10
- remove patches merged upstream
- drop "Configure Command" from phpinfo output
- prevent php_config.h changes across (otherwise identical)
  rebuilds- update to 5.4.9- fix php.conf- filter private shared in _httpd_modir
- improve system libzip patch to use pkg-config
- use _httpd_contentdir macro and fix php.gif path
- switch back to upstream generated scanner/parser
- use system pcre only when recent enough- improves php.conf, no need to be relocated- clarify Licenses
- missing provides xmlreader and xmlwriter
- change php embedded library soname version to 5.4- fix mysql_sock macro definition- fix standard build (non scl)- fix installed headers- use libldap_r for ldap extension- add missing scl_prefix in some provides/requires- make php-enchant optionnal, not available on RHEL-5
- make php-recode optionnal, not available on RHEL-5
- disable t1lib on RHEL-5- enable tidy on RHEL-6 only
- re-enable unit tests- minor macro fixes for RHEL-5 build
- update autotools workaround for RHEL-5
- use readline when libedit not available (RHEL-5)- update to 5.4.8
- define both session.save_handler and session.save_path
- fix possible segfault in libxml (#828526)
- use SKIP_ONLINE_TEST during make test
- php-devel requires pcre-devel and php-cli (instead of php)
- provides php-phar
- update systzdata patch to v10, timezone are case insensitive- php-fpm: create apache user if needed
- php-cli: provides cli command in standard root (scl)- add configtest option to init script
- test configuration before service reload
- fix php-fpm service relocation
- fix php-fpm config relocation
- drop embdded subpackage for scl- missing requires on scl-runtime
- relocate /var/lib/session
- fix php-devel requires
- rename, but don't relocate macros.php- initial spec rewrite for scl build- fix typo in systemd macro- php-fpm: enable PrivateTmp
- php-fpm: new systemd macros (#850268)
- php-fpm: add upstream patch for startup issue (#846858)- systemd integration, https://bugs.php.net/63085
- no odbc call during timeout, https://bugs.php.net/63171
- check sqlite3_column_table_name, https://bugs.php.net/63149- most failed tests explained (i386, x86_64)- fix for http://bugs.php.net/63126 (#783967)- patch to ensure we use latest libdb (not libdb4)- really fix rhel tests (use libzip and libdb)- fix test to enable zip extension on RHEL-7- remove session.save_path from php.ini
  move it to apache and php-fpm configuration files- update to 5.4.7
  http://www.php.net/releases/5_4_7.php
- php-fpm: don't daemonize- enable php-fpm on secondary arch (#849490)- update to 5.4.6
- update to v9 of systzdata patch
- backport fix for new libxml- update to 5.4.5- also provide php(language)%{_isa}
- define %{php_version}- drop BR for libevent (#835671)
- provide php(language) to allow version check- add missing provides (core, ereg, filter, standard)- update to 5.4.4 (CVE-2012-2143, CVE-2012-2386)
- use /usr/lib/tmpfiles.d instead of /etc/tmpfiles.d
- use /run/php-fpm instead of /var/run/php-fpm- update to 5.4.3 (CVE-2012-2311, CVE-2012-2329)- update to 5.4.2 (CVE-2012-1823)- update to 5.4.1- rebuild for new icu
- switch (conditionally) to libdb-devel- fix Loadmodule with MPM event (use ZTS if not MPM worker)
- split conf.d/php.conf + conf.modules.d/10-php.conf with httpd 2.4- rebuild for missing automatic provides (#807889)- really use _httpd_mmn- rebuild against httpd 2.4
- use _httpd_mmn, _httpd_apxs macros- update to PHP 5.4.0 finale- update to PHP 5.4.0RC8- update to PHP 5.4.0RC7
- provides env file for php-fpm (#784770)
- add patch to use system libzip (thanks to spot)
- don't provide INSTALL file- all binaries in /usr/bin with zts prefix- update to PHP �x���������������������X\#�gJj�����^0�
3t�����[����������������3t\	8�?pd�� �%�	1�	h���������	�����	
 a
dhmr���(�8�9�:�G8H<I@XDYP\l]p^{b�dHeMfPlR�l��
�����g�h�Ccpanel-perl-536-class-trigger0.151.cp108~el7CPAN module - Mixin to add / call inheritable triggersCpanel build perl module 'Class::Trigger'Mixin to add / call inheritable triggersb��)bh-centos-7.dev.cpanel.net)�perlcpanel/perlhttps://metacpan.orglinuxnoarch)ہ$^��88d06a25579a3973892e95c3cc91c5e3c67098f2a178c8c146e6e344f6061241rootrootcpanel-perl-536-class-trigger-0.15-1.cp108~el7.src.rpm����cpanel-perl(Class::Trigger)cpanel-perl-class-triggercpanel-perl-536-class-trigger




cpanel-perl-536rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(CompressedFileNames)rpmlib(PayloadIsXz)rpmlib(TildeInVersions)4.6.0-14.0-13.0.4-15.2-14.10.0-14.11.1b�@`-@_�9�[���Busy Camels <bc@cpanel.net> - 0.15-1.cp108Busy Camels <bc@cpanel.net> - 0.15-1.cp1198Todd Rinaldo <toddr@cpan.org> - 0.15-1.cp1194Todd Rinaldo <toddr@cpanel.net> - 0.14-1.cp1178- Bump to 1.cp108 for re-build- Bump to 1.cp1198 for debian re-build- Update from upstream: Class-Trigger 0.15- Update from upstream: Class-Trigger 0.140.150.150.15-1.cp108~el7Trigger.pm/usr/local/cpanel/3rdparty/perl/536/cpanel-lib/Class/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches   -m64 -mtune=genericcpioxz2noarch-redhat-linux-gnu?����X�#�o��G|�d?724f75d2be012048c512027e24b1c88ba326fe62c�VE+c�VA 5.4.7
  http://www.php.net/releases/5_4_7.php
- php-fpm: don't daemonize- enable php-fpm on secondary arch (#849490)- update to 5.4.6
- update to v9 of systzdata patch
- backport fix for new libxml- update to 5.4.5- also provide php(language)%{_isa}
- define %{php_version}- drop BR for libevent (#835671)
- provide php(language) to allow version check- add missing provides (core, ereg, filter, standard)- update to 5.4.4 (CVE-2012-2143, CVE-2012-2386)
- use /usr/lib/tmpfiles.d instead of /etc/tmpfiles.d
- use /run/php-fpm instead of /var/run/php-fpm- update to 5.4.3 (CVE-2012-2311, CVE-2012-2329)- update to 5.4.2 (CVE-2012-1823)- update to 5.4.1- rebuild for new icu
- switch (conditionally) to libdb-devel- fix Loadmodule with MPM event (use ZTS if not MPM worker)
- split conf.d/php.conf + conf.modules.d/10-php.conf with httpd 2.4- rebuild for missing automatic provides (#807889)- really use _httpd_mmn- rebuild against httpd 2.4
- use _httpd_mmn, _httpd_apxs macros- update to PHP 5.4.0 finale- update to PHP 5.4.0RC8- update to PHP 5.4.0RC7
- provides env file for php-fpm (#784770)
- add patch to use system libzip (thanks to spot)
- don't provide INSTALL file- all binaries in /usr/bin with zts prefix- update to PHP 5.4.0RC6
  https://fedoraproject.org/wiki/Features/Php54- fix systemd unit- switch to systemd- Rebuild for new libpng- rebuild with new gmp without compat lib- rebuild with new gmp- revert is_a() to php <= 5.3.6 behavior (from upstream)
  with new option (allow_string) for new behavior- add mysqlnd sub-package
- drop patch4, use --libdir to use /usr/lib*/php/build
- add patch to redirect mysql.sock (in mysqlnd)@x������������� �
@Nameamese�����������������������X�#~gJj����������=�����|�����������������=�=�DŐ?��d����	&�	P�������������	*�6�O�U\x	�
���
?b����+HLV(]8dh9h:�hG��H��I�X�Y�\�]�8^�{b��d�Ge�Lf�Ol�Qt�lu��v��w��x��������$�4
�L��x�|ńgňhŌCfirewalld-filesystem0.6.313.el7_9Firewalld directory layout and rpm macrosThis package provides directories and rpm macros which
are required by other packages that add firewalld configuration files.`�c�x86-02.bsys.centos.org�CentOSGPLv2+CentOS BuildSystem <http://bugs.centos.org>Unspecifiedhttp://www.firewalld.orglinuxnoarch�A�A�A�A�A�A큤`�c�`�c�`�c�`�c�`�c�`�c�`�c�d92b09d5cfa8449b42722b025419d0a224b79120687bcaddf6c5a489e1e40da0rootrootrootrootrootrootrootrootrootrootrootrootrootrootfirewalld-0.6.3-13.el7_9.src.rpm����������������������������firewalld-filesystem



rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)3.0.4-14.6.0-14.0-15.2-1firewalld0.3.134.11.3`x*�_Wr@^��@^��^9\�]�X�]���]nU�]QT�]QT�]>�\��[�@[v��[ug@[P}@[��Z��Z/�Z'�Z'�Y��@Y��@Y��Y�?@Y�J�Y>�@Y.�@Y;@Y	�@X��@X��X��@X�@X�@Xn5@W֘�Wί�W�u@W�@W�@W��W��@W{�@Wrf�Wj}�Wj}�Wj}�WM|�U�@U��@U�m�T��TD�@T3�T)I�Sz@S
�@S	�R�b@R�@R��R�x@R�k�Rx�R_�@RN��RM\@RL
�RIg�Q���Q��Q��@Q�y�Q��@Q�@Qn��QT0�QI��Q8�@Q$��Q�@P�@P��@P��@P� @P�p�P~��PI�P3x@P(�@P!@O�O�Oc+@Oa�OU�@OT��OC�@O1@O/��MY@M!�@M!�@ME@Eric Garver <egarver@redhat.com> - 0.6.3-13Eric Garver <egarver@redhat.com> - 0.6.3-12Eric Garver <egarver@redhat.com> - 0.6.3-11Eric Garver <egarver@redhat.com> - 0.6.3-10Eric Garver <egarver@redhat.com> - 0.6.3-9Eric Garver <egarver@redhat.com> - 0.6.3-8Eric Garver <egarver@redhat.com> - 0.6.3-7Eric Garver <egarver@redhat.com> - 0.6.3-6Eric Garver <egarver@redhat.com> - 0.6.3-5Eric Garver <egarver@redhat.com> - 0.6.3-4Eric Garver <egarver@redhat.com> - 0.6.3-3Eric Garver <egarver@redhat.com> - 0.6.3-2Eric Garver <egarver@redhat.com> - 0.6.3-1Eric Garver <egarver@redhat.com> - 0.5.3-5Eric Garver <egarver@redhat.com> - 0.5.3-4Eric Garver <egarver@redhat.com> - 0.5.3-3Eric Garver <egarver@redhat.com> - 0.5.3-2Eric Garver <egarver@redhat.com> - 0.5.3-1Eric Garver <egarver@redhat.com> - 0.4.4.4-14Eric Garver <egarver@redhat.com> - 0.4.4.4-13Eric Garver <egarver@redhat.com> - 0.4.4.4-12Phil Sutter - 0.4.4.4-11Eric Garver <egarver@redhat.com> - 0.4.4.4-10Eric Garver <egarver@redhat.com> - 0.4.4.4-9Eric Garver <egarver@redhat.com> - 0.4.4.4-8Eric Garver <egarver@redhat.com> - 0.4.4.4-7Thomas Woerner <twoerner@redhat.com> - 0.4.4.4-6Thomas Woerner <twoerner@redhat.com> - 0.4.4.4-5Thomas Woerner <twoerner@redhat.com> - 0.4.4.4-4Thomas Woerner <twoerner@redhat.com> - 0.4.4.4-3Thomas Woerner <twoerner@redhat.com> - 0.4.4.4-2Thomas Woerner <twoerner@redhat.com> - 0.4.4.4-1Thomas Woerner <twoerner@redhat.com> - 0.4.4.3-2Thomas Woerner <twoerner@redhat.com> - 0.4.4.3-1Thomas Woerner <twoerner@redhat.com> - 0.4.3.2-10Thomas Woerner <twoerner@redhat.com> - 0.4.3.2-9Thomas Woerner <twoerner@redhat.com> - 0.4.3.2-8Thomas Woerner <twoerner@red�x�������h������X#�eJj���������eQ�����z����������������Q�A�)�tem libzip (thanks to spot)
- don't provide INSTALL file- all binaries in /usr/bin with zts prefix- update to PHP 5.4.0RC6
  https://fedoraproject.org/wiki/Features/Php54- fix systemd unit- switch to systemd- Rebuild for new libpng- rebuild with new gmp without compat lib- rebuild with new gmp- revert is_a() to php <= 5.3.6 behavior (from upstream)
  with new option (allow_string) for new behavior- add mysqlnd sub-package
- drop patch4, use --libdir to use /usr/lib*/php/build
- add patch to redirect mysql.sock (in mysqlnd)- update to 5.3.8
  http://www.php.net/ChangeLog-5.php#5.3.8- update to 5.3.7
  http://www.php.net/ChangeLog-5.php#5.3.7
- merge php-zts into php (#698084)- rebuild for net-snmp SONAME bump- enable mhash extension (emulated by hash extension)- rebuild for new MySQL client library- update to 5.3.6
  http://www.php.net/ChangeLog-5.php#5.3.6
- fix php-pdo arch specific requires- disable zip extension per "No Bundled Libraries" policy (#551513)- rebuild for icu 4.6- fix systemd-units requires- add tmpfiles.d configuration for php-fpm
- add Arch specific requires/provides- Rebuilt for https://fedoraproject.org/wiki/Fedora_15_Mass_Rebuild- update to 5.3.5
  http://www.php.net/ChangeLog-5.php#5.3.5
- clean duplicate configure options- rebuild against MySQL 5.5.8
- remove all RPM_SOURCE_DIR- security patch from upstream for #660517- update to 5.3.4
  http://www.php.net/ChangeLog-5.php#5.3.4
- move phpize to php-cli (see #657812)- ghost /var/run/php-fpm (see #656660)
- add filter_setup to not provides extensions as .so- use mysql_config in libdir directly to avoid biarch build failures- rebuild for new net-snmp- add php-fpm sub-package- PHP 5.3.3 released- garbage collector upstream  patches (#580236)- rebuild for icu 4.4- PHP 5.3.2 Released!
- remove mime_magic option (now provided by fileinfo, by emu)
- add patch for http://bugs.php.net/50578
- remove patch for libedit (upstream)
- add runselftest option to allow build without test suite- update to v7 of systzdata patch- fix build with autoconf 2.6x- update to 5.3.1
- remove openssl patch (merged upstream)
- add provides for php-pecl-json
- add prod/devel php.ini in doc- use libedit instead of readline to resolve licensing issues- rebuilt with new openssl- Rebuilt for https://fedoraproject.org/wiki/Fedora_12_Mass_Rebuild- rediff systzdata patch- update to v6 of systzdata patch; various fixes- update to v5 of systzdata patch; parses zone.tab and extracts
  timezone->{country-code,long/lat,comment} mapping table- update to 5.3.0
- remove ncurses, dbase, mhash extensions
- add enchant, sqlite3, intl, phar, fileinfo extensions
- raise sqlite version to 3.6.0 (for sqlite3, build with --enable-load-extension)
- sync with upstream "production" php.ini- update to 5.2.10
- add interbase sub-package- update to 5.2.9- Rebuilt for https://fedoraproject.org/wiki/Fedora_11_Mass_Rebuild- add recode support, -recode subpackage (#106755)
- add -zts subpackage with ZTS-enabled build of httpd SAPI
- adjust php.conf to use -zts SAPI build for worker MPM- fix patch fuzz, renumber patches- drop obsolete configure args
- drop -odbc patch (#483690)- split out sysvshm, sysvsem, sysvmsg, posix into php-process- move wddx to php-xml, build curl shared in -common
- remove BR for expat-devel, bogus configure option- rebuild for new MySQL- libtool 2 workaround for phpize (#476004)
- add missing php_embed.h (#457777)- update to 5.2.8- libtool 2 workaround- update to 5.2.7
- enable pdo_dblib driver in php-mssql- tweak Summary, thanks to Richard Hughes- move gd_README to php-gd
- update to r4 of systzdata patch; introduces a default timezone
  name of "System/Localtime", which uses /etc/localtime (#469532)- enable XPM support in php-gd
- Fix BR for php-gd- enable T1lib support in php-gd- update to 5.2.6
- sync default php.ini with upstream
- drop extension_dir from default php.ini, rely on hard-coded
  default, to make php-common multilib-safe (#455091)
- update to r3 of systzdata patch- split pspell extens�x���������������������X#�eJj�������������������o�����7�����������������o:{�o�fee7f693d5528f8744f20b9b060160a7b783bd67e15bbd7350b24862e7040544cdf68f93d5528f8744f20b9b060160a7b783bd67e15bbd7350b24862e7040544cdf68f3da8b63b59986a2693099c43c03348b06e5b8037509d8efd5eb2271a859cf84f3da8b63b59986a2693099c43c03348b06e5b8037509d8efd5eb2271a859cf84fdb7b6fb511e497a594861ff0db4d4b79ac545133fb389813f27293b881bbee23db7b6fb511e497a594861ff0db4d4b79ac545133fb389813f27293b881bbee232e5d5025e0acd5fe879639b1362b87713d1202aa2ee84123a8d1a72e6773f2972e5d5025e0acd5fe879639b1362b87713d1202aa2ee84123a8d1a72e6773f297fa9545b80649680fbb3c641e9482a2e369b7fd3cc4f75e4384a00e5d9678937ffa9545b80649680fbb3c641e9482a2e369b7fd3cc4f75e4384a00e5d9678937f1b0ed364d80f1e1bbde19f8f8c3df9941f6d967b5f197fc6b92b0529d678289e1b0ed364d80f1e1bbde19f8f8c3df9941f6d967b5f197fc6b92b0529d678289eb34c838bbfb15a3fa46ac127dcbe43bf034c8189117ee9251de524433499e0b8b34c838bbfb15a3fa46ac127dcbe43bf034c8189117ee9251de524433499e0b85ffd81f85ab5f0bf7ce7d3784f99870e4c65922935d68a965d2e3cc55628f71b5ffd81f85ab5f0bf7ce7d3784f99870e4c65922935d68a965d2e3cc55628f71b3c78b11cb2c862387f598bcdf48678079dd452e723b8e4daec92d8dfbe75fc6d3c78b11cb2c862387f598bcdf48678079dd452e723b8e4daec92d8dfbe75fc6d82139462e02e683be7d27e71cd12a2a66fb34478f3c328a1d25bdf92e976fbad82139462e02e683be7d27e71cd12a2a66fb34478f3c328a1d25bdf92e976fbad5108862663b939890cfe1ab5957fedf5da73a070bc2596942c8e1490c089d39c5108862663b939890cfe1ab5957fedf5da73a070bc2596942c8e1490c089d39c1342dcb84a5fc1a956edda84f05ea8fd8dd699d74d0ef5fb8ad3644a0a7ba70f1342dcb84a5fc1a956edda84f05ea8fd8dd699d74d0ef5fb8ad3644a0a7ba70f5f3178c31087762f5d120967fb0ad85d8d4db779c61d3201a7b40a85a0319c075f3178c31087762f5d120967fb0ad85d8d4db779c61d3201a7b40a85a0319c0732fc8c56d0f5f8b07412f4c6c26f32d81f3914ce720cd6097a76b5b441a12d9b32fc8c56d0f5f8b07412f4c6c26f32d81f3914ce720cd6097a76b5b441a12d9b691e8f147e270779621f12285d08764539b041d95d46da45e498de25b32beea1691e8f147e270779621f12285d08764539b041d95d46da45e498de25b32beea1bc9e8a355f3d5b194890260ecd748bbd1544c59aca453607d9f345cedc35ab42bc9e8a355f3d5b194890260ecd748bbd1544c59aca453607d9f345cedc35ab426b13e54e6cfd9ed67d3ff2ce348d8b11263f4596e092c90345832779b62cd0cc6b13e54e6cfd9ed67d3ff2ce348d8b11263f4596e092c90345832779b62cd0cc8c5445d141afc66b464601489cd2f7638ebd6f034e36d12d2e1a7ea47852653e8c5445d141afc66b464601489cd2f7638ebd6f034e36d12d2e1a7ea47852653e95bb76aead1f20c73ac123185c068432f6cc3455721093a9b3c5e267ef46a21895bb76aead1f20c73ac123185c068432f6cc3455721093a9b3c5e267ef46a21840ec310f4f4bb886439f3d6132d4a230bf6f5bcf4111fa5d901690ec45d38bc640ec310f4f4bb886439f3d6132d4a230bf6f5bcf4111fa5d901690ec45d38bc600df2185b9de9661aa5951ea43d272e80a612de13e6f2d0428dfb9c7b9f2919600df2185b9de9661aa5951ea43d272e80a612de13e6f2d0428dfb9c7b9f29196d57a597aca6faaa62256a319f769265d40a6a030eb142724f86e1529ce4d58ebd57a597aca6faaa62256a319f769265d40a6a030eb142724f86e1529ce4d58eb752dfcdb745c3538d4ddbc393098bcc5f5b14b12ca508bb2716a305722bdac5b752dfcdb745c3538d4ddbc393098bcc5f5b14b12ca508bb2716a305722bdac5bc3f58b65660eb2de0a8a15634cc286258d1e66a5520fe0ad40a3148c506f9589c3f58b65660eb2de0a8a15634cc286258d1e66a5520fe0ad40a3148c506f9589b7f0da861ccf05e35c5e3f4843e961c496c63d25449bdc576faf919279f66173b7f0da861ccf05e35c5e3f4843e961c496c63d25449bdc576faf919279f661731e54221c877822489e55071fd03485b0529b43a29f97f137b6e0fbce69ecd8721e54221c877822489e55071fd03485b0529b43a29f97f137b6e0fbce69ecd87251b454cff0498daa34bbd921738f5c3cbb8bb1aa4be44687ac731fe80598d78951b454cff0498daa34bbd921738f5c3cbb8bb1aa4be44687ac731fe80598d789757f16a3aa7db76ab2d04bb3ddb15e1d9a3e0e67587f9e1c1d4cae1674716406757f16a3aa7db76ab2d04bb3ddb15e1d9a3e0e67587f9e1c1d4cae167471640608e0b461eea23c53c7e262892068d50fbe177f403918225ea7258f4e62e5ca2608e0b461eea23c53c7e262892068d50fbe177f403918225ea7258f4e62e5ca26da0429eb7a57b53728d8895f85a22a2f36defefac8b5f9c5f94d249dc6c539a1da0429eb7a57b53728d8895f85a22a2f36defefac8b5f9c5f94d249dc6c539a11b181031a357232064f96363edb95b456ac405b3ebc4bb7b508af197115776591b181031a357232064f96363edb95b456ac405b3ebc4bb7b508af19711577659c529d347aeb4bc1b69881cda71ecaa59d�x�������������X�������XL#�fJj�����(������s,���������������������s,3H�.�nd/56548,
	rtl-optimization/56484, rtl-optimization/56494, target/56529,
	tree-optimization/56270, tree-optimization/56521,
	tree-optimization/56539, tree-optimization/56559
  - include arm-cores.def in gcc-python-plugin on arm (#910926)
- include vxworks-dummy.h in gcc-python-plugin where needed (PR plugins/45078)- updated from trunk
  - PRs c++/10291, c++/40405, c++/52688, c++/55632, c++/55813, c++/56243,
	c++/56358, c++/56359, c++/56377, c++/56395, c++/56403, c++/56419,
	c++/56438, c++/56481, fortran/54730, fortran/56385, fortran/56416,
	fortran/56477, fortran/56491, libfortran/30162, libstdc++/56011,
	libstdc++/56012, middle-end/45472, middle-end/56077,
	middle-end/56108, middle-end/56420, middle-end/56461,
	rtl-optimization/50339, rtl-optimization/56466, sanitizer/56393,
	sanitizer/56454, target/48901, target/52500, target/52501,
	target/52550, target/54639, target/54640, target/54662, target/56444,
	target/56445, target/56455, testsuite/52641, tree-optimization/55481,
	tree-optimization/56175, tree-optimization/56294,
	tree-optimization/56310, tree-optimization/56415,
	tree-optimization/56426, tree-optimization/56443,
	tree-optimization/56448
- fnsplit fix (PR tree-optimization/56424)- updated from trunk
  - PRs asan/56330, c++/51242, c++/54276, c++/56373, libquadmath/56379,
	middle-end/55889, middle-end/56349, pch/54117,
	rtl-optimization/56348, target/52555, target/54685, target/56214,
	target/56347, tree-optimization/55334, tree-optimization/56321,
	tree-optimization/56350, tree-optimization/56366,
	tree-optimization/56381, tree-optimization/56384,
	tree-optimization/56396, tree-optimization/56398
- add BuildRequires: /usr/bin/pod2man to fix man pages generation
- don't ICE on bogus inline asm in kernel (#912857, PR inline-asm/56405)
- fix up info page building with texinfo 5.0 (PR bootstrap/56258)
- devirtualization ICE fix (PR tree-optimization/56265)- updated from trunk
  - PRs bootstrap/56327, c++/52026, c++/54922, c++/55003, c++/55220,
	c++/55223, c++/55232, c++/55582, c++/55670, c++/55680, c++/56323,
	c++/56343, fortran/53818, fortran/56224, fortran/56318,
	libstdc++/56111, lto/50494, target/55431, target/55941,
	testsuite/56138
- asan fixes (PR sanitizer/56330)
- asan speedup - use 0x7fff8000 shadow offset instead of 1LL << 44 on
  x86_64- updated from trunk
  - PRs c++/55710, c++/55879, c++/55993, c++/56135, c++/56155, c++/56285,
	c++/56291, c/44938, fortran/46952, fortran/56204, inline-asm/56148,
	libitm/55693, lto/56295, lto/56297, middle-end/56288,
	sanitizer/56128, target/52122, testsuite/56082
  - fix IRA bug that caused reload ICE on ARM (#910153, target/56184)
  - attempt harder to fold "n" constrainted asm input operands in C++
    with -O0 (#910421, c++/56302)- updated from trunk
  - PRs c++/56238, c++/56247, c++/56268, fortran/55362, libstdc++/56267,
	libstdc++/56278, libstdc++/56282, rtl-optimization/56246,
	rtl-optimization/56275, target/56043, tree-optimization/56264,
	tree-optimization/56273
- improve expansion of mem1 op= mem2 (PR rtl-optimization/56151)- updated from trunk
  - PRs bootstrap/56227, c++/56235, c++/56237, c++/56239, c++/56241,
	debug/53363, fortran/54339, fortran/55789, libstdc++/56193,
	libstdc++/56216, lto/56231, middle-end/56181,
	rtl-optimization/56195, rtl-optimization/56225, target/50678,
	target/54009, target/54131, tree-optimization/56250
  - fix Ada frontend miscompilation with profiledbootstrap (#906516,
    PR rtl-optimization/56178)
- restore parsing of ppc inline asm dialects (#909298, PR target/56256)
- fix up libiberty old regex (PR other/56245)
- fix IRA -O0 -g code debug regression (PR debug/53948)- updated from trunk
  - PRs c++/54122, c++/56177, c++/56208, debug/54793, fortran/47517,
	fortran/50627, fortran/54195, fortran/56008, fortran/56054,
	libstdc++/56202, lto/56168, middle-end/56113, middle-end/56167,
	middle-end/56217, rtl-optimization/56131, sanitizer/55617,
	target/52123, target/54601, target/55146, target/56186,
	tree-optimization/53185, tree-optimization/53342,
	tree-optimization/54386, tree-optimization/55789,
	�x�������������������X�#�gJj����@���������n�������������������ges to require php-common not php (#177821)- provide php-zend-abi (#212804)
- add /etc/rpm/macros.php exporting interface versions
- synch with upstream recommended php.ini- update to 5.2.0 (#213837)
- php-xml provides php-domxml (#215656)
- fix php-pdo-abi provide (#214281)- rebuild for curl soname bump
- add build fix for curl 7.16 API- from upstream: add safety checks against integer overflow in _ecalloc- update to 5.1.6 (security fixes)
- bump default memory_limit to 16M (#196802)- rebuild- Provide php-posix (#194583)
- only provide php-pcntl from -cli subpackage
- add missing defattr's (thanks to Matthias Saou)- move Obsoletes for php-openssl to -common (#194501)
- Provide: php-cgi from -cli subpackage- split out php-cli, php-common subpackages (#177821)
- add php-pdo-abi version export (#193202)- rebuilt for new libnetsnmp- provide mod_php (#187891)
- provide php-cli (#192196)
- use correct LDAP fix (#181518)
- define _GNU_SOURCE in php_config.h and leave it defined
- drop (circular) dependency on php-pear- update to 5.1.4- update to 5.1.3- provide php-api (#183227)
- add provides for all builtin modules (Tim Jackson, #173804)
- own %{_libdir}/php/pear for PEAR packages (per #176733)
- add obsoletes to allow upgrade from FE4 PDO packages (#181863)- bump again for double-long bug on ppc(64)- rebuilt for new gcc4.1 snapshot and glibc changes- rebuild for new libc-client soname- only build xmlreader and xmlwriter shared (#177810)- update to 5.1.2- rebuild again- rebuild for new net-snmp- enable short_open_tag in default php.ini again (#175381)- rebuilt- require net-snmp for php-snmp (#174800)- add /usr/share/pear back to hard-coded include_path (#174885)- rebuild for httpd 2.2- update to 5.1.1
- remove pear subpackage
- enable pdo extensions (php-pdo subpackage)
- remove non-standard conditional module builds
- enable xmlreader extension- rebuilt against new openssl- pear: update to XML_RPC 1.4.4, XML_Parser 1.2.7, Mail 1.1.9 (#172528)- rebuild for new libnetsnmp- update to 5.0.5
- add fix for upstream #34435
- devel: require autoconf, automake (#159283)
- pear: update to HTTP-1.3.6, Mail-1.1.8, Net_SMTP-1.2.7, XML_RPC-1.4.1
- fix imagettftext et al (upstream, #161001)- ldap: restore ldap_start_tls() function- disable RPATHs in shared extensions (#156974)- build simplexml_import_dom even with shared dom (#156434)
- prevent truncation of copied files to ~2Mb (#155916)
- install /usr/bin/php from CLI build alongside CGI
- enable sysvmsg extension (#142988)- prevent build of builtin dba as well as shared extension- split out dba and bcmath extensions into subpackages
- BuildRequire gcc-c++ to avoid AC_PROG_CXX{,CPP} failure (#155221)
- pear: update to DB-1.7.6
- enable FastCGI support in /usr/bin/php-cgi (#149596)- build /usr/bin/php with the CLI SAPI, and add /usr/bin/php-cgi,
  built with the CGI SAPI (thanks to Edward Rudd, #137704)
- add php(1) man page for CLI
- fix more test cases to use -n when invoking php- rebuild for new libpq soname- bundle from PEAR: HTTP, Mail, XML_Parser, Net_Socket, Net_SMTP
- snmp: disable MSHUTDOWN function to prevent error_log noise (#153988)
- mysqli: add fix for crash on x86_64 (Georg Richter, upstream #32282)- build shared objects as PIC (#154195)- fix PEAR installation and bundle PEAR DB-1.7.5 package- update to 5.0.4 (#153068)
- add .phps AddType to php.conf (#152973)
- better gcc4 fix for libxmlrpc- BuildRequire mysql-devel >= 4.1
- don't mark php.ini as noreplace to make upgrades work (#152171)
- fix subpackage descriptions (#152628)
- fix memset(,,0) in Zend (thanks to Dave Jones)
- fix various compiler warnings in Zend- package mysqli extension in php-mysql
- really enable pcntl (#142903)
- don't build with --enable-safe-mode (#148969)
- use "Instant Client" libraries for oci8 module (Kai Bolay, #149873)- fix build with GCC 4- install the ext/gd headers (#145891)
- enable pcntl extension in /usr/bin/php (#142903)
- add libmbfl array arithmetic fix (dcb314@hotmail.com, #143795)
- add BuildRequire for recent �x�������������H��������X�#
gJj����X��3�����p�����������������ot become wildcard (bug #769597)
- Fix NULL pointer derefernce in pcre_free_study() (upstream bug #1186)- 8.21 bump- ppc needs a larger stack similar to s390- 8.21-RC1 bump- Fix case-less match if cases differ in encoding length (bug #756675)- Fix cache-flush in JIT on PPC- Fix repeated forward reference (bug #755969)- Fix other look-behind regressions- Fix look-behind regression in 8.20- fix build on s390(x) - disable jit and use larger stack for tests- 8.20 bump- 8.20-RC3 bump- 8.20-RC2 bump- 8.20-RC1 bump with JIT- Fix infinite matching PRUNE (bug #735720)- Fix parsing named class in expression (bug #732368)- Separate utilities from libraries
- Move pcre-config(1) manual to pcre-devel sub-package
- Remove explicit defattr from spec code
- Compile pcretest with readline support- 8.13 bump: Bug-fix version, Unicode tables updated to 6.0.0, new pcregrep
  option --buffer-size to adjust to long lines, new feature is passing of
  *MARK information to callouts.
- Should fix crash back-tracking over unicode sequence (bug #691319)- Fix caseless reference matching in UTF-8 mode when the upper/lower case
  characters have different lengths (bug #702623)- Fix typos in manual pages (bugs #675476, #675477)
- Clean spec file up- Rebuilt for https://fedoraproject.org/wiki/Fedora_15_Mass_Rebuild- 8.12 bump
- Remove accepted pcre-8.11-Fix-typo-in-pcreprecompile-3.patch- 8.11 bump
- See ChangeLog for changes. Namely changes have been made to the way
  PCRE_PARTIAL_HARD affects the matching of $, \z, \Z, \b, and \B.
- Fix typo in pcreprecompile(3) manual
- Document why shared library is not under /usr- 8.10 bump (bug #612635)
- Add LICENCE to static subpackage because COPYING refers to it
- Remove useless rpath by using new libtool (simple sed does not work anymore
  because tests need to link against just-compiled library in %check phase)- Add COPYING to static subpackage
- Remove useless rpath- Rebuilt for https://fedoraproject.org/wiki/Fedora_12_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_11_Mass_Rebuild- Update to 7.8, drop upstreamed patches
- Fix destination of documentation (#427763)
- Use buildroot macro consistently
- Separate the static library, as per current Guidelines
- Satisfy rpmlint- Apply Tavis Ormandy's patch for CVE-2008-2371.- Backport patch from upstream pcre 7.6 to address buffer overflow
  caused by "a character class containing a very large number of
  characters with codepoints greater than 255 (in UTF-8 mode)"
  CVE-2008-0674, #431660
- Try re-enabling make check again.- Remove obsolete ``reqs''
- add dist tag
- update BuildRoot- bz292501, update to 7.3- 7.0- update to 6.7
- fix #217303, enable-unicode-properties
- sane stack limit- rebuild- update to 6.6
- fix multilib problem- bump again for double-long bug on ppc(64)- rebuilt for new gcc4.1 snapshot and glibc changes- rebuilt- update to 6.3- rebuild- don't print $libdir in 'pcre-config --libs' output- include LICENCE, AUTHORS in docdir
- run make check
- move %configure to %build- update to 5.0
- change License: BSD
- fix header location #64248- rebuilt- add the correct pcre license, #118781- update to 4.5- rebuilt- rebuilt- 4.4- rebuilt- update to 4.2- rebuilt- build with utf8, bug #81504- Really remove .la files- remove .la- Typo bug- Added missing so symlink- Fixed to build s390/s390x/x86_64- Fix #65009- automated rebuild- automated rebuild- rebuild- Update to 3.9- Update to 3.7- Move libpcre to /lib, grep uses it these days (#41104)- Move this to a separate package, used to be in kdesupport, but it's
  generally useful...�x����������������������X�#�fJj���������Dr�����,����������������DrOq�?/\?*�d����	,�	Q�������������	�����$	,
4DH
L\p���
P
|
(�8�X9(X:{XF(=G(PH(`I(pX(tY(�\(�](�^)$b)zc*?d*�e*�f*�l*�z*��*�*�*�,�-
/�/H/L/Pg/Th/XCea-php72-php-pgsql7.2.3411.13.13.cpanelA PostgreSQL database module for PHPThe ea-php72-php-pgsql package add PostgreSQL database support to PHP.
PostgreSQL is an object-relational database management
system that supports almost all SQL constructs. PHP is an
HTML-embedded scripting language. If you need back-end support for
PostgreSQL, you should install this package in addition to the main
php package.i��Ohou-2&EA4-production / CentOS_7cPanel, Inc.PHPDevelopment/Languageshttp://www.php.net/linuxx86_643;��	
��������i��i��i��i��ba9ac133e58220ffeabbd5b15ba305c51ce9e408471a5d3eda1d0236fa5293e0ae264c1c89b1190d7515e1a528d978f112e19dfb1f35a566fbafb722467c78ede07cb026dc8cf93a92eefe2de47f3b6580251c2ecbb9adaab5a54000addec6bd92b8aad142bcce374ca7245c338e66b8009022581d0625d64cf422143130cb91rootrootrootrootrootrootrootrootea-php72-php-7.2.34-11.13.13.cpanel.src.rpm����������������ea-php72-php_databaseea-php72-php-pdo_pgsqlea-php72-php-pgsqlea-php72-php-pgsql(x86-64)


@@@@@@@
ea-php72-php-pdoea-openssl11rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(CompressedFileNames)libc.so.6()(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libpq.so.5()(64bit)rtld(GNU_HASH)rpmlib(PayloadIsXz)7.2.34-11.13.13.cpanel1.1.1d-14.6.0-14.0-13.0.4-15.2-14.11.3h�R@f�)@e\��d,@b\@`ٹ�`B@_���_���_�]@_u�_R,@_+�_�@_�^��^��@^�2�^��@^|�@^s^�^[��^Nt�^=Q@^)��]�f@]��]��]�|@]��@]���]z3@]nU�]B�@]5�@]#0@];�]�\�@\�s@\��\��@\���\��\��\�M�\��\\�\P@@\J�@\73�\	@[�%@[��[�;@[�Q@[y[�[U�@[P}@[0�@[{@[��Z�@Z�3@ZԐ@Z�@Z���Z���Z��@ZtR�Za�ZX�@ZWQ�ZT��ZOh�Z'�Z%8�Z�@ZN�Y��Y�B@Y�@Y�Y�d�Y�*@Y��@Y���Y��Chris Castillo <chris.castillo@webpros.com> - 7.2.34-11Julian Brown <julian.brown@cpanel.net> - 7.2.34-10Tim Mullin <tim@cpanel.net> - 7.2.34-9Julian Brown <julian.brown@cpanel.net> - 7.2.34-8Travis Holloway <t.holloway@cpanel.net> - 7.2.34-7Travis Holloway <t.holloway@cpanel.net> - 7.2.34-6Cory McIntire <cory@cpanel.net> - 7.2.34-5Julian Brown <julian.brown@cpanel.net> - 7.2.34-4Daniel Muey <dan@cpanel.net> - 7.2.34-3Tim Mullin <tim@cpanel.net> - 7.2.34-2Cory McIntire <cory@cpanel.net> - 7.2.34-1Tim Mullin <tim@cpanel.net> - 7.2.33-2Cory McIntire <cory@cpanel.net> - 7.2.33-1Tim Mullin <tim@cpanel.net> - 7.2.32-2Cory McIntire <cory@cpanel.net> - 7.2.32-1Julian Brown <julian.brown@cpanel.net> - 7.2.31-3Tim Mullin <tim@cpanel.net> - 7.2.31-2Cory McIntire <cory@cpanel.net> - 7.2.31-1Cory McIntire <cory@cpanel.net> - 7.2.30-1Tim Mullin <tim@cpanel.net> - 7.2.29-2Cory McIntire <cory@cpanel.net> - 7.2.29-1Julian Brown <julian.brown@cpanel.net> - 7.2.28-2Cory McIntire <cory@cpanel.net> - 7.2.28-1Tim Mullin <tim@cpanel.net> - 7.2.27-2Cory McIntire <cory@cpanel.net> - 7.2.27-1Daniel Muey <dan@cpanel.net> - 7.2.26-2Cory McIntire <cory@cpanel.net> - 7.2.26-1Tim Mullin <tim@cpanel.net> - Hx��������������H�7��IS��0���������������������XR#�gJj8 �
;k�����S����������������;k<k:k�Elio Maldonado<emaldona@redhat.com> - 3.12.3.99.3-18Elio Maldonado<emaldona@redhat.com - 3.12.3.99.3-17Dennis Gilmore <dennis@ausil.us> - 3.12.3.99.3-16Dennis Gilmore <dennis@ausil.us> - 3.12.3.99.3-15Dennis Gilmore <dennis@ausil.us> - 3.12.3.99.3-14Dennis Gilmore <dennis@ausil.us> - 3.12.3.99.3-13Dennis Gilmore <dennis@ausil.us> - 3.12.3.99.3-12Elio Maldonado+emaldona@redhat.com - 3.12.3.99.3-11Elio Maldonado <emaldona@redhat.com> - 3.12.3.99.3-10Dennis Gilmore <dennis@ausil.us> - 3.12.3.99.3-9Elio Maldonado <emaldona@redhat.com> - 3.12.3.99.3-7.1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 3.12.3.99.3-7Elio Maldonado <emaldona@redhat.com> - 3.12.3.99.3-6Elio Maldonado <emaldona@redhat.com> - 3.12.3.99.3-5Elio Maldonado <emaldona@redhat.com> - 3.12.3.99.3-4Kai Engert <kaie@redhat.com> - 3.12.3.99.3-3Kai Engert <kaie@redhat.com> - 3.12.3.99.3-2Kai Engert <kaie@redhat.com> - 3.12.3-7Kai Engert <kaie@redhat.com> - 3.12.3-4Kai Engert <kaie@redhat.com> - 3.12.3-3Kai Engert <kaie@redhat.com> - 3.12.3-2Kai Engert <kaie@redhat.com> - 3.12.2.99.3-7Kai Engert <kaie@redhat.com> - 3.12.2.99.3-6Kai Engert <kaie@redhat.com> - 3.12.2.99.3-5Kai Engert <kaie@redhat.com> - 3.12.2.99.3-4Kai Engert <kaie@redhat.com> - 3.12.2.99.3-3Kai Engert <kaie@redhat.com> - 3.12.2.99.3-2Kai Engert <kaie@redhat.com> - 3.12.2.99.3-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 3.12.2.0-4Kai Engert <kaie@redhat.com> - 3.12.2.0-3Dennis Gilmore <dennis@ausil.us> - 3.12.1.1-4Kai Engert <kaie@redhat.com> - 3.12.1.1-3Kai Engert <kengert@redhat.com> - 3.12.1.1-2Kai Engert <kaie@redhat.com> - 3.12.1.0-2Kai Engert <kaie@redhat.com> - 3.12.0.3-7Kai Engert <kengert@redhat.com> - 3.12.0.3-6Kai Engert <kengert@redhat.com> - 3.12.0.3-3Kai Engert <kengert@redhat.com> - 3.12.0.3-2Kai Engert <kengert@redhat.com> - 3.12.0.1-1Jesse Keating <jkeating@redhat.com> - 3.11.99.5-2Kai Engert <kengert@redhat.com> - 3.11.99.5-1Kai Engert <kengert@redhat.com> - 3.11.99.4-1Kai Engert <kengert@redhat.com> - 3.11.99.3-6Kai Engert <kengert@redhat.com> - 3.11.99.3-5Kai Engert <kengert@redhat.com> - 3.11.99.3-4Kai Engert <kengert@redhat.com> - 3.11.99.3-3Kai Engert <kengert@redhat.com> - 3.11.99.3-2Kai Engert <kengert@redhat.com> - 3.11.99.3-1Kai Engert <kengert@redhat.com> - 3.11.99.2b-3Kai Engert <kengert@redhat.com> - 3.11.99.2b-2Kai Engert <kengert@redhat.com> - 3.11.99.2-2Kai Engert <kengert@redhat.com> - 3.11.99.2-1Kai Engert <kengert@redhat.com> - 3.11.7-10Rob Crittenden <rcritten@redhat.com> - 3.11.7-9Kai Engert <kengert@redhat.com> - 3.11.7-8Bob Relyea <rrelyea@redhat.com> - 3.11.7-7Kai Engert <kengert@redhat.com> - 3.11.7-6Kai Engert <kengert@redhat.com> - 3.11.7-5Kai Engert <kengert@redhat.com> - 3.11.7-4Kai Engert <kengert@redhat.com> - 3.11.7-3Kai Engert <kengert@redhat.com> - 3.11.7-2Kai Engert <kengert@redhat.com> - 3.11.5-2Kai Engert <kengert@redhat.com> - 3.11.5-1Bob Relyea <rrelyea@redhat.com> - 3.11.4-4Kai Engert <kengert@redhat.com> - 3.11.4-1Kai Engert <kengert@redhat.com> - 3.11.3-2Kai Engert <kengert@redhat.com> - 3.11.3-1Kai Engert <kengert@redhat.com> - 3.11.2-2Jesse Keating <jkeating@redhat.com> - 3.11.2-1.1Kai Engert <kengert@redhat.com> - 3.11.2-1Kai Engert <kengert@redhat.com> - 3.11.1-2Kai Engert <kengert@redhat.com> - 3.11.1-1Kai Engert <kengert@redhat.com> - 3.11-4Jesse Keating <jkeating@redhat.com> - 3.11-3.2Jesse Keating <jkeating@redhat.com> - 3.11-3.1Ray Strode <rstrode@redhat.com> 3.11-3Christopher Aillon <caillon@redhat.com> 3.11-2Christopher Aillon <caillon@redhat.com> 3.11-1Christopher Aillon <caillon@redhat.com> 3.11-0.cvs.2Christopher Aillon <caillon@redhat.com> 3.11-0.cvsKai Engert <kengert@redhat.com>Rob Crittenden <rcritten@redhat.com> 3.10-1- update to CKBI 2.82 from NSS 3.120
- updated certificates:
-     # Certificate "ePKI Root Certification Authority"
-     # Certificate "GlobalSign Root CA"
-     # Certificate "Entrust.net Premium 2048 Secure Server CA"
-     # Certificate "Comodo AAA Services roo8�������@o������H�7��IS��8�������������(o�������X#�eJj��������P��2�����+�����������������2U��1�i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i�Mi��i�Mi��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i�Mi�Mi�Mi�Mi�Mi�Mi�Mi�Mi�Mi�Mi�Mi��i�Mi��i��i��i��i�Mi��i��i��i��i��i��i��i��i��i��i�Mi��i��i��i��i��i��i��i��i��i�Mi�Mi�Mi�Mi�Mi�Mi��i�Mi��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i�Mi�Mi�Mi�Mi�Mi�Mi�Mi�Mi�Mi�Mi�Mi�Mi�Mi�Mi�Mi�Mi�Mi�Mi�Mi�Mi�Mi��i�Mi��i��i��i��i��i��i��i��i��i��i��i��i��i�Mi�Mi�Mi�Mi�Mi�Mi�Mi��i�Mi��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i�Mi�Mi�Mi�Mi�Mi�Mi�Mi�Mi�Mi��i�Mi�xi�Mi�xi�Mi�xi�Mi�xi�Mi�xi�Mi�xi�Mi�xi�Mi�xi�Mi�xi�Mi�xi�Mi�xi�Mi�xi�Mi�xi�Mi�xi�Mi�xi�Mi�xi�Mi�xi�Mi�xi�Mi�xi�Mi�xi�Mi�xi�Mi�xi�Mi�xi�Mi�xi�Mi��i�Mi�Mi�Mi�Mi�Mi�Mi�Mi�Mi�Mi�Mi�Mi�Mi�Mi�Mi�Mi�Mi�Mi�Mi�Mi�Mi�Mi�Mi�Mi��i�Mi��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i�Mi�Mi��i�Mi��i��i��i��i��i��i��i�Mi�Mi�Mi��i�Mi��i��i��i��i��i��i��i�Mi��i�Mi��i��i��i��i��i��i��i��i��i�Mi�Mi�Mi��i�Mi��i��i��i��i��i��i��i�Mi�Mi��i�Mi��i��i��i��i��i�Mi��i�Mi�Mi�Mi�Mi�Mi�Mi��i�Mi��i��i��i��i��i�Mi��i�Mi��i��i��i��i��i��i��i��i��i�Mi�Mi�Mi�Mi�Mi�Mi�Mi�Mi��i�Mi��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i�Mi�Mi�Mi�Mi�Mi�Mi�Mi�Mi�Mi�Mi�Mi�Mi�Mi�Mi�Mi�Mi�Mi�Mi�Mi�Mi�Mi�Mi�Mi�Mi�Mi�Mi�Mi�Mi�Mi�Mi�Mi�Mi��i�Mi��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i�Mi�Mi�Mi�Mi�Mi�Mi�Mi�Mi�Mi�Mi�Mi�Mi�Mi��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��i��f6d5a9fb50eda26ae8a694e7dbab4c26e63eded7a7007225a0f1faf935e78b36dfb7ca81246c7811a0d24ad1da9179f9984868f123a0b596933b00088b28017fe3b0c44298fc1c149afbf4c8996fb92427ae41e4649b934ca495991b7852b855bb2dceca73401e6d0bc4171c79ca0d931c21069675f8a62cdc17fe2e79bee664e5733134b4b18c95043b43dd52c8662eb65a83b5cfe407c80321defa60d95d28e5733134b4b18c95043b43dd52c8662eb65a83b5cfe407c80321defa60d95d28bb56df85dbf50f01df288d06f966c48673cba5dcb169a5f544612862ff9c26b6bb56df85dbf50f01df288d06f966c48673cba5dcb169a5f544612862ff9c26b6281ccb9025968d6da7dbfe3e0c05e4f55c5cd305207a07cfc97f5adeb3835995281ccb9025968d6da7dbfe3e0c05e4f55c5cd305207a07cfc97f5adeb3835995e1a01504f885454f9a428aa09503c394552d4eb93d8edaeb9c1c6ecabdcd15ebe1a01504�x������,�^�������X#bgJj����0d��������D�����Q�����������������D�D	E�5.4.16-2Remi Collet <rcollet@redhat.com> 5.4.16-1Remi Collet <rcollet@redhat.com> 5.4.14-3Remi Collet <rcollet@redhat.com> 5.4.14-2Remi Collet <rcollet@redhat.com> 5.4.14-1Remi Collet <rcollet@redhat.com> 5.4.13-1Remi Collet <rcollet@redhat.com> 5.4.11-1Remi Collet <rcollet@redhat.com> 5.4.10-1Remi Collet <rcollet@redhat.com> 5.4.9-1Remi Collet <rcollet@redhat.com> 5.4.8-7Remi Collet <rcollet@redhat.com> 5.4.8-6Remi Collet <rcollet@redhat.com> 5.4.8-5Remi Collet <rcollet@redhat.com> 5.4.8-6Remi Collet <rcollet@redhat.com> 5.4.8-4Remi Collet <rcollet@redhat.com> 5.4.8-4Remi Collet <rcollet@redhat.com> 5.4.8-3Joe Orton <jorton@redhat.com> - 5.4.8-2Remi Collet <rcollet@redhat.com> 5.4.8-3Remi Collet <rcollet@redhat.com> 5.4.8-2.1Remi Collet <rcollet@redhat.com> 5.4.8-2Remi Collet <rcollet@redhat.com> 5.4.8-1.2Remi Collet <rcollet@redhat.com> 5.4.8-1Remi Collet <rcollet@redhat.com> 5.4.7-4Remi Collet <rcollet@redhat.com> 5.4.7-3Remi Collet <rcollet@redhat.com> 5.4.7-2Remi Collet <rcollet@redhat.com> 5.4.7-1Remi Collet <remi@fedoraproject.org> 5.4.7-10Remi Collet <remi@fedoraproject.org> 5.4.7-9Remi Collet <rcollet@redhat.com> 5.4.7-8Remi Collet <rcollet@redhat.com> 5.4.7-7Remi Collet <rcollet@redhat.com> 5.4.7-6Remi Collet <rcollet@redhat.com> 5.4.7-5Remi Collet <rcollet@redhat.com> 5.4.7-4Remi Collet <rcollet@redhat.com> 5.4.7-3Remi Collet <remi@fedoraproject.org> 5.4.7-2Remi Collet <remi@fedoraproject.org> 5.4.7-1Remi Collet <remi@fedoraproject.org> 5.4.6-2Remi Collet <remi@fedoraproject.org> 5.4.6-1Remi Collet <remi@fedoraproject.org> 5.4.5-1Remi Collet <remi@fedoraproject.org> 5.4.4-4Remi Collet <remi@fedoraproject.org> 5.4.4-3Remi Collet <remi@fedoraproject.org> 5.4.4-2Remi Collet <remi@fedoraproject.org> 5.4.4-1Remi Collet <remi@fedoraproject.org> 5.4.3-1Remi Collet <remi@fedoraproject.org> 5.4.2-1Remi Collet <remi@fedoraproject.org> 5.4.1-1Joe Orton <jorton@redhat.com> - 5.4.0-6Remi Collet <remi@fedoraproject.org> 5.4.0-5Joe Orton <jorton@redhat.com> - 5.4.0-4Joe Orton <jorton@redhat.com> - 5.4.0-3Joe Orton <jorton@redhat.com> - 5.4.0-2Remi Collet <remi@fedoraproject.org> 5.4.0-1Remi Collet <remi@fedoraproject.org> 5.4.0-0.4.RC8Remi Collet <remi@fedoraproject.org> 5.4.0-0.3.RC7Remi Collet <remi@fedoraproject.org> 5.4.0-0.2.RC6Remi Collet <remi@fedoraproject.org> 5.4.0-0.1.RC6Remi Collet <remi@fedoraproject.org> 5.3.8-4.4Remi Collet <remi@fedoraproject.org> 5.3.8-4.3Adam Jackson <ajax@redhat.com> - 5.3.8-4.2Marcela Mašláňová <mmaslano@redhat.com> - 5.3.8-3.2Peter Schiffer <pschiffe@redhat.com> - 5.3.8-3.1Remi Collet <remi@fedoraproject.org> 5.3.8-3Remi Collet <remi@fedoraproject.org> 5.3.8-2Remi Collet <remi@fedoraproject.org> 5.3.8-1Remi Collet <remi@fedoraproject.org> 5.3.7-1Joe Orton <jorton@redhat.com> - 5.3.6-4Remi Collet <Fedora@famillecollet.com> 5.3.6-3Remi Collet <Fedora@famillecollet.com> 5.3.6-2Remi Collet <Fedora@famillecollet.com> 5.3.6-1Joe Orton <jorton@redhat.com> - 5.3.5-6Caolán McNamara <caolanm@redhat.com> 5.3.5-5Remi Collet <Fedora@famillecollet.com> 5.3.5-4Remi Collet <Fedora@famillecollet.com> 5.3.5-3Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 5.3.5-2Remi Collet <Fedora@famillecollet.com> 5.3.5-1Remi Collet <rpms@famillecollet.com> 5.3.4-2Remi Collet <rpms@famillecollet.com> 5.3.4-1.1Remi Collet <Fedora@famillecollet.com> 5.3.4-1Remi Collet <Fedora@famillecollet.com> 5.3.3-5Joe Orton <jorton@redhat.com> - 5.3.3-4Joe Orton <jorton@redhat.com> - 5.3.3-3Remi Collet <Fedora@famillecollet.com> 5.3.3-2Remi Collet <Fedora@famillecollet.com> 5.3.3-1Remi Collet <Fedora@famillecollet.com> 5.3.2-3Caolán McNamara <caolanm@redhat.com> 5.3.2-2Remi Collet <Fedora@famillecollet.com> 5.3.2-1Joe Orton <jorton@redhat.com> - 5.3.1-3Joe Orton <jorton@redhat.com> - 5.3.1-2Remi Collet <Fedora@famillecollet.com> 5.3.1-1Tom "spot" Callaway <tcallawa@redhat.com> - 5.3.0-7Tomas Mraz <tmraz@redhat.com> - 5.3.0-6Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 5.3.0-5Joe x�������	�M������H�7��IS��8��������������M�������X�#dfJj�������������
J�����"����������������JI�D%�?!Xd����	�	<�`�d�|�������	��������	
0�
 9Rp���9(e8l59@5:�5>f@uG�H�I�X�Y�\�]�^2bnd e 
f 
l t (u <v Pw!x!y!0	�!T!h!l#�#�
%��%�%�%�g%�h%�ClibXrandr1.5.12.el7X.Org X11 libXrandr runtime libraryX.Org X11 libXrandr runtime libraryY�Tic1bm.rdu2.centos.org��CentOSMITCentOS BuildSystem <http://bugs.centos.org>System Environment/Librarieshttp://www.x.orglinuxx86_64�`"U=����A큤��Y�TiY�TiY�TiW�_tW�_t1b5fae8f8b3a748d13ac617929c5cd6fd839ab748bf46d2b2de4860df8933c95a5a3a16b574630bd227d59030a0cdc4a1a1eaa9e072b6d488220baf4bfffe0ae73777e5be1cef2827d843e4b186803f050c66db472cf8076d88e2b5f71696e67libXrandr.so.2.2.0rootrootrootrootrootrootrootrootrootrootlibXrandr-1.5.1-2.el7.src.rpm��������������������libXrandrlibXrandr(x86-64)libXrandr.so.2()(64bit)@@@@@@@


@
/sbin/ldconfig/sbin/ldconfiglibX11libX11.so.6()(64bit)libXext.so.6()(64bit)libXrender.so.1()(64bit)libc.so.6()(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.4)(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rtld(GNU_HASH)rpmlib(PayloadIsXz)1.6.03.0.4-14.6.0-14.0-15.2-14.11.3X���X��@V�=@U�a@UX��S�@S�@S���Q��Q��@Q�J�Q�V@Q8�@Q�P1@P��O�MO�L��@J�U�Ji�@JhP�J_@I�2�I��@IH�Is�I"@H��G��G��@F���F��F)��F@E�n�E�4@Ea��D��@D�b�D��DP�@C�@C�C��@C��@C���C�q�Ct��C\�C;�@C�C	�@Benjamin Tissoires <benjamin.tissoires@redhat.com> 1.5.1-2Benjamin Tissoires <benjamin.tissoires@redhat.com> 1.5.1-1Fedora Release Engineering <releng@fedoraproject.org> - 1.5.0-3Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.5.0-2Dave Airlie <airlied@redhat.com> 1.5.0-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.4.2-2Benjamin Tissoires <benjamin.tissoires@redhat.com> 1.4.2-1.el7Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.4.1-3Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.4.1-2Peter Hutterer <peter.hutterer@redhat.com> 1.4.1-1Peter Hutterer <peter.hutterer@redhat.com> - 1.4.0-5.20130524gitc90f74497Peter Hutterer <peter.hutterer@redhat.com> 1.4.0-4.20130524gitc90f74497Peter Hutterer <peter.hutterer@redhat.com> - 1.4.0-3Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.4.0-2Dave Airlie <airlied@redhat.com> 1.4.0-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.3.1-4Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.3.1-3Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.3.1-2Adam Jackson <ajax@redhat.com> 1.3.1-1Adam Jackson <ajax@redhat.com> 1.3.0-5Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.3.0-3Adam Jackson <ajax@redhat.com> 1.3.0-2Adam Jackson <ajax@redhat.com> 1.3.0-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.2.99.4-3Adam Jackson <ajax@redhat.com> 1.2.99.4-2Adam Jackson <ajax@redhat.com> 1.2.99.4-1Adam Jackson <ajax@redhat.com> 1.2.3-3Adam Jackson <ajax@redhat.com> 1.2.3-2Adam Jackson <ajax@red�x�������������P=�������XG#�gJj������������^�������=�����v�����������������=�=�=�FirewallClientConfigServiceSettings(): destinations are dict not list
- service/zone/icmptype: do not write deprecated name attribute
- New service ntp
- firewall-config: Fixed name of about dialog
- configure.in: Fixed getting of error codes
- Added coding to all pyhton files
- Fixed copyright years
- Beautified file headers
- Force use of pygobject3 in python-slip (RHBZ#874378)
- Log: firewall.server.config_icmptype, firewall.server.config_service and
  firewall.server.config_zone: Prepend full path
- Allow ":" in interface names for interface aliases
- Add name argument to Updated and Renamed signal
- Disable IPv4, IPv6 and EB tables if missing - for IPv4/IPv6 only environments
- firewall-config.glade file cleanup
- firewall-config: loadDefaults() can throw exception
- Use toolbars for Add/Edit/Remove/LoadDefaults buttons for zones, services
  and icmp types
- New vnc-server service, opens ports for displays :0 to :3 (RHBZ#877035)
- firewall-cmd: Fix typo in help output, allow default zone usage for
  permanenent options
- Translation updates: cs, fr, ja, pt_BR and zh_CN- firewall-config: some UI usability changes
- firewall-cmd: New option --list-all-zones, output of --list-all changed,
  more option combination checks
- firewall-applet: Replaced NMClient by direct DBUS calls to fix python core
  dumps in case of connection activates/deactivates
- Use fallback 'C' locale if current locale isn't supported (RHBZ#860278)
- Add interfaces to zones again after reload
- firewall-cmd: use FirewallClient().connected value
- firewall-cmd: --remove-interface was not working due to a typo
- Do not use restorecon for new and backup files
- Fixed use of properties REJECT and DROP
- firewalld_test.py: check interfaces after reload
- Translation updates
- Renamed firewall-convert-scfw-config to firewall-offline-cmd, used by
  anaconda for firewall configuration (e.g. kickstart)
- Fix python shebang to use -Es at installation time for bin_SCRIPTS and
  sbin_SCRIPTS and at all times in gtk3_chooserbutton.py
- tests/firewalld_config.py: update test_zones() test case
- Config interface: improve renaming of zones/services/icmp_types
- Move emiting of Added signals closer to source.
- FirewallClient(): config:ServiceAdded signal was wrongly mapped
- Add argument 'name' to Removed signal
- firewall-config: Add callbacks for config:[service|icmp]-[added|removed]
- firewall-config: catch INVALID_X error when removing zone/service/icmp_type
- firewall-config: remove unused code
- Revert "Neutralize _xmlplus instead of conforming it"
- firewall-applet: some UI usability changes
- firewall-cmd: ALREADY_ENABLED, NOT_ENABLED, ZONE_ALREADY_SET are warnings- Do not apply old settings to zones after reload
- FirewallClient: Added callback structure for firewalld signals
- New firewall-config with full zone, service and icmptype support
- Added Shields Up/Down configuration dialog to firewall-applet
- Name attribute of main tag deprecated for zones, services and icmptypes,
  will be ignored if present
- Fixed wrong references in firewalld man page
- Unregister DBus interfaces after sending out the Removed signal
- Use proper DBus signature in addIcmpType, addService and addZone
- New builtin property for config interfaces
- New test case for Config interface
- spec: use new systemd-rpm macros (rhbz#850110)
- More config file verifications
- Lots of smaller fixes and enhancements- use new systemd-rpm macros (rhbz#850110)- Update of firewall-config
- Some bug fixes- New D-BUS interface for persistent configuration
- Aded support for persistent zone configuration in firewall-cmd
- New Shields Up feature in firewall-applet
- New requirements for python-decorator and pygobject3
- New firewall-config sub-package
- New firewall-convert-scfw-config config script- Fixed traceback in firewall-cmd for failed or canceled authorization, 
  return proper error codes, new error codes NOT_RUNNING and NOT_AUTHORIZED
- Enhanced firewalld service file (RHBZ#806868) and (RHBZ#811240)
- Fixed duplicates in zone after reload, enabled timed8�������	�,������H�7��IS��8��������������,�������X#�gJj�Ux8���������������������������`��an.- CPANEL-40666: Use a separate file in /etc/cron.d instead of root crontab- CPANEL-40685: Collect installed package repositories.- ART-2048: Update Customization unit tests- COBRA-13828: Stop localization of Server Profile- ART-2284: Version bump we forgot to submit with original ART-2284 change.- BC-5277: Collect additional usage metrics.- BC-5277: Collect additional usage metrics.- ART-1928 Debugging- ART-2212 Determine if and when we need to dig into the tar.gz older logs- ART-2211 Write a parser for the session log- BOO-2053: Collect database storage engine statistics.- DUCK-6788: Gather the number of demo users.- DUCK-6579: Report the CloudLinux edition.- PH-17754: Collect Content Include usage information (for Jupiter).- CPANEL-40280: Collect elevation data when upgrading to AlmaLinux 8 from CentOS 7.- CPANEL-39992: Gather license state from Cpanel::License::State preferentially.- COBRA-13690: Collect Server Profile and distributed accounts info.- PH-16817: Add a new key Jupiter to themes.- BC-4571: Track email bounce rate.- CPANEL-39138: Set analytics sample rate to 100 for trial licenses.- DUCK-6260: Collect number of virtual accounts.- CPANEL-39096: Stop relying on internal CA- DUCK-6347: Fix WordPress Toolkit usage counts- BWG-2382: Collect account migration info.- HB-6214: Enable and build package for Ubuntu- BC-4458: Collect usage of mailman lists per domain.- BWG-2522: Collect usage of "reseller without domain" creation.- ART-968: Collect the following license information as part of metadata:
  * Current license state as an identifying integer
  * Current license state in human readable form
  * Unique company ID
- ART-1012: Add support for collecting cp-license-change
  GA events to WHM Analytics when enabled for the root user.
- ART-1132: Use the cached license results rather than the last
  recorded license so we have an opportunity to update if the
  cache is expired.- ART-1080: Change license transition reporting to Google Analytics
  to use a human readable string for the transition type instead of
  a number the analyst will have to lookup each time to understand
  the context.- ART-1083: Fix bug where analytics flyout does not appear when
  there are missing Verify API helper modules.- ART-1062: Fix reliability issues for older product versions
  that are missing the new Verify API helper modules.- ART-1012: Add support for collecting cp-license-change
  GA events to WHM Analytics when enabled for the root user.
- ART-1060: Add support to run GA code on the license
  expired page.- DUCK-5312: Disable analytics flyout panel for WordPress Toolkit.- DUCK-6099: Ignore Jupiter page paths for API1 summary logs.- DUCK-5932: Run update gatherer outside of upcp.
  Introduce new script to automatically gather and send usage
  stats, and run this via cron directly, without arguments or
  requirement of being run from within upcp.- ART-947: Adjust the default GA logging to be opt-out for the
  root user in whm when they are running with a trial license.- CPANEL-37973: Use Cpanel::OS for sysinfo_config data if possible.- CPANEL-37922: Report reseller customization utilization- PH-15644: report server customization utilization- GTM-1: Add sample rate in google analytics
  config to collect sampled data in google analytics reports.
  This helps us to not cross over our 10 Million hit limit
  per month.- CPANEL-34914: Collect full active database version.- BWG-2134: Collect Z-Push daily login counts.- DUCK-4964:
    * Collect additional information on installed addon modules
    * Collect additional WordPress usage- CPANEL-35264: Fix unnecessary error thrown my licence gathering- BWG-1809: Collect CCS and Dovecot daily login counts.- CPANEL-34295
  * Add support for license ID- CPANEL-33791, HB-5795:
  * Add support for gathering tcpwrapper usage- CPANEL-33064:
  * BOO-1166: Collect hostname at install as part of metadata if possible
  * BOO-1161: Collect whether hostname is autoissued or not as part of metadata
  * BOO-1162: Collect defaul8�����X��������������H�7��IS��8���������������������X�#IgJj��������`���������������������������oreplace config file.- Make klogind pass a clean environment to children, like NetKit's rlogind does.- Don't enable the server by default.
- Compress info pages.
- Add defaults for the PAM module to krb5.conf- Correct copyright: it's exportable now, provided the proper paperwork is
  filed with the government.- apply Mike Friedman's patch to fix format string problems
- don't strip off argv[0] when invoking regular rsh/rlogin- run kadmin.local correctly at startup- pass absolute path to kadm5.keytab if/when extracting keys at startup- fix info page insertions- tweak server init script to automatically extract kadm5 keys if
  /var/kerberos/krb5kdc/kadm5.keytab doesn't exist yet
- adjust package descriptions- fix for potentially gzipped man pages- fix comments in krb5-configs- move /usr/kerberos/bin to end of PATH- install kadmin header files- patch around TIOCGTLC defined on alpha and remove warnings from libpty.h
- add installation of info docs
- remove krb4 compat patch because it doesn't fix workstation-side servers- remove hesiod dependency at build-time- rebuild on 1.1.1- clean up init script for server, verify that it works [jlkatz]
- clean up rotation script so that rc likes it better
- add clean stanza- backed out ncurses and makeshlib patches
- update for krb5-1.1
- add KDC rotation to rc.boot, based on ideas from Michael's C version- added -lncurses to telnet and telnetd makefiles- added krb5.csh and krb5.sh to /etc/profile.d- broke out configuration files- fixed server package so that it works now- started changelog (previous package from zedz.net)
- updated existing 1.0.5 RPM from Eos Linux to krb5 1.0.6
- added --force to makeinfo commands to skip errors during build/sbin/ldconfig/sbin/ldconfig/bin/sh	

 !"#$%&'()*+,-.deen���������������������1.15.1-55.el7_9.tuxcare.els21.15.1-55.el7_9.tuxcare.els21.15.1-55.el7_9.tuxcare.els2	





gssmech.dkrb5.confkrb5.conf.dkrb5pluginsauthdatakdblibkrb5preauthtlsk5tls.solibgssapi_krb5.so.2libgssapi_krb5.so.2.2libgssrpc.so.4libgssrpc.so.4.2libk5crypto.so.3libk5crypto.so.3.1libkdb5.so.8libkdb5.so.8.0libkrad.so.0libkrad.so.0.0libkrb5.so.3libkrb5.so.3.3libkrb5support.so.0libkrb5support.so.0.1krb5-libs-1.15.1NOTICEREADMEexampleskdc.confkrb5.confservices.appendkrb5-libs-1.15.1LICENSEmit-krb5.momit-krb5.mo.k5identity.5.gz.k5login.5.gzk5identity.5.gzk5login.5.gzkrb5.conf.5.gzkerberos.7.gzkerberoskrb5user/etc//etc/gss//usr/lib64//usr/lib64/krb5//usr/lib64/krb5/plugins//usr/lib64/krb5/plugins/tls//usr/share/doc//usr/share/doc/krb5-libs-1.15.1//usr/share/doc/krb5-libs-1.15.1/examples//usr/share/licenses//usr/share/licenses/krb5-libs-1.15.1//usr/share/locale/de/LC_MESSAGES//usr/share/locale/en_US/LC_MESSAGES//usr/share/man/man5//usr/share/man/man7//var//var/kerberos//var/kerberos/krb5/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches   -m64 -mtune=genericcpioxz2x86_64-redhat-linux-gnu	
z�.
�\��8�����H��
�������X#>gJj�������������������dO���������������������dO#scO�eys that it's given (still more of #761317)- apply upstream patch to fix a null pointer dereference when processing
  TGS requests (CVE-2011-1530, #753748)- correct a bug in the fix for #754001 so that the file creation context is
  consistently reset- update to 1.10 alpha 1
- on newer releases where we can assume NSS >= 3.13, configure PKINIT to build
  using NSS
- on newer releases where we build PKINIT using NSS, configure libk5crypto to
  build using NSS
- rename krb5-pkinit-openssl to krb5-pkinit on newer releases where we're
  expecting to build PKINIT using NSS instead
- during %check, run check in the library and kdc subdirectories, which
  should be able to run inside of the build system without issue- Rebuilt for glibc bug#747377- apply upstream patch to fix a null pointer dereference with the LDAP kdb
  backend (CVE-2011-1527, #744125), an assertion failure with multiple kdb
  backends (CVE-2011-1528), and a null pointer dereference with multiple kdb
  backends (CVE-2011-1529) (#737711)- pull in patch from trunk to rename krb5int_pac_sign() to krb5_pac_sign() and
  make it public (#745533)- kadmin.service: fix #723723 again
- kadmin.service,krb5kdc.service: remove optional use of $KRB5REALM in command
  lines, because systemd parsing doesn't handle alternate value shell variable
  syntax
- kprop.service: add missing Type=forking so that systemd doesn't assume simple
- kprop.service: expect the ACL configuration to be there, not absent
- handle a harder-to-trigger assertion failure that starts cropping up when we
  exit the transmit loop on time (#739853)- hardcode pid file as option in krb5kdc.service- fix pid path in krb5kdc.service- convert to systemd- pull in upstream patch for RT#6952, confusion following referrals for
  cross-realm auth (#734341)
- pull in build-time deps for the tests- switch to the upstream patch for #727829- handle an assertion failure that starts cropping up when the patch for
  using poll (#701446) meets servers that aren't running KDCs or against
  which the connection fails for other reasons (#727829, #734172)- override the default build rules to not delete temporary y.tab.c files,
  so that they can be packaged, allowing debuginfo files which point to them
  do so usefully (#729044)- build shared libraries with partial RELRO support (#723995)
- filter out potentially multiple instances of -Wl,-z,relro from krb5-config
  output, now that it's in the buildroot's default LDFLAGS
- pull in a patch to fix losing track of the replay cache FD, from SVN by
  way of Kevin Coffman- kadmind.init: drop the attempt to detect no-database-present errors (#723723),
  which is too fragile in cases where the database has been manually moved or
  is accessed through another kdb plugin- backport fixes to teach libkrb5 to use descriptors higher than FD_SETSIZE
  to talk to a KDC by using poll() if it's detected at compile-time (#701446,
  RT#6905)- pull a fix from SVN to try to avoid triggering a PTR lookup in getaddrinfo()
  during krb5_sname_to_principal(), and to let getaddrinfo() decide whether or
  not to ask for an IPv6 address based on the set of configured interfaces
  (#717378, RT#6922)
- pull a fix from SVN to use AI_ADDRCONFIG more often (RT#6923)- apply upstream patch by way of Burt Holzman to fall back to a non-referral
  method in cases where we might be derailed by a KDC that rejects the
  canonicalize option (for example, those from the RHEL 2.1 or 3 era) (#715074)- pull a fix from SVN to get libgssrpc clients (e.g. kadmin) authenticating
  using the old protocol over IPv4 again (RT#6920)- incorporate a fix to teach the file labeling bits about when replay caches
  are expunged (#576093)- switch to the upstream patch for #707145- klist: don't trip over referral entries when invoked with -s (#707145,
  RT#6915)- fixup URL in a comment
- when built with NSS, require 3.12.10 rather than 3.12.9- update to 1.9.1:
  - drop no-longer-needed patches for CVE-2010-4022, CVE-2011-0281,
    CVE-2011-0282, CVE-2011-0283, CVE-2011-0284, CVE-2011-028�x�������������p��������X�#2fJj����p2������9Y�����Q����������������9Y8Y:Y� 0.89 (fix eu-strip)- update to 0.86 (fix eu-strip on s390x/alpha)
- libebl is an archive now; remove references to DSO- upgrade to 0.84 (readelf/elflint improvements, rawhide bugs fixed).- upgrade to 0.83 (fix invalid ELf handle on *.so strip, more).- upgrade to 0.82 (strip tests fixed on big-endian).- upgrade to 0.81 (strip excludes unused symtable entries, test borked).- upgrade to 0.80 (debugedit changes for kernel in progress).- rebuilt- upgrade to 0.79 (correct formats for size_t, more of libdw "works").- upgrade to 0.78 (libdwarf bugfix, libdw additions).- debuginfo rebuild- use the correct way of identifying the section via the sh_info link.- update to 0.75 (eu-strip -g fix)- update to 0.74 (fix for writing with some non-dirty sections)- another -0.73 update (with sparc fixes).
- do "make check" in %check, not %install, section.- update to 0.73 (with s390 fixes).- rebuilt- fix arguments to gelf_getsymshndx and elf_getshstrndx
- fix other warnings
- reenable checks on s390x- temporarily disable checks on s390x, until someone has
  time to look at it- update to 0.72- update to 0.71- update to 0.69.
- add "make check" and segfault avoidance patch.
- elfutils-libelf needs to run ldconfig.- update to 0.68.- update to 0.67.- update to 0.65.- update to 0.64.- split packages further into elfutils-libelf- update to 0.63.- Adjust for dropping libtool- update to 0.59- update to 0.56- update to 0.54- update to 0.53
- drop x86_64 hack, ICE fixed in gcc-3.2-11.- get beehive to punch a rhpkg generated package.- build in 8.0.1.
- x86_64: avoid gcc-3.2 ICE on x86_64 for now.- Add libelf-devel to conflicts for elfutils-devel- Split into runtime and devel package- integrate into official sources- Swaddle.	

0.176-5.el70.176-5.el7eu-addr2lineeu-areu-elfcmpeu-elfcompresseu-elflinteu-findtextreleu-make-debug-archiveeu-nmeu-objdumpeu-ranlibeu-readelfeu-sizeeu-stackeu-stringseu-stripeu-unstripelfutils-0.176CONTRIBUTINGREADMETODOelfutils-0.176COPYINGCOPYING-GPLV2COPYING-LGPLV3/usr/bin//usr/share/doc//usr/share/doc/elfutils-0.176//usr/share/licenses//usr/share/licenses/elfutils-0.176/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches   -m64 -mtune=genericcpioxz2x86_64-redhat-linux	

ELF 64-bit LSB executable, x86-64, version 1 (SYSV), dynamically linked (uses shared libs), for GNU/Linux 2.6.32, BuildID[sha1]=6ea6d9b1f5e5271ce69317074d233723252f74bd, strippedELF 64-bit LSB executable, x86-64, version 1 (SYSV), dynamically linked (uses shared libs), for GNU/Linux 2.6.32, BuildID[sha1]=cec2313cbae3e75d0ddc2d036c360a3b74fb2c1d, strippedELF 64-bit LSB executable, x86-64, version 1 (SYSV), dynamically linked (uses shared libs), for GNU/Linux 2.6.32, BuildID[sha1]=6bbee1dcb6cb54cae9eba92627cdbe55a497dde5, strippedELF 64-bit LSB executable, x86-64, version 1 (SYSV), dynamically linked (uses shared libs), for GNU/Linux 2.6.32, BuildID[sha1]=5ed657702afdf69b4cb20ba54f9189ee0d5ec880, strippedELF 64-bit LSB executable, x86-64, version 1 (SYSV), dynamically linked (uses shared libs), for GNU/Linux 2.6.32, BuildID[sha1]=4cc7a82afac2d0c206fa31d4524de98b71106144, strippedELF 64-bit LSB executable, x86-64, version 1 (SYSV), dynamically linked (uses shared libs), for GNU/Linux 2.6.32, BuildID[sha1]=0dcbb942f4d60be13929bf9ae3a2fcd44530d7b1, strippedPOSIX shell script, ASCII text executableELF 64-bit LSB executable, x86-64, version 1 (SYSV), dynamically linked (uses shared l�x�����8��������X�#�gJjp�x����������������������������$r�MR�7t$��s�W�f�
��Yf6ʕ9L��;����&k
PR�O*ĉ���E�=�uT�?�\n�K�+y��]`J��ĥ��kS�j�r�KbE�>F0��:F+�c{��+��@��t�(!��9��]�r}���t��~6����^�輵Z[O&%,�j���a���l�o�LU.Q��j���"(�o������
��5B��Z��h#����d�J��� �m�zc-�W��dpuaR#Eb�~��l��HI�D��{L�ۜ�b�Y�:c�g�ݬO�r"vq�3X�i��@�C��r��+�o�H�����О��N��}�\t3	�Bpv�����7�t��8�f��|��+���F��X�fr|!�k�C��f��*T�'�q4{&�_-mȲ34oPC�����Z�;H�=Ⱥ�X�1�z�zW�S�*K$ƨ���9r���uU�@0[�>	��x�yL/G���go����f��v���XN���>���Z[W�#���s�:[:�٫�
G��&T�
��BX'W<K�Z�oAm�?��T0k�("�tС�ƾ�Ș��w�}-�yZ|�����v��H.#��RF�yJ��<�<���$;�9�F���sr8F)��lj���Y���nn��	����C.ϯ�&R������)��5��c�W�����zaCV��7�	��\���5�a��b<V>�(�;��^���9}:[;��i�#@=$�9��J8 �bG�a)Q_�@�zr��I��O��q�vA��=��9�	�RR�/��p��/�g�wN�	�b���WF�8�Bi�w�(�s�C������N!�Y���V��)

̙�O�!���*��b���t�}��5�ߗ�H�T��K�1�)�ڡ�'����R�&�n�qءOi�����u�M����	h��g�Vwҏ�(���9a7829338bbb7df9067579dc6845f17aeb55585ebL���@bL��rt for emulating controller temperature (Jeff Moyer) [1689002]
- [tools] testing/nvdimm: Make DSM failure code injection an override (Jeff Moyer) [1632007]
- [acpi] nfit: Prefer _DSM over _LSR for namespace label reads (Jeff Moyer) [1632007]
- [nvdimm] libnvdimm: Introduce locked DIMM capacity support (Jeff Moyer) [1632007]
- [acpi] nfit: Fix bus command validation (Jeff Moyer) [1689002]
- [acpi] nfit: fix unchecked dereference in acpi_nfit_ctl (Jeff Moyer) [1689002]
- [acpi] nfit: fix cmd_rc for acpi_nfit_ctl to always return a value (Jeff Moyer) [1689002]
- [dax] dev-dax: check_vma: ratelimit dev_info-s (Jeff Moyer) [1689002]
- [dax] Use dax_write_cache* helpers (Jeff Moyer) [1689002]
- [documentation] acpi, nfit: Remove ecc_unit_size (Jeff Moyer) [1689002]
- [documentation] acpi: nfit: document sysfs interface (Jeff Moyer) [1689002]
- [nvdimm] libnvdimm: Debug probe times (Jeff Moyer) [1689002]
- [acpi] nfit: constify *_attribute_group (Jeff Moyer) [1689002]
- [tools] testing/nvdimm: add pfn device dependency (Jeff Moyer) [1689002]
- [sched] core: Fix TASK_DEAD race in finish_task_switch() (Phil Auld) [1689789]
- [x86] mce: Handle varying MCA bank counts (David Arcari) [1693352]- [netdrv] mark the intel igc driver as tech preview (David Arcari) [1454918]
- [netdrv] igc: Remove unneeded hw_dbg prints (David Arcari) [1454918]
- [netdrv] igc: Fix the typo in igc_base.h header definition (David Arcari) [1454918]
- [netdrv] igc: Add support for the ntuple feature (David Arcari) [1454918]
- [netdrv] igc: Add support for statistics (David Arcari) [1454918]
- [netdrv] igc: Extend the ethtool supporting (David Arcari) [1454918]
- [netdrv] igc: Add multiple receive queues control supporting (David Arcari) [1454918]
- [netdrv] igc: Use struct_size() helper (David Arcari) [1454918]
- [netdrv] igc: Add ethtool support (David Arcari) [1454918]
- [netdrv] igc: Remove the 'igc_get_phy_id_base' method (David Arcari) [1454918]
- [netdrv] igc: Remove the 'igc_read_mac_addr_base' method (David Arcari) [1454918]
- [netdrv] igc: Remove unneeded code (David Arcari) [1454918]
- [netdrv] igc: Remove unused code (David Arcari) [1454918]
- [netdrv] igc: Fix code redundancy (David Arcari) [1454918]
- [netdrv] igc: Remove unreachable code from igc_phy.c file (David Arcari) [1454918]
- [netdrv] igc: Remove obsolete IGC_ERR define (David Arcari) [1454918]
- [netdrv] intel: consolidate NAPI and NAPI exit (David Arcari) [1454918]
- [netdrv] igc: Clean up code (David Arcari) [1454918]
- [netdrv] igc: Tidy up some white space (David Arcari) [1454918]
- [netdrv] igc: fix error return handling from call to netif_set_real_num_tx_queues (David Arcari) [1454918]
- [netdrv] igc: Remove set but not used variable 'pci_using_dac' (David Arcari) [1454918]
- [netdrv] igc: Remove set but not used variables 'ctrl_ext, link_mode' (David Arcari) [1454918]
- [netdrv] intel-ethernet: software timestamp skbs as late as possible (David Arcari) [1454918]
- [netdrv] igc: Add watchdog (David Arcari) [1454918�x�������������`�������X�#�gJj��������G�����K�����������������G�vvG�reu@cpanel.net> 1.3.15-1Rubber Duck <rubberduck@cpanel.net> 1.3.14-3Tim Mullin <tim@cpanel.net> 1.3.14-2Rikus Goodell <rikus.goodell@cpanel.net> 1.3.14-1Adam Wien <adam@cpanel.net> 1.3.13-3Darren Mobley <darren@cpanel.net> 1.3.13-2Rishwanth Yeddula <rish@cpanel.net> 1.3.13-1Dan Muey <dan@cpanel.net> 1.3.12-2Tom Green <tomg@cpanel.net> 1.3.12-1Marco Ferrufino <marco@cpanel.net> 1.3.11-1Chris Dillon <chris.dillon@cpanel.net> 1.3.10-1Rishwanth Yeddula <rish@cpanel.net> 1.3.9-1Cory McIntire <cory@cpanel.net> 1.3.8-1Rishwanth Yeddula <rish@cpanel.net> 1.3.7-4Phoenix <scrum.phoenix@cpanel.net> 1.3.7-3Ken Power <kenp@cpanel.net> 1.3.7-2Phoenix <scrum.phoenix@cpanel.net> 1.3.7-1Rubber Ducks <rubberduck@cpanel.net> 1.3.6-10Rubber Ducks <rubberduck@cpanel.net> 1.3.6-9Thomas Baugh <thomas.baugh@cpanel.net> 1.3.6-8Rubber Ducks <rubberduck@cpanel.net> 1.3.6-7Rishwanth Yeddula <rish@cpanel.net> 1.3.6-6Rubber Ducks <rubberduck@cpanel.net> 1.3.6-5Julian Brown <julian.brown@cpanel.net> 1.3.6-4Tom Green <tomg@cpanel.net> 1.3.6-3George Baugh <george.b@cpanel.net> 1.3.6-2Rishwanth Yeddula <rish@cpanel.net> 1.3.6-1Rishwanth Yeddula <rish@cpanel.net> 1.3.5-1Jason Kiniry <jason@cpanel.net> 1.3.4-9Jason Kiniry <jason@cpanel.net> 1.3.4-8Ken Power <kenp@cpanel.net> 1.3.4-7Tom Green <tomg@cpanel.net> 1.3.4-6Daniel Chisolm <d.chisolm@cpanel.net> 1.3.4-5Ken Power <kenp@cpanel.net> 1.3.4-4Darren Mobley <darren@cpanel.net> 1.3.4-3Ken Power <kenp@cpanel.net> 1.3.4-2Ken Power <kenp@cpanel.net> 1.3.4-1Stephen Bee <stephen@cpanel.net> 1.3.3-7Ken Power <kenp@cpanel.net> 1.3.3-6Rishwanth Yeddula <rish@cpanel.net> 1.3.3-5Joe Zhou <joe.zhou@cpanel.net> 1.3.3-4Joe Zhou <joe.zhou@cpanel.net> 1.3.3-3Joe Zhou <joe.zhou@cpanel.net> 1.3.3-2Aneece Yazdani <aneece@cpanel.net> 1.3.3-1Sruthi Sanigarapu <sruthi@cpanel.net> 1.3.2-6Aneece Yazdani <aneece@cpanel.net> 1.3.2-5Aneece Yazdani <aneece@cpanel.net> 1.3.2-4Sruthi Sanigarapu <sruthi@cpanel.net> 1.3.2-3Aneece Yazdani <aneece@cpanel.net> 1.3.2-2Sruthi Sanigarapu <sruthi@cpanel.net> 1.3.2-1Jeffrey Royer <jeffrey.royer@cpanel.net> 1.3.1-1Jeffrey Royer <jeffrey.royer@cpanel.net> 1.3.0-1Jeffrey Royer <jeffrey.royer@cpanel.net> 1.2.0-1Jeffrey Royer <jeffrey.royer@cpanel.net> 1.1.0-1Jeffrey Royer <jeffrey.royer@cpanel.net> 1.0.1-1Jeffrey Royer <jeffrey.royer@cpanel.net> 1.0.0-1- CPANEL-51783: Improve obs-cp-analytics package detection over hard-coded means- CPANEL-48884: Report on WHMCS management status in cpanel-analytics- CPANEL-51688: Gather licensed IP in update telemetry metadata- CPANEL-51619: Remove unneeded temporary domain check- CPANEL-49972: Add domain_type field to domain telemetry- CPANEL-50883: Collect contents of panel.ini- CPANEL-50197: Fix wapps_weekly missing when cache silently fails to read or write- CPANEL-49844: Improve email metrics lookup
- CPANEL-50849: Bump spec for release- CPANEL-49844: Index domains for fast lookup when populating metrics- CPANEL-49844: Adjust IMAP/POP session data.- CPANEL-49844: Add IMAP/POP session counting.- CPANEL-50364: Collect slightly more information about ConfigServer Firewall version and configuration- CPANEL-49791: Fix warnings resulting from skipping /etc/csf/cpanel.allow- CPANEL-49791: Collect information about ConfigServer Firewall configuration- CPANEL-48130: Record wappspector docroot results
- EA4-156: Move ea-wappspector dependency to cpanel-analytics
- EA4-194: remove port from domain in web traffic report- CPANEL-49507: Redirect dryrun install output so prevent confusing log entries- CPANEL-49828: Do not use cPstrict in Elevate.pm- WPX-9239: Fix an error when gathering WP2 features on non-WP2 servers.- WPX-8715: Restructure the data gathered for WP2 features- CPANEL-48300: Remove personhood input from whm, cpanel, and webmail templates
- CPANEL-49414: Remove analytics checks for root user with trial license- CPANEL-49010: Fix apt-get dry-run bug in package manager data collection.- CPANEL-46622: Record send button click event in Roundcube.- CPANEL-48479:�x���������������������X�##gJj����H��������Lv�����$����������������Lv�8?�d���!�	-�	��8�<�X�\�	a�m������	�
���
���Lh��}(�8�9�:qG	H	$I	@X	HY	�\
]
0^
nb
�doetfwly����
�����g�h�Ccpanel-perl-536-appconfig1.711.cp108~el7CPAN module - AppConfig is a bundle of Perl5 modules for reading configuration files and parsing command line arguments.Cpanel build perl module 'AppConfig'AppConfig is a bundle of Perl5 modules for reading configuration files and parsing command line arguments.b�9bh-centos-7.dev.cpanel.netEperlcpanel/perlhttps://metacpan.orglinuxnoarch~��^ 3�)�$�$�$�$�$�$�$T�pT�T�T�T�T�T�ba47e51a0e7aab5565b3e05ae70c56980fefa9c4eed503bedc9b0e4c48bb4226c04389817cf090225554555a5a5cb5e7b5e0e9c894aa972c3180aed5ea88ab220e49ddf6754a658a81b7c04a0aac05471d1dea34875b7704b5f59a4f3dc41d214a98d69ff1bcc78e5a900cce215442fd3b40339a6f07ff8919eac76a28e8610248540f928f45ac7ee61f1979e1320f5bb8cb441ebffe5b6189a5bb9632984b30ec7b28b1eb4a153f494854a582b89660e40aff43386684de687f19000bca38f5b1e6093d0d79de2f0e707d71a5a85d4175e5e29b1a66e6b5ff1650fadbf82ee1rootrootrootrootrootrootrootrootrootrootrootrootrootrootcpanel-perl-536-appconfig-1.71-1.cp108~el7.src.rpm����������������������������cpanel-perl(AppConfig)cpanel-perl(AppConfig::Args)cpanel-perl(AppConfig::CGI)cpanel-perl(AppConfig::File)cpanel-perl(AppConfig::Getopt)cpanel-perl(AppConfig::State)cpanel-perl(AppConfig::Sys)cpanel-perl-536-appconfig-argscpanel-perl-536-appconfig-cgicpanel-perl-536-appconfig-filecpanel-perl-536-appconfig-getoptcpanel-perl-536-appconfig-statecpanel-perl-536-appconfig-syscpanel-perl-appconfigcpanel-perl-appconfig-argscpanel-perl-appconfig-cgicpanel-perl-appconfig-filecpanel-perl-appconfig-getoptcpanel-perl-appconfig-statecpanel-perl-appconfig-syscpanel-perl-536-appconfig




cpanel-perl-536cpanel-perl-536-test-morerpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(CompressedFileNames)rpmlib(PayloadIsXz)rpmlib(TildeInVersions)4.6.0-14.0-13.0.4-15.2-14.10.0-14.11.1b�@`-@V<�@Q+R@Busy Camels <bc@cpanel.net> - 1.71-1.cp108Busy Camels <bc@cpanel.net> - 1.71-1.cp1198Todd Rinaldo <toddr@cpan.org> - 1.71-1.cp1156Todd Rinaldo <toddr@cpanel.net> - 1.66-1.cp1136- Bump to 1.cp108 for re-build- Bump to 1.cp1198 for debian re-build- Update from upstream: AppConfig 1.71- Update from upstream: AppConfig 1.661.711.711.711.711.711.711.711.711.711.711.711.711.711.711.711.711.711.711.711.711.71-1.cp108~el7AppConfig.pmArgs.pmCGI.pmFile.pmGetopt.pmState.pmSys.pm/usr/local/cpanel/3rdparty/perl/536/cpanel-lib//usr/local/cpanel/3rdparty/perl/536/cpanel-lib/AppConfig/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches   -m64 -mtune=genericcpioxz2noarch-redhat-linux-gnu?������nIx�^�R�/�*	lca65839d8d78da16addd5025016c2c201ebbfdf2c�VC�c�VA@cpanel.net> - 7.1.29-1Daniel Muey <dan@cpanel.net> - 7.1.28-4Tim Mullin <tim@cpanel.net> - �x�������������P��������X�#;gJj�����!�u�K�����b�����������������K�;�K�es to provide more functions
  (RT#7682, #986564/#986565)- use (a bundled, for now, copy of) nss_wrapper to let us run some of the
  self-tests at build-time in more places than we could previously (#978756)
- cover inconsistencies in whether or not there's a local caching nameserver
  that's willing to answer when the build environment doesn't have a
  resolver configuration, so that nss_wrapper's faking of the local
  hostname can be complete- specify dependencies on the same arch of krb5-libs by using the %{?_isa}
  suffix, to avoid dragging 32-bit libraries onto 64-bit systems (#980155)- special-case /run/user/0, attempting to create it when resolving a
  directory cache below it fails due to ENOENT and we find that it doesn't
  already exist, either, before attempting to create the directory cache
  (maybe helping, maybe just making things more confusing for #961235)- update to 1.11.3
  - drop patch for RT#7605, fixed in this release
  - drop patch for CVE-2002-2443, fixed in this release
  - drop patch for RT#7369, fixed in this release
- pull upstream fix for breaking t_skew.py by adding the patch for #961221- respin with updated version of patch for RT#7650 (#969331)- don't forget to set the SELinux label when creating the directory for
  a DIR: ccache
- pull in proposed fix for attempts to get initial creds, which end up
  following referrals, incorrectly trying to always use master KDCs if
  they talked to a master at any point (should fix RT#7650)- pull in patches from master to not test GSSRPC-over-UDP and to not
  depend on the portmapper, which are areas where our build systems
  often give us trouble, too- backport fix for not being able to verify the list of transited realms
  in GSS acceptors (RT#7639, #959685)
- backport fix for not being able to pass an empty password to the
  get-init-creds APIs and have them actually use it (RT#7642, #960001)
- add backported proposed fix to use the unauthenticated server time
  as the basis for computing the requested credential expiration times,
  rather than the client's idea of the current time, which could be
  significantly incorrect (#961221)- pull in upstream fix to start treating a KRB5CCNAME value that begins
  with DIR:: the same as it would a DIR: value with just one ccache file
  in it (RT#7172, #965574)- pull up fix for UDP ping-pong flaw in kpasswd service (CVE-2002-2443,- Update otp patches
- Merge otp patches into a single patch
- Add keycheck patch- pull the changing of the compiled-in default ccache location to
  DIR:/run/user/%{uid}/krb5cc back into F19, in line with SSSD and
  the most recent pam_krb5 build- correct some configuration file paths which the KDC_DIR patch missed- update to 1.11.2
  - drop pulled in patch for RT#7586, included in this release
  - drop pulled in patch for RT#7592, included in this release
- pull in fix for keeping track of the message type when parsing FAST requests
  in the KDC (RT#7605, #951843) (also #951965)- move the compiled-in default ccache location from the previous default of
  FILE:/tmp/krb5cc_%{uid} to DIR:/run/user/%{uid}/krb5cc (part of #949588)- Update otp backport patches (libk5radius => libkrad)- when testing the RPC library, treat denials from the local portmapper the
  same as a portmapper-not-running situation, to allow other library tests
  to be run while building the package- create and own /var/kerberos/krb5/user instead of /var/kerberos/kdc/user,
  since that's what the libraries actually look for
- add buildrequires on nss-myhostname, in an attempt to get more of the tests
  to run properly during builds
- pull in Simo's patch to recognize "client_keytab" as a key type which can
  be passed in to gss_acquire_cred_from() (RT#7598)- pull up Simo's patch to mark the correct mechanism on imported GSSAPI
  contexts (RT#7592)
- go back to using reconf to run autoconf and autoheader (part of #925640)
- add temporary patch to use newer config.guess/config.sub (more of #925640)- fix a version comparison to expect newer texlive build requirements when
  %{_�x�������������ȧ�������X'#�gJj���� B(�������qA���������������������qA�m�T�anel.net> - 5.5.22-6Darren Mobley <darren@cpanel.net> 5.5.22-5Darren Mobley <darren@cpanel.net> 5.5.22-4S. Kurt Newman <kurt.newman@cpanel.net> 5.5.22-3Dan Muey <dan@cpanel.net> 5.5.22-2S. Kurt Newman <kurt.newman@cpanel.net> - 5.5.22-1S. Kurt Newman <kurt.newman@cpanel.net> - 5.5.22-0Trinity Quirk <trinity.quirk@cpanel.net> - 5.5.6-14Jan Kaluza <jkaluza@redhat.com> - 5.5.6-13Remi Collet <rcollet@redhat.com> - 5.5.6-12Remi Collet <rcollet@redhat.com> - 5.5.6-11Remi Collet <rcollet@redhat.com> - 5.5.6-10Remi Collet <rcollet@redhat.com> - 5.5.6-9Remi Collet <rcollet@redhat.com> - 5.5.6-8Remi Collet <rcollet@redhat.com> - 5.5.6-7Remi Collet <rcollet@redhat.com> - 5.5.6-6Remi Collet <rcollet@redhat.com> - 5.5.6-5Remi Collet <rcollet@redhat.com> - 5.5.6-4Remi Collet <rcollet@redhat.com> 5.5.6-3Remi Collet <rcollet@redhat.com> 5.5.6-2Remi Collet <rcollet@redhat.com> 5.5.6-0Remi Collet <rcollet@redhat.com> 5.5.5-1Remi Collet <rcollet@redhat.com> 5.5.4-1Remi Collet <rcollet@redhat.com> 5.5.3-1Remi Collet <rcollet@redhat.com> 5.5.1-1Remi Collet <rcollet@redhat.com> 5.4.16-6Remi Collet <rcollet@redhat.com> 5.4.16-5Remi Collet <rcollet@redhat.com> 5.4.16-4Remi Collet <rcollet@redhat.com> - 5.4.16-3Remi Collet <rcollet@redhat.com> 5.4.16-2Remi Collet <rcollet@redhat.com> 5.4.16-1Remi Collet <rcollet@redhat.com> 5.4.14-3Remi Collet <rcollet@redhat.com> 5.4.14-2Remi Collet <rcollet@redhat.com> 5.4.14-1Remi Collet <rcollet@redhat.com> 5.4.13-1Remi Collet <rcollet@redhat.com> 5.4.11-1Remi Collet <rcollet@redhat.com> 5.4.10-1Remi Collet <rcollet@redhat.com> 5.4.9-1Remi Collet <rcollet@redhat.com> 5.4.8-7Remi Collet <rcollet@redhat.com> 5.4.8-6Remi Collet <rcollet@redhat.com> 5.4.8-5Remi Collet <rcollet@redhat.com> 5.4.8-6Remi Collet <rcollet@redhat.com> 5.4.8-4Remi Collet <rcollet@redhat.com> 5.4.8-4Remi Collet <rcollet@redhat.com> 5.4.8-3Joe Orton <jorton@redhat.com> - 5.4.8-2Remi Collet <rcollet@redhat.com> 5.4.8-3Remi Collet <rcollet@redhat.com> 5.4.8-2.1Remi Collet <rcollet@redhat.com> 5.4.8-2Remi Collet <rcollet@redhat.com> 5.4.8-1.2Remi Collet <rcollet@redhat.com> 5.4.8-1Remi Collet <rcollet@redhat.com> 5.4.7-4Remi Collet <rcollet@redhat.com> 5.4.7-3Remi Collet <rcollet@redhat.com> 5.4.7-2Remi Collet <rcollet@redhat.com> 5.4.7-1Remi Collet <remi@fedoraproject.org> 5.4.7-10Remi Collet <remi@fedoraproject.org> 5.4.7-9Remi Collet <rcollet@redhat.com> 5.4.7-8Remi Collet <rcollet@redhat.com> 5.4.7-7Remi Collet <rcollet@redhat.com> 5.4.7-6Remi Collet <rcollet@redhat.com> 5.4.7-5Remi Collet <rcollet@redhat.com> 5.4.7-4Remi Collet <rcollet@redhat.com> 5.4.7-3Remi Collet <remi@fedoraproject.org> 5.4.7-2Remi Collet <remi@fedoraproject.org> 5.4.7-1Remi Collet <remi@fedoraproject.org> 5.4.6-2Remi Collet <remi@fedoraproject.org> 5.4.6-1Remi Collet <remi@fedoraproject.org> 5.4.5-1Remi Collet <remi@fedoraproject.org> 5.4.4-4Remi Collet <remi@fedoraproject.org> 5.4.4-3Remi Collet <remi@fedoraproject.org> 5.4.4-2Remi Collet <remi@fedoraproject.org> 5.4.4-1Remi Collet <remi@fedoraproject.org> 5.4.3-1Remi Collet <remi@fedoraproject.org> 5.4.2-1Remi Collet <remi@fedoraproject.org> 5.4.1-1Joe Orton <jorton@redhat.com> - 5.4.0-6Remi Collet <remi@fedoraproject.org> 5.4.0-5Joe Orton <jorton@redhat.com> - 5.4.0-4Joe Orton <jorton@redhat.com> - 5.4.0-3Joe Orton <jorton@redhat.com> - 5.4.0-2Remi Collet <remi@fedoraproject.org> 5.4.0-1Remi Collet <remi@fedoraproject.org> 5.4.0-0.4.RC8Remi Collet <remi@fedoraproject.org> 5.4.0-0.3.RC7Remi Collet <remi@fedoraproject.org> 5.4.0-0.2.RC6Remi Collet <remi@fedoraproject.org> 5.4.0-0.1.RC6Remi Collet <remi@fedoraproject.org> 5.3.8-4.4Remi Collet <remi@fedoraproject.org> 5.3.8-4.3Adam Jackson <ajax@redhat.com> - 5.3.8-4.2Marcela Mašláňová <mmaslano@redhat.com> - 5.3.8-3.2Peter Schiffer <pschiffe@redhat.com> - 5.3.8-3.1Remi Collet <remi@fedoraproject.org> 5.3.8-3Remi Collet <remi@fedoraproject.org> 5.3.8-2Remi Collet <remi@fedoraproject.org> 5.3.8-1Remi Collet <remi@fedoraproject.org> 5.3.7-1Joe O�x�������������@��������X�#�gJj�������}<�����T����������������<;�B0X?+�d����	"�	b�������������	�*�W�]d�	
T��
�	X	�
�
�Ld�(8 %9�%:%G$H$�I%X%(Y%0\%H]%�^(bb(�d)(e)-f)0l)2t)Lu)�v*<w*�x+(y+��+�+�+�-�-�
/��0(0,0Lg0Ph0TCkeyutils-libs-devel1.5.83.el7Development package for building Linux key management utilitiesThis package provides headers and libraries for building key utilities.S�j�worker1.bsys.centos.orgrCentOSGPLv2+ and LGPLv2+CentOS BuildSystem <http://bugs.centos.org>System Environment/Basehttp://people.redhat.com/~dhowells/keyutils/linuxx86_64R.�*?t���
%R��@�v.�������������������������������������������������������������S�j�S�j�S�j�S�j�S�j�S�j�S�j�S�j�S�j�S�j�S�j�S�j�S�j�S�j�S�j�S�j�S�j�S�j�S�j�S�j�S�j�S�j�S�j�S�j�S�j�S�j�S�j�S�j�S�j�S�j�a5cca5ae3b959e49662905a35c96bf66b2b83d2c8ed8164e597d628a616d0f4f844b5e9543e865d1a5820599cb5738564e3ab61bd5c949df4468e2a3b3a7b1411dc5b602d512cf2f885f916003ca664dc8a14aeeb78e656f0f72e7232d50a67b2b22b7d82666c555e7f5f790fbb6c85e66a86cd247cc4ccbe9af65f3028692f1387845bc1f0111515c291c73f3dca011d88145c30efafb469d92204c2ca78782c298d303c52da476d28c98b9cb610e5996c6b764c9fb1bd8d81e127ea196f1b59b377222da009f1562c94cca65bbd956719c9057a17fa93588f62949faf5ffaf6baa5143bdbbdb4dd8289b170007ff65b5ad5f9de1bc72f5f9ae5eb15d1104d5074d323e98d896d72ef30fd130f3ac6431002487712cd819dfe73f39958f6bd5a4320008ae6af40451904a9292d42ef6726a93514efbed6bff29115f85e1edf0b2d188f7872291cfec5e9236a7c89afecdbb604b0223790553584689d1f3038d24eee4b675a4545b42053fb6aea9018eabde6e5589be9a766d20d3ba14b83ba8482acf5a71c59da9d4ef5ed6bac9d54a2a8ed6f8283ab043ff0670d5cff6b29667ebae49c1261e0629a134c48f700372cfd6548c897179047628287f691c07225553ba7ccbe4cba6eda768e70b9ed26b174c9661ae783972994278d9c2530c213740befefb577a2c1d7152b292f1d659f7f457e7c840d71470870031684f19cd07339fc721961aeda7c4b6a100927ca73fe5a973290a33d332c0004482cdc123e03fbf2e1d7248b51e8a4c6f54f3e3dfa02d50d025cfc09a1b6a76b623a89dc356ff266b1616badb2d395c36cde7f7b2fb7a19b884d588030c88259fee5d73f102a7574242137fea7bc45810a6d6ba1050890e0cdb838941ec406a4d0f2083f6/lib64/libkeyutils.so.1keyctl_instantiate.3.gzkeyctl_describe.3.gzkeyctl_get_security.3.gzkeyctl_instantiate.3.gzkeyctl_instantiate.3.gzkeyctl_read.3.gzkeyctl_instantiate.3.gzkeyctl_link.3.gzrecursive_key_scan.3.gzrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootkeyutils-1.5.8-3.el7.src.rpm������������������������������������������������������������������������������������������������������������������������keyutils-libs-develkeyutils-libs-devel(x86-64)@



keyutils-libslibkeyutils.so.1()(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rp�x�����U���������XQ#afJj��������8�������������������������v
ELF 64-bit LSB executable, x86-64, version 1 (SYSV), dynamically linked (uses shared libs), for GNU/Linux 2.6.32, BuildID[sha1]=0xfa25ac05b170cbf921174b3b430b5bdf9d4d7f4a, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=0xf6e76b040a01c7c08b698fba4ed499d5207443ae, strippeddirectoryPascal source, ASCII texttroff or preprocessor input, ASCII text (gzip compressed data, from Unix, max compression)RRRRRRR
R	R
RRRPPPPPPRRRRRRRR
RR?���`�d�S�&$ƨ���b��Mb�
���\��)�=�2k�7��t�k�'���������[�"n�
+9%�PJpec�؝��'����e���z�D�o�5���\<��k�7���Q_��|N�r�}kͯ���M~�:�|�$Ƒ���H���Nj
�
,�Ѳo�C�f�M��ܢ�ע��Ɲ������c��jE3N�!��j�lWɋϞ<B�1�`����OX#����]mb~|��v��NV�}��!Wd�����5�
	�����O��z�>c��ڢK�_�6YPD؃��+
�z�e�Mj��"Y��Kry_�
EǓ���g��A�Q"@B{�!���]/DXb��X���}w]���p���l�Ka|nP��[�]H��Ɛ��S�$��\�8���B�o���BZ25>�}�խq��҃&bN�U�S�ve�l9�ٙ|{)ՏZo��w��O"�[�ھ`����,���/��a��R����z5�FT�/�{g�u7��5}�)�S'�L=���Kwu'G!��n!
�D>#��"���S�&$ƨ������>f͏��Gq;���Q�WK��5�� ⧜�3���n#ؽ2:�Gޞ�.�Ǯ4M(�g����J�_Ԥ������f���*���/�M����MW|9qۯ~��
YD_˵�$e#��p��D��xoc��$%�a_�X��.�y�#�'x�
l�֓��^N���i�������逝/D���%��c#s��i���x?=�o&]?_�~�%t`���{�,h&0��L�2//:�*u�
7db���r�x��xZ�I�,�4~��H(�`3�̠
	t�-&�n�'	4sf$�j��_F��Lh8H�biS��
��(���U}BƭE�*K}u��w�dw��T/��"�G(Q�4�/�u���� a¨�,�]�.+?��z��4��7sE[��%�f�r�p�)�� E-��4�q���>g����zT�$�8�U,gK�"TH��p�v'aB��<�`�]ɘznʤF��~���;I�mK��#�)W�r&��T���+b��֧�t}�1780d6ea886cb5857ee0fdf19dcd7f138618b2f4bL��0bL��so u�INIS.gz�3INIS-CYRILLIC.sor�INIS-CYRILLIC.gz�o	INIS-8.so�	INIS-8.gz�-IEC_P27-1.so-�IEC_P27-1.gz� 
IBM9448.so bi�d	IBM943.so�u	IBM939.so�i	IBM937.so�h	IBM935.so�f	IBM933.so�-	IBM932.so�r	IBM930.so�n	IBM922.so�	IBM922.gz� 	IBM921.so� 	IBM918.so�	IBM918.gz�e
IBM9066.socon�d	IBM905.so�	IBM905.gz�-	IBM904.so�	IBM904.gz�n
IBM9030.sobin� 	IBM903.so�	IBM903.gz�x	IBM902.so�l	IBM901.so�o	IBM891.so�	IBM891.gz� 	IBM880.so�	IBM880.gz�p	IBM875.so�	IBM875.gz� 	IBM874.so�	IBM874.gz�
	IBM871.so�	IBM871.gz�n	IBM870.so�	IBM870.gz�t	IBM869.so�	IBM869.gz�h	IBM868.so�	IBM868.gz�aIBM866NAV.so
�IBM866NAV.gz�d	IBM866.so�	IBM866.gz�a	IBM865.so�	IBM865.gz�E	IBM864.so�	IBM864.gz�e	IBM863.so�	IBM863.gz�x�������������0v�������Xc#�eJj����x 
�Bw���������������������w9�{��                        !!""##$$$$$$$$#%%&&&&&&&&%%%###''((((((((((((((((((((((((((((((((((((((((((''''''''''''''''''''))************)))))++,,,,,,,,,,,,,,,,,,,,,,,,,,+++++++++++------------------------------------------------+.....................++//000000000000000000///1122222211//3344�x��������������e�������X�#\fJj������������������������������������������@redhat.com>Erik Troan <ewt@redhat.com>Elliot Lee <sopwith@redhat.com> 0.8-2Erik Troan <ewt@redhat.com>Erik Troan <ewt@redhat.com>- Mass rebuild 2014-01-24- Mass rebuild 2013-12-27- add missing whiptail options to help and man page- fix errors found by gcc-with-cpychecker (#800075)
- fix building with tcl8.6 (#902561)
- add fallback to python-config (#783627)
- replace tabs in snack.py (#870647)
- compile snackmodule.c with flag -fPIC (Kang Kai)
- include new translations from transifex
- allow newtWinMenu and newtWinEntries with no buttons or items
- don't draw scale when not mapped
- build with large-file support for stat64
- remove unused variables in test code
- update FSF address
- remove obsolete macros
- make some dependencies arch-specific- Rebuilt for https://fedoraproject.org/wiki/Fedora_19_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_18_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_17_Mass_Rebuild- fix returning strings in whiptail and whiptcl (#752818)
- fix configure to work with multiple python versions (#737998)- add support for changing colors in individual labels, scrollbars, entries,
  textboxes and scales, add custom colorsets 
- add support for NEWT_COLORS and NEWT_COLORS_FILE variables (#689903)
- allow resizing of form
- fix errors found by coverity
- fix va_list usage (Gwenole Beauchesne)
- fix building and installing on Mac OS X (#652479)
- check for slang.h header, support DESTDIR variable, add --without-python
  option (Otavio Salvador)
- add Persian, Low German translations- Rebuilt for https://fedoraproject.org/wiki/Fedora_15_Mass_Rebuild- don't hang in form when stdin disappears- fix whiptail --gauge and its description in man page (#620083)
- remove space after \n in whiptail texts (#620083)
- remove NLS code from snack (#599608)
- expose more keys to python as shortcuts in dialogs (Jakob Kemi)
- release python global-thread-lock during dialog displays (Jakob Kemi)
- fix warnings in whiptcl.c and include Tcl_PkgProvide() call (Mikhail T.)
- don't NULL deref when an invalid array is specified in checkboxtree
  (Arnaldo Carvalho de Melo)- Rebuilt for https://fedoraproject.org/wiki/Features/Python_2.7/MassRebuild- Change python_sitearch macro to use %global as the new rpm will break
  using %define here, see:
  https://www.redhat.com/archives/fedora-devel-list/2010-January/msg00093.html- fix buffer overflow in textbox when reflowing (#523955, CVE-2009-2905)
- use full textbox width when reflowing and allow minimal width 1
- fix writing lines longer than width in textbox
- don't use va_list in newtvwindow more than once (#523696)
- bind \E[Z to back-tab in built-in keymap (#468046)
- terminate string after reading file in whiptail
- add newtRadioSetCurrent function (Thomas Jarosch)
- add pkgconfig support (Thomas Jarosch)
- add Malay, Malayalam, Assamese, Gujarati, Bengali India, Kannada, Telugu
  translations
- include tutorial in txt format
- include debian patches
  - fix crash in textbox SetText when topLines != 0
  - don't link modules with libraries already linked with libnewt
  - add Asturian and Marathi translations- Rebuilt for https://fedoraproject.org/wiki/Fedora_12_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_11_Mass_Rebuild- Rebuild for Python 2.6- improve --noitem description (#456305)
- add setHeight to Textbox class
- fix fixedheight forms
- free keymap in newtFinished()
- fix memory leak in textbox
- fix valgrind error in checkboxtree
- don't crash when running empty form
- don't crash or hang when form has no focusable elements
- before checkboxtree drawing return first item in GetCurrent()
- redraw textbox in SetText()
- add setColor description to SnackScreen docstring (Greg Swift)
- make sure Widget isn't used directly (Greg Swift) (#452920)
- add Serbian translations (Miloš Komarčević)
- add Balochi translation (Mostafa Daneshvar)- handle component destruction (patch by Richard W.M. Jones)
- fix newtWinEntry definition
- don't use uninitialized values in newtWinMenu
�x������������� U�������X#
gJj�e������s�����������������_get_stringnumber.3.gzpcre_get_stringtable_entries.3.gzpcre_get_substring.3.gzpcre_get_substring_list.3.gzpcre_jit_exec.3.gzpcre_jit_stack_alloc.3.gzpcre_jit_stack_free.3.gzpcre_maketables.3.gzpcre_pattern_to_host_byte_order.3.gzpcre_refcount.3.gzpcre_study.3.gzpcre_utf32_to_host_byte_order.3.gzpcre_version.3.gzrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootpcre-8.32-17.el7.src.rpm��������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������pcre-develpcre-devel(x86-64)pkgconfig(libpcre)pkgconfig(libpcre16)pkgconfig(libpcre32)pkgconfig(libpcrecpp)pkgconfig(libpcreposix)@@@@@@@@



/bin/sh/usr/bin/pkg-configlibpcre.so.1()(64bit)libpcre16.so.0()(64bit)libpcre32.so.0()(64bit)libpcrecpp.so.0()(64bit)libpcreposix.so.0()(64bit)pcre(x86-64)pkgconfig(libpcre)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)8.32-17.el73.0.4-14.6�x��������������D�������X#�gJj����l D������������������������������an Zeleny <jzeleny@redhat.com> - 2.4.21-2Jan Zeleny <jzeleny@redhat.com> - 2.4.21-1Jan Zeleny <jzeleny@redhat.com> - 2.4.19-3Jan Zeleny <jzeleny@redhat.com> - 2.4.19-2Jan Zeleny <jzeleny@redhat.com> - 2.4.19-1Jan Zeleny <jzeleny@redhat.com> 2.4.18-4Jan Zeleny <jzeleny@redhat.com> 2.4.18-3Jan Zeleny <jzeleny@redhat.com> 2.4.18-2Jan Zeleny <jzeleny@redhat.com> 2.4.18-1Jan Zeleny <jzeleny@redhat.com> 2.4.16-7Jan Zeleny <jzeleny@redhat.com> 2.4.16-6Tomas Mraz <tmraz@redhat.com> - 2.4.16-5Jan Zeleny <jzeleny@redhat.com> 2.4.16-4Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2.4.16-2Jan Zeleny <jzeleny@redhat.com> 2.4.16-1Jan Zeleny <jzeleny@redhat.com> 2.4.15-4Jan Zeleny <jzeleny@redhat.com> 2.4.15-3Jan Zeleny <jzeleny@redhat.com> 2.4.15-2Jan Safranek <jsafranek@redhat.com> 2.4.15-1Jan Safranek <jsafranek@redhat.com> 2.4.14-1Tomas Mraz <tmraz@redhat.com> 2.4.12-3Caolán McNamara <caolanm@redhat.com> 2.4.12-2Jan Safranek <jsafranek@redhat.com> 2.4.12-1Jan Safranek <jsafranek@redhat.com> 2.4.11-3Jan Safranek <jsafranek@redhat.com> 2.4.11-2Jan Safranek <jsafranek@redhat.com> 2.4.11-1Jan Safranek <jsafranek@redhat.com> 2.4.10-2Jan Safranek <jsafranek@redhat.com> 2.4.10-1Jan Safranek <jsafranek@redhat.com> 2.4.9-5Jan Safranek <jsafranek@redhat.com> 2.4.9-4Jan Safranek <jsafranek@redhat.com> 2.4.8-4Jan Safranek <jsafranek@redhat.com> 2.4.8-3Jan Safranek <jsafranek@redhat.com> 2.4.8-2Jan Safranek <jsafranek@redhat.com> 2.4.8-1Jan Safranek <jsafranek@redhat.com> 2.4.7-7Jan Safranek <jsafranek@redhat.com> 2.4.7-6Jan Safranek <jsafranek@redhat.com> 2.4.7-5Jan Safranek <jsafranek@redhat.com> 2.4.7-4Jan Safranek <jsafranek@redhat.com> 2.4.7-3Jan Safranek <jsafranek@redhat.com> 2.4.7-2Jan Safranek <jsafranek@redhat.com> 2.4.7-1Jan Safranek <jsafranek@redhat.com> 2.4.6-1Jan Safranek <jsafranek@redhat.com> 2.3.39-1Jan Safranek <jsafranek@redhat.com> 2.3.38-4Jan Safranek <jsafranek@redhat.com> 2.3.38-3Jan Safranek <jsafranek@redhat.com> 2.3.38-2Jan Safranek <jsafranek@redhat.com> 2.3.38-1Jan Safranek <jsafranek@redhat.com> 2.3.37-3Jan Safranek <jsafranek@redhat.com> 2.3.37-2Jan Safranek <jsafranek@redhat.com> 2.3.37-1Jan Safranek <jsafranek@redhat.com> 2.3.34-7Jan Safranek <jsafranek@redhat.com> 2.3.34-6Jan Safranek <jsafranek@redhat.com> 2.3.34-5Jan Safranek <jsafranek@redhat.com> 2.3.34-4Jan Safranek <jsafranek@redhat.com> 2.3.34-3Jan Safranek <jsafranek@redhat.com> 2.3.34-2Jay Fenlason <fenlason<redhat.com> 2.3.34-1Thomas Woerner <twoerner@redhat.com> 2.3.30-1.1Jay Fenlason <fenlason@redhat.com> 2.3.30-1Jay Fenlason <fenlason@redhat.com> 2.3.28-1Jesse Keating <jkeating@redhat.com> - 2.3.27-4Jay Fenlason <fenlason@redhat.com> 2.3.27-3Jay Fenlason <fenlason@redhat.com> 2.3.27-2Jesse Keating <jkeating@redhat.com> - 2.3.24-2.1Jay Fenlason <fenlason@redhat.com> 2.3.24-2Jay Fenlason <fenlason@redhat.com> 2.3.21-2Jay Fenlason <fenlason@redhat.com> 2.3.19-4Jesse Keating <jkeating@redhat.com> - 2.3.19-3.1Jay Fenlason <fenlason@redhat.com> 2.3.19-3Jesse Keating <jkeating@redhat.com> - 2.3.19-2.1Jay Fenlason <fenlason@redhat.com> 2.3.19-2Jesse Keating <jkeating@redhat.com>Jay Fenlason <fenlason@redhat.com> 2.3.11-3Jay Fenlason <fenlason@redhat.com> 2.3.11-2Tomas Mraz <tmraz@redhat.com> 2.2.29-3Jay Fenlason <fenlason@redhat.com> 2.2.29-2Jay Fenlason <fenlason@redhat.com> 2.2.28-2Jay Fenlason <fenlason@redhat.com> 2.2.26-2Jay Fenlason <fenlason@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 2.2.26-1Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 2.2.25-1Nalin Dahyabhai <nalin@redhat.com> 2.2.24-1Nalin Dahyabhai <nalin@redhat.com> 2.2.23-4Nalin Dahyabhai <nalin@redhat.com> 2.2.23-3Tomas Mraz <tmraz@redhat.com> 2.2.23-2Nalin Dahyabhai <nalin@redhat.com> 2.2.23-1Nalin Dahyabhai <nalin@redhat.com> 2.2.20-1Nalin Dahyabhai <nalin@redhat.com> 2.2.17-0Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 2.2.13-2Nalin Dahyabh�x�����`4�������X@#�fJj���������:�v�����*�����������������v��3H�t GCC_COLORS=
  in the environment- update from the 4.8 branch
  - PRs c++/58273, libstdc++/58415, middle-end/58377, rtl-optimization/58365,
	target/58314, target/58361, target/58382, tree-optimization/58385
- add arm_neon.h on aarch64 (#1007490)- update from the 4.8 branch
  - PRs c++/58325, libstdc++/58302, libstdc++/58341, middle-end/57656,
	other/12081, target/57735, tree-optimization/57521,
	tree-optimization/57685, tree-optimization/58010,
	tree-optimization/58223, tree-optimization/58228,
	tree-optimization/58246, tree-optimization/58277,
	tree-optimization/58364- update from the 4.8 branch
  - PRs c++/58083, c++/58119, c++/58190, fortran/57798, fortran/58185,
	middle-end/56977, middle-end/57381, middle-end/58257, target/56979,
	target/57865, target/57927, target/58218, tree-optimization/57343,
	tree-optimization/57396, tree-optimization/57417,
	tree-optimization/58006, tree-optimization/58164,
	tree-optimization/58165, tree-optimization/58209
- fix up x86-64 -mcmodel=large -fpic TLS GD and LD model
  (#994244, PR target/58067)
- power8 fusion support fixes (#731884, PR target/58160)- update from the 4.8 branch
  - PRs c++/57825, c++/57901, c++/57981, c++/58022, fortran/57435,
	fortran/58058, libstdc++/56627, libstdc++/57914, libstdc++/58098,
	middle-end/58041, rtl-optimization/57459, rtl-optimization/57708,
	rtl-optimization/57878, sanitizer/56417, target/51784, target/57516,
	target/58067, target/58132, tree-optimization/57980
- power8 fusion support (#731884)
- fix up ABI alignment patch (#947197)
- fix up SRA with volatile struct accesses (PR tree-optimization/58145)- update from the 4.8 branch
  - PRs target/55656, target/55657
  - update to Go 1.1.1
- backport power8 HTM support from trunk (#731884)
- backport s390 zEC12 HTM support from trunk- update from the 4.8 branch
  - PRs c++/57437, c++/57526, c++/57532, c++/57545, c++/57550, c++/57551,
	c++/57645, c++/57771, c++/57831, fortran/57785,
	rtl-optimization/57829, target/56102, target/56892, target/56987,
	target/57506, target/57631, target/57736, target/57744,
	target/57777, target/57792, target/57844
- backport some raw-string literal handling fixes (#981029,
  PRs preprocessor/57757, preprocessor/57824)
- improve convert_to_* (PR c++/56493)
- tune for power7 on RHEL7- update from the 4.8 branch
  - PRs c++/53211, c++/56544, driver/57652, libstdc++/57619, libstdc++/57666,
	libstdc++/57674, rtl-optimization/57518, target/57623, target/57655,
	tree-optimization/57358, tree-optimization/57537
  - fix up gcc-{ar,nm,ranlib} (#974853, PR driver/57651)
- fix two libitm HTM handling bugs (PR libitm/57643)
- speed up __popcount[sdt]i2 library function (PR middle-end/36041)
- backport power8 support from trunk (#731884, PR target/57615)
- for Fedora 20+ test -fstack-protector-strong during %check instead
  of -fstack-protector- update from the 4.8 branch
  - PRs fortran/57364, fortran/57508, target/56547, target/57379, target/57568
- backport backwards compatible alignment ABI fixes (#947197, PR target/56564)
- fix up widening multiplication vectorization on big-endian
  (PR tree-optimization/57537)- update from the 4.8 branch
  - GCC 4.8.1 release
  - PRs c++/56930, c++/57319, fortran/57217, target/49146, target/56742
- backport Intel Silvermont enablement and tuning from trunk
- backport 3 small AMD improvement patches from trunk- update from the 4.8 branch
  - std::chrono::steady_clock ABI fixes from 4.8.0-7- update from the 4.8 branch
  - PRs c++/57016, c++/57317, c++/57325, c++/57388, libffi/56033,
	libstdc++/57336, middle-end/57344, middle-end/57347, plugins/56754,
	rtl-optimization/57341, target/56732, target/57356,
	tree-optimization/57303, tree-optimization/57318,
	tree-optimization/57321, tree-optimization/57330, tree-ssa/57385
  - std::chrono::steady_clock now really steady- update from the 4.8 branch
  - PRs c++/56782, c++/56998, c++/57041, c++/57196, c++/57243, c++/57252,
	c++/57253, c++/57254, c++/57274, c++/57279, middle-end/57251,
	rtl-optimization/57281, rtl-optimization/57300, target/45359,
	target/46396, tar�x��������������#�������XC#gJj�������������[�6�����-�����������������6�6�DL?�d��$�*�	6�	o���,�0�	:�P�������	
4�
$Lt��� �(8 94:f>�@�B�G$HDIdXlYpZ�[�\�]�^	b
ad
�e
�fltu<v\w�x�����
�48@gDhHCcpanel-php81-date-holidays-brazil0.1.21.cp110~el7PEAR: Driver based class to calculate holidays in BrazilDate_Holidays helps you calculate the dates and titles of holidays and
other special celebrations. This is the driver for calculating holidays in
Brazil.ci}!bh-centos-7.dev.cpanel.net-�PHP v3.01Development/Librarieshttp://pear.php.net/package/Date_Holidays_Brazillinuxnoarchecho /usr/local/cpanel/3rdparty/php/81/lib/pear/Date_Holidays_Brazil.xml >> /var/cpanel/.pending_pear_registrations# Only remove PEAR registry entry if this is a plain uninstall. For upgrades, leave it in place.
if [ x$1 = x0 ]; then echo pear.php.net/Date_Holidays_Brazil >> /var/cpanel/.pending_pear_deregistrations ; fi

#���A�A�A큤A�A큤H�fci}!ci}!ci}!ci}!ci}!ci}!ci}!e70eec8b222b2d2d3978dd03ab17e0257e5c77aa86fdac63da7f84bd138659870917b83b355f3fa6974434f1a119f97f59d1b4d0e36b85b2e66c7bd1b230bf5ee3b0c44298fc1c149afbf4c8996fb92427ae41e4649b934ca495991b7852b855rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootcpanel-php81-date-holidays-brazil-0.1.2-1.cp110~el7.src.rpm��������������������������������cpanel-php81-date-holidays-brazil




/bin/sh/bin/shcpanel-php81cpanel-php81cpanel-php81cpanel-php81-date-holidaysrpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rpmlib(TildeInVersions)3.0.4-14.6.0-14.0-15.2-14.10.0-14.11.1c_��a��`OL@[D��Q�M�B. McMahon <b.mcmahon@cpanel.net> - 0.1.2-1.cp110~el7B. McMahon <b.mcmahon@cpanel.net> - 0.1.2-1.cp11102Nicolas Rochelemagne <nicolas.rochelemagne@cpanel.net> - 0.1.2-1.cp1198Julian Brown <julian.brown@cpanel.net> - 0.1.2-1.cp1176Nicolas Rochelemagne <nicolas.rochelemagne@cpanel.net> - 0.1.2-1.cp1142- Packaging for PHP v8.1- Packaging for PHP v7.4- Rename package and add Ubuntu support- Updated to PHP 7.2.create first rpm version/bin/sh/bin/shcpanel-php74-date-holidays-brazil0.1.2-1.cp110~el7Date_Holidays_Brazil.xmlDateHolidaysDriverBrazil.phpdocscpanel-php81-date-holidays-brazil-0.1.2nodocs/usr/local/cpanel/3rdparty/php/81/lib/pear//usr/local/cpanel/3rdparty/php/81/lib/php//usr/local/cpanel/3rdparty/php/81/lib/php/Date//usr/local/cpanel/3rdparty/php/81/lib/php/Date/Holidays//usr/local/cpanel/3rdparty/php/81/lib/php/Date/Holidays/Driver//usr/share/doc//usr/share/doc/cpanel-php81-date-holidays-brazil-0.1.2/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches   -m64 -mtune=genericcpioxz2noarch-redhat-linux-gnuXML document textdirectoryC++ source, UTF-8 Unicode textempty�x��������������������X#�gJj�����P1��������k��������������������eld does not work (#733073)
- new feature: honor priority/weight with ldap_domain2hostlist (#733078)
- manpage fix: wrong ldap_sync_destroy() prototype in ldap_sync(3) manpage (#717722)- Rebuilt for rpm (#728707)- rebase to new upstream release
- fix: memleak in tlsm_auth_cert_handler (#717730)- rebase to new upstream release
- change default database type from BDB to HDB
- enable ldapi:/// interface by default
- set cn=config management ACLs for root user, SASL external schema (#712495)
- fix: server scriptlets require initscripts package (#716857)
- fix: connection fails if TLS_CACERTDIR doesn't exist but TLS_REQCERT
  is set to 'never' (#716854)
- fix: segmentation fault caused by double-free in ldapexop (#699683)
- fix: segmentation fault of client tool when input line in LDIF file
  is splitted but indented incorrectly (#716855)
- fix: segmentation fault of client tool when LDIF input file is not terminated
  by a new line character (#716858)- new: system resource limiting for slapd using ulimit
- fix update: openldap can't use TLS after a fork() (#636956)
- fix: possible null pointer dereference in NSS implementation
- fix: openldap-servers upgrade hangs or do not upgrade the database (#664433)- rebase to 2.4.24
- BDB backend switch from DB4 to DB5- Rebuilt for https://fedoraproject.org/wiki/Fedora_15_Mass_Rebuild- fix update: openldap can't use TLS after a fork() (#636956)- fix: openldap can't use TLS after a fork() (#636956)
- fix: openldap-server upgrade gets stuck when the database is damaged (#664433)- fix: some server certificates refused with inadequate type error (#668899)
- fix: default encryption strength dropped in switch to using NSS (#669446)
- systemd compatibility: add configuration file (#656647, #668223)- initscript: slaptest with '-u' to skip database opening (#667768)
- removed slurpd options from sysconfig/ldap
- fix: verification of self issued certificates (#657984)- Mozilla NSS - implement full non-blocking semantics
  ldapsearch -Z hangs server if starttls fails (#652822)
- updated list of all overlays in slapd.conf (#655899)
- fix database upgrade process (#656257)- add support for multiple prefixed Mozilla NSS database files in TLS_CACERTDIR
- reject non-file keyfiles in TLS_CACERTDIR (#652315)
- TLS_CACERTDIR precedence over TLS_CACERT (#652304)
- accept only files in hash.0 format in TLS_CACERTDIR (#650288)
- improve SSL/TLS trace messages (#652818)- fix possible infinite loop when checking permissions of TLS files (#641946)
- removed outdated autofs.schema (#643045)
- removed outdated README.upgrade
- removed relics of migrationtools- rebase to 2.4.23
- embeded db4 library removed
- removed bogus links in "SEE ALSO" in several man-pages (#624616)- Mozilla NSS - delay token auth until needed (#616552)
- Mozilla NSS - support use of self signed CA certs as server certs (#614545)- CVE-2010-0211 openldap: modrdn processing uninitialized pointer free (#605448)
- CVE-2010-0212 openldap: modrdn processing IA5StringNormalize NULL pointer dereference (#605452)
- obsolete configuration file moved to /usr/share/openldap-servers (#612602)- another shot at previous fix- fixed issue with owner of /usr/lib/ldap/__db.* (#609523)- added ldif.h to the public api in the devel package
- added -lldif to the public api
- added HAVE_MOZNSS and other flags to use Mozilla NSS for crypto- rebuild with connectionless support (#587722)
- updated autofs schema (#584808)- rebased to 2.4.22 (mostly bugfixes, added back-ldif, back-null testing support)
- due to some possible issues pointed out in last update testing phase, I'm
  pulling back the last change (slapd can't be moved since it depends on /usr
  possibly mounted from network)- moved slapd to start earlier during boot sequence- minor corrections of init script (#571235, #570057, #573804)- fixed SIGSEGV when deleting data using hdb (#562227)- fixed broken link /usr/sbin/slapschema (#559873)- removed some static libraries from openldap-devel (#556090)- rebased openldap to 2.4.21
- rebased bdb to 4.8.26- mino�x�������������x�������X#gJj�Y
�
`����������������������`�a��E� <jorton@redhat.com> 5.0.4-8Joe Orton <jorton@redhat.com> 5.0.4-7Joe Orton <jorton@redhat.com> 5.0.4-6Joe Orton <jorton@redhat.com> 5.0.4-5Joe Orton <jorton@redhat.com> 5.0.4-4Joe Orton <jorton@redhat.com> 5.0.4-3Joe Orton <jorton@redhat.com> 5.0.4-2Joe Orton <jorton@redhat.com> 5.0.4-1Joe Orton <jorton@redhat.com> 5.0.3-5Joe Orton <jorton@redhat.com> 5.0.3-4Joe Orton <jorton@redhat.com> 5.0.3-3Joe Orton <jorton@redhat.com> 5.0.3-2Joe Orton <jorton@redhat.com> 5.0.3-1Joe Orton <jorton@redhat.com> 5.0.2-8Joe Orton <jorton@redhat.com> 5.0.2-7Joe Orton <jorton@redhat.com> 5.0.2-6Joe Orton <jorton@redhat.com> 5.0.2-5Joe Orton <jorton@redhat.com> 5.0.2-4Joe Orton <jorton@redhat.com> 5.0.1-4Joe Orton <jorton@redhat.com> 5.0.1-3Joe Orton <jorton@redhat.com> 5.0.1-2Joe Orton <jorton@redhat.com> 5.0.1-1Tom Callaway <tcallawa@redhat.com>Tom Callaway <tcallawa@redhat.com>- EA4-136: Fix libxml2 v2.15.0 compatibility- ZC-12167: Correct libxml2 problem- EA-11821: Patch to build with the latest ea-libxml2- ZC-10950: Fix build problems- ZC-10936: Clean up Makefile and remove debug-package-nil- EA-10532: Update litespeed to 8.0.1- ZC-9589: Update DISABLE_BUILD to match OBS- EA-9013: Disable %check section- EA-9625: Update litespeed to 7.9- EA-9390: Fix build with latest ea-brotli (v1.0.9)- EA-9281: Update litespeed from upstream to 7.8- EA-9189: Update litespeed from upstream to 7.7- EA-8928: Updated the required version for ea-libcurl- ZC-6270: Fix circular deps like EA-8854- ZC-6247: Deal with rpm conflicts with php-fpm and other rpms- EA-8762: Update litespeed from upstream to 7.6- ZC-4361: Fix bogus changelog dates- EA-8549: Build php-fpm with pcntl- EA-8576: Update litespeed from upstream to 7.5- EA-8558: Update litespeed from upstream to 7.4.2- EA-8538: Update litespeed from upstream to 7.4- ZC-5036: Add find-latest-version (assumes PHP is checked out next ro ea-tools)- EA-8342: Update litespeed to new upstream update of 7.3- EA-8342: Update litespeed to 7.3- EA-8170: Update litespeed to the latest version (7.2)- Fixed php-fpm installing directories it does not own (EA-7526)- EA-7359: Ensure ea-libxml2 is listed as a requirement for the php-xml package.- ZC-3601: Update litespeed to the latest version (7.1).- EA-7382: Update dependency on ea-openssl to require the latest version with versioned symbols.- ZC-3552: Added versioning to ea-openssl and ea-libcurl requirements.- ZC-3475: Update for ea-openssl shared object- HB-3287: Increase open file limit for php-fpm by default- HB-3263: Ensure securetmp is done before starting FPM- EA-7044: Adjust PHPs to use ea-libxml2- HB-3061: Fix epoll bug.- EA-7008: init openssl for FTP like 7.x does- EA-6812: build PHP against ea-openssl like Apache- EA-4653: Update mail header patch for PHP 5.5- HB-2873: Added network-online.target to "After" in the service file- EA-6819: Patch to support libtidy 5.4.0- EA-4197: make php.ini directives consistent w/ other versions- EA-6574: Make permissions on FPM socket dir more secure- EA-6484: Clarify Summary and Description for DSO- EA-6232: Build -curl with HTTP/2 support- EA-6292: Switch libxml2 to OS provided libraries- EA-6282: Swapped ea-php## symlinks to match EasyApache 3 compatibility- Switch libxml2 to cPanel distributed packages- EA-6063: Add ea-php55 binary symlinks to /usr/bin and /usr/local/bin- Disable dtrace functionality since CentOS does not provide dtrace via repos.- EA-6203: Correct OpCache blacklist directory- EA-6031: Enable mssql option and use our ea-freetds instead of freetds- ZC-2475: PHPs need build reqs when building for libcurl- EA-2422: Have PHPs use our ea-libcurl- EA-5946: force requirement of ea-libtidy instead of .so from BuildRequires ea-libtidy-devel- EA-5839: Add opcache.validate_permission to opcache ini- EA-5807: enable php-tidy on rhel 6 and above- EA-3685: do not create apache user/group since we use nobody- Fix erronous getpwnam message in php-fpm jailshell code- Ensure the same extensions are compiled staticall�x�������������������Xv#�gJj��������������������i�����D�����������������i�i�v�cdb85d3833cb2067123acc95bcc747d0a61bae3ed78c10cb4dbc1799084d89688653f40c9de8305389a502cdf090b87a9970a90d4d3404a6c3daea10b9fd09ee0c90074f49b89a582ada92889d4f9fe2b2c4e91aa136d8bc11cd40a7be21fcbcb2add26766d1eabf66d247cac01596c8eb8cae64b2d9b06cc3b7b6ba152608252af8d71c0c195c93890b86f1625294a78e4171e2c3038ba1e3e16d0a37b35e10d49cff334ad970287f9457546268c94e5715e2652e76bd2c74e9f4f8c5a1c3a857c224c92a39844c7c318ffa2dba912629762906197a84ced61e6c93cc932c96d5e05b310132c1e0dba9c5094de162757eed09becaf59ffc807fdafc2323307525439a4ea0c45b6a99ba9fe0f1fd28d2e1aa777dc65dbb41e7a6b567ddbb919abb3ed82ea96ee30cd819cf188d97a50b9d29754b699ce3c8a417fcf38888d211dc929d2cbc0992d07236a598220bf60aa4a076a1b8ce3bcad23b9748856469254d8a1f106cec9db35ee3f3fa8d926bfdcd6a5f9598cc9b5e199c3ba1e3254c68851234fe5df72492264fd07925b735e405a34d2216fe67237c1fd3a8639a2798679467c4938a2c9a18b1f8f8940815a982732539e22836acc9c46d90fdfda55e76f63838a7bcc2e6ec06cded7b38c6fb3d9204e68cbaa9c629f54487d5/var/cpanel/customizations/ui-analytics/var/cpanel/customizations/ui-analytics/var/cpanel/customizations/ui-analyticsrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootcpanel-analytics-1.4.59-3.3.1.cpanel.src.rpm������������������������������������������������������������������������������������������������������������������������������������������������������������cpanel-analytics	



cpanel-perlea-wappspector/bin/sh/bin/sh/bin/sh/bin/shrpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(CompressedFileNames)rpmlib(PayloadIsXz)4.6.0-14.0-13.0.4-15.2-14.11.3i��@i�{�i�5�i��i��isb�if3�iRm@iC�iAI�i6��i T@i�i�@iv�i<@i�@h��@h�h@h��@h��@h��@h�
@h�!@h��@h���hx�ho�@hnY�hH@hH@h8L@h�h�@hm�g���g�g��@g��@g�/@g��@gd
�gV�gG	�gDf�g=�@g=�@g=�@g=�@g=�@g=�@g=�@g=�@g<}�g3C@gp@g�@f�5�f�)@f��f�@f�I�f��@f��@fy_�fl0�fE�@fD��f0�@f�f�@f
��e�r�e��e�,�e�Z�e�	@e�e�}@e�d@e��@e�z@e]�@eV@eT��e'�e0@d�i�d�D@d�df@df@dd��dcp@d^*@d[�@dT�dS�@dRL�d?�d6�@d5K�d-b�d%y�d�d@c�U@c�@cƍ�c�/�c�F�c�F�c�F�c��@c�@c�@c�i@c��cD	@c47@c47@c2�c2�c-��b��@b�b�b�@b�@b�(�b��@bڑ@bγ�b�@b�'�b�a@b�a@b��@b�k�b��b���b��@b{�@by@bi0@bb��bY^@bT@bE��bB�bA�@b=��b9�@b8h�b�@bO�a�6�aŶ@a�W@a�y�ay?@af�@aU��aM��aM��a;H�a8��a(�a(�a$�@a�@a�@a��a��a�`��@`�]�`�@`pA�`c�`Gc@`>(�_�@_�:�_��@_3�^�)@^�W@^�3�^��^ϧ�^�@^��@^���^�0�^{G�^x��^j$@^^F�^Nt�^M#@^2�@^1s�^1s�^)��^r�^!@]�]�@]���]��]�4@]�4@]��]���]z3@]p��]e@]'$�]:�\�}�\��@\�@\4��\l@[��@[�1�[�@[�[�0�[4�[(�@[(�@[�@[
@�Z�K@David Lanning <david.lanning@webpros.com> - 1.4.59-3Heekyoung Park <heekyoung.park@webpros.com> - 1.4.59-2Todd Rinaldo <todd.rinaldo@webpros.com> - 1.4.59-1Rikus Goodell <rikus.goodell@webpros.com> - 1.4.58-17Rikus Goodell <rikus.goodell@webpros.com> - 1.4.58-13Travis Holloway <travis.holloway@webpros.com> - 1.4.58-12Dan Muey <daniel.muey@webpros.com> - 1.4.58-11Dan Muey <daniel.muey@webpros.com> - 1.4.58-10B. McMahon <benjamin.mcmahon@webpros.com> - 1.4.58-9Rikus Goodell <rikus.goodell@webpros.com> - 1.4.58-8Rikus Goodell <rikus.goodell@webpros.com> - 1.4.58-5Sloane Bernstein <sloane.bernstein@webpros.com> - 1.4.58-3Sloane Bernstein <sloane.bernstein@webpros.com> - 1.4.58-2Sloane Bernstein <sloane.bernstein@webpros.com> - 1.4.58-1Brian Mendoza <brian.mendoza@webpros.com> - 1.4.57-15Brian Mendoza <brian.mendoza@webpros.com> - 1.4.57-14Travis Holloway <travis.holloway@webpros.com> - 1.4.57-13Nicolas Rochelemagne <nicolas.rochelemagne@webpros.com> - 1.4.57-12Ris�x�������������h������X#-fJj�3�u4Y�����\����������������4Y3Y5Y�kub@redhat.com> 0.92-1Jakub Jelinek <jakub@redhat.com> 0.91-2Ulrich Drepper <drepper@redhat.com>Jakub Jelinek <jakub@redhat.com> 0.91-1Jeff Johnson <jbj@redhat.com> 0.89-3Bill Nottingham <notting@redhat.com> 0.89-1Jakub Jelinek <jakub@redhat.com> 0.86-3Jeff Johnson <jbj@redhat.com> 0.84-3Jeff Johnson <jbj@redhat.com> 0.83-3Jeff Johnson <jbj@redhat.com> 0.82-3Jeff Johnson <jbj@redhat.com> 0.81-3Jeff Johnson <jbj@redhat.com> 0.80-3Elliot Lee <sopwith@redhat.com>Jeff Johnson <jbj@redhat.com> 0.79-2Jeff Johnson <jbj@redhat.com> 0.78-2Elliot Lee <sopwith@redhat.com>Jeff Johnson <jbj@redhat.com> 0.76-2Jakub Jelinek <jakub@redhat.com> 0.75-2Jakub Jelinek <jakub@redhat.com> 0.74-2Jeff Johnson <jbj@redhat.com> 0.73-3Jeff Johnson <jbj@redhat.com> 0.73-2Tim Powers <timp@redhat.com>Jakub Jelinek <jakub@redhat.com> 0.72-4Karsten Hopp <karsten@redhat.de> 0.72-3Jakub Jelinek <jakub@redhat.com> 0.72-2Jakub Jelinek <jakub@redhat.com> 0.71-2Jeff Johnson <jbj@redhat.com> 0.69-4Jeff Johnson <jbj@redhat.com> 0.68-2Jeff Johnson <jbj@redhat.com> 0.67-2Jeff Johnson <jbj@redhat.com> 0.65-2Jeff Johnson <jbj@redhat.com> 0.64-2Ulrich Drepper <drepper@redhat.com> 0.64Jeff Johnson <jbj@redhat.com> 0.63-2Ulrich Drepper <drepper@redhat.com> 0.62Jeff Johnson <jbj@redhat.com> 0.59-2Jeff Johnson <jbj@redhat.com> 0.56-2Jeff Johnson <jbj@redhat.com> 0.54-2Jeff Johnson <jbj@redhat.com> 0.53-2Jeff Johnson <jbj@redhat.com> 0.52-3Jeff Johnson <jbj@redhat.com> 0.52-2Ulrich Drepper <drepper@redhat.com> 0.52Ulrich Drepper <drepper@redhat.com> 0.50Ulrich Drepper <drepper@redhat.com> 0.49Jeff Johnson <jbj@redhat.com> 0.46-1- Add elfutils-0.176-gcc-pr88835.patch.- Add elfutils-0.176-dwelf_elf_e_machine_string.patch (#1724350)- Add elfutils-0.176-elf-update.patch (#1717351)
- Add elfutils-0.176-strip-symbols-illformed.patch- Add elfutils-0.176-xlate-note.patch (#1704754)- New upstream release (#1676504)
  CVE-2019-7146, CVE-2019-7148, CVE-2019-7149, CVE-2019-7150,
  CVE-2019-7664, CVE-2019-7665, CVE-2018-16062, CVE-2018-16402,
  CVE-2018-16403, CVE-2018-18310, CVE-2018-18521, CVE-2018-18520.- Add elfutils-0.172-robustify.patch. (#1593328)- New upstream release.
  - No functional changes compared to 0.171.
  - Various bug fixes in libdw and eu-readelf dealing with bad DWARF5
    data. Thanks to running the afl fuzzer on eu-readelf and various
    testcases.
  - eu-readelf -N is ~15% faster.- New upstream release.
  - DWARF5 and split dwarf, including GNU DebugFission, support.
  - readelf: Handle all new DWARF5 sections.
    --debug-dump=info+ will show split unit DIEs when found.
    --dwarf-skeleton can be used when inspecting a .dwo file.
    Recognizes GNU locviews with --debug-dump=loc.
  - libdw: New functions dwarf_die_addr_die, dwarf_get_units,
    dwarf_getabbrevattr_data and dwarf_cu_info.
    libdw will now try to resolve the alt file on first use
    when not set yet with dwarf_set_alt.
    dwarf_aggregate_size() now works with multi-dimensional arrays.
  - libdwfl: Use process_vm_readv when available instead of ptrace.
  - backends: Add a RISC-V backend.- Add elfutils-0.170-dwarf_aggregate_size.patch (#1527966).- Rely on systemd_requires for sysctl_apply default-yama-scope (#1509861).- Rebuild because of binutils bug (#1508966)- New upstream release. Remove upstreamed patches.
- Sync provide_yama_scope with fedora.
- Add elfutils-0.170-x86_64-backtrace-test-override.patch.- Fix ppc64 fallback unwinder (#1454754)- Enable default-yama-scope (#1455514)- Add ppc64 fallback unwinder (#1454754)- Rebase to fedora elfutils 0.168 (#1371517, #1400302)- Rebase to fedora elfutils 0.166 (#1296313, #1304873)- Add elfutils-0.163-readelf-n-undefined-shift.patch (#1262839)- Add elfutils-0.163-elflint-bad-nobits.patch (#1251698)- Update to 0.163- Update to 0.162 (#1224169, #1223462, #1207799)
- Include elfutils/known-dwarf.h
- Drop BuildRequires glibc-headers- Update to 0.160.- Add elfutils-0.158-mod-e_type.patch.- Mass rebuild 2014-01-24- Update to 0.158.  Add eu-stack.- Mass reb�x���������������������X#�fJj������������h�	�������l�����������������������for old kernels which could not mount, but seems to be fine.
- Drop pottcdate removal patch, and don't rebuild .po files,
  causes multilib problems and we generally shouldn't rebuild.
- Drop multilib patch; wrapper header should take care of this now.
- Drop ->open rename, Fedora seems ok with this now.- Fix integer overflows (#414591 / CVE-2007-5497)- The -devel package now requires device-mapper-devel, to match
  the dependency in blkid.pc (#410791)- Use upstream patch for blkid fat detection, avoids div-by-zero
  when encountering some BSD partitions (#398281)- Add arm to multilib header wrapper- Make (more) file timestamps match those in tarball for multilib tidiness 
- Fix e2fsprogs-libs summary (shared libs not static)- Detect big-endian squashfs filesystems in libblkid (#305151)- Detect squashfs filesystems in libblkid (#305151)- Fix blkid fat probe when there is a real MBR (#290951)- Add alpha to the header wrappers- wrap a couple headers to fix multilib issues (#270441)- add gawk to e2fsprogs-devel Requires, compile_et needs it (#265961)- Update license tags
- Fix one open-create caller with no mode
- Protect ->open ops from glibc open-create-mode-checker
- Fix source URL
- Add gawk to BuildRequires- Fix bug in ext2fs_swap_inode_full() on big-endian boxes- New version 1.40.2
- Fix up warning in badblocks- Fix up .po files to remove timestamps; multilib issues (#245653)- Many coverity-found potential leaks, segfaults, etc (#239354)
- Fix debugfs segfaults when no fs open (#208416, #209330)
- Avoid recursive loops in logdump due to symlinks in /dev (#210371)
- Don't write changes to the backup superblocks by default (#229561)
- Correct byteswapping for fast symlinks with xattrs (#232663)
- e2fsck: added sanity check for xattr validation (#230193)- add dist tag to release field- add LUKS support to libblkid (#242421)- fix post/preun requirements
- use smp flags- Add build dependency on new device-mapper-devel package.- build fixes for new automake 1.10 (#220715)- make uuid_generate_time generate unique uuids (#218606)- 32-bit 16T fixups from esandeen (#202807)
- Update summaries and descriptions- Fix problem with empty FAT label (#206656)- Fix memory leak in device probing.- fixed multilib devel conflicts (#192665)- prevent libblkid returning /dev/dm-X- rebuild- add GFS abd GFS2 support to libblkid- new version 1.39
- dropped ext2online, because resize2fs is now able to do online resize
- spec file cleanup
- enabled checks for build- prevent libblkid returning /dev/dm-X
- fix build- prevent error messages to stderr caused by libblkid calling libdevmapper- used upstream version of the blkid-epoch patch (by Theodore Tso, #182188)- Move /etc/blkid.tab to /etc/blkid/blkid.tab- BuildRequires pkgconfig- Disable /etc/blkid.tab caching if time is set before epoch (#182188)- _don't_ handle selinux context on blkid.tab, dwalsh says this is a no-no.- handle selinux context on blkid.tab- BuildRequires: gettext-devel- bump again for double-long bug on ppc(64)- rebuilt for new gcc4.1 snapshot and glibc changes- cleanup device-mapper patch
- use pkg-config for device-mapper- fix some more minor logic errors in dm probing- fix a logic error in dm probing
- add priority group for dm devices, so they'll be preferred- added support for device-mapper devices- rebuilt- fixed file conflicts between 32bit and 64bit packages (#168815)
- fixed mklost+found crashes with buffer overflow (#157773)
  Thanks to Arjan van de Ven for the patch- splitted up libs from main package, into a new e2fsprogs-libs package
- fixed requires and prereqs- new version 1.38
- Close File descriptor for unregognized devices (#159878)
  Thanks to David Milburn for the patch.
  Merged from RHEL-4
- enable tune2fs to set and clear feature resize_inode (#167816)
- removed outdated information from ext2online man page (#164383)/sbin/ldconfig/sbin/ldconfig�1.42.9-19.el7.tuxcare.els11.42.9-19.el7.tuxcare.els1libss.so.2libss�x�������������X��������X�#�gJj�����������P������)�����n����������������)+)�1)
- Update PayPalEE test cert with unexpired one (#580207)- Fix ns.spec to not require nss-softokn (#575001)- rebuilt with all tests enabled- Using SSL_RENEGOTIATE_TRANSITIONAL as default while on transition period
- Disabling ssl tests suites until bug 539183 is resolved- Update to 3.12.6
- Reactivate all tests
- Patch tools to validate command line options arguments- Fix curl related regression and general patch code clean up-  retagging- Fix SIGSEGV on call of NSS_Initialize (#553638)- New version of patch to allow root to modify ystem database (#547860)- Temporarily disabling the ssl tests- Fix nsssysinit to allow root to modify the nss system database (#547860)- Fix an error introduced when adapting the patch for rhbz #546211- Remove left over trace statements from nsssysinit patching- Fix a misconstructed patch- Fix nsssysinit to enable apps to use system cert store, patch contributed by David Woodhouse (#546221)
- Fix spec so sysinit requires coreutils for post install scriplet (#547067)
- Fix segmentation fault when listing keys or certs in the database, patch contributed by Kamil Dudka (#540387)- Fix nsssysinit to set the default flags on the crypto module (#545779)
- Remove redundant header from the pem module- Remove unneeded patch- Retagging to include missing patch- Update to 3.12.5
- Patch to allow ssl/tls clients to interoperate with servers that require renogiation- Retagging- Require nss-softoken of same architecture as nss (#527867)
- Merge setup-nsssysinit.sh improvements from F-12 (#527051)- User no longer prompted for a password when listing keys an empty system db (#527048)
- Fix setup-nsssysinit to handle more general formats (#527051)- Fix syntax error in setup-nsssysinit.sh- Fix sysinit to be under mozilla/security/nss/lib- Add nss-sysinit activation/deactivation script- Install blank databases and configuration file for system shared database
- nsssysinit queries system for fips mode before relying on environment variable- Restoring nssutil and -rpath-link to nss-config for now - 522477- Add the nss-sysinit subpackage- Installing shared libraries to %{_libdir}- Retagging to pick up new sources- Update pem enabling source tar with latest fixes (509705, 51209)- PEM module implements memory management for internal objects - 509705
- PEM module doesn't crash when processing malformed key files - 512019- Remove symbolic links to shared libraries from devel - 521155
- No rpath-link in nss-softokn-config- Update to 3.12.4- Fix FORTIFY_SOURCE buffer overflows in test suite on ppc and ppc64 - bug 519766
- Fixed requires and buildrequires as per recommendations in spec file review- Restoring patches 2 and 7 as we still compile all sources
- Applying the nss-nolocalsql.patch solves nss-tools sqlite dependency problems- restore require sqlite- Don't require sqlite for nss- Ensure versions in the requires match those used when creating nss.pc- Remove nss-prelink.conf as signed all shared libraries moved to nss-softokn
- Add a temprary hack to nss.pc.in to unblock builds- caolan's nss.pc patch- Bump the release number for a chained build of nss-util, nss-softokn and nss- Fix nss-config not to include nssutil
- Add BuildRequires on nss-softokn and nss-util since build also runs the test suite- disabling all tests while we investigate a buffer overflow bug- disabling some tests while we investigate a buffer overflow bug - 519766- remove patches that are now in nss-softokn and
- remove spurious exec-permissions for nss.pc per rpmlint
- single requires line in nss.pc.in- Fix BuildRequires: nss-softokn-devel release number- fix nss.pc.in to have one single requires line- cleanups for softokn- remove the softokn subpackages- don install the nss-util pkgconfig bits- remove from -devel the 3 headers that ship in nss-util-devel- kill off the nss-util nss-util-devel subpackages- split off nss-softokn and nss-util as subpackages with their own rpms
- first phase of splitting nss-softokn and nss-util as their own packages- must install libns�x��������������������X�#�fJjn) [P�8Q	�������a���������������������Eb?]4d����	#�	J�t�x�����������	�����(8	@
HX�
��$Td���(�8��9��:(U�>Zd@ZsGZ�HZ�IZ�XZ�YZ�\Z�]Z�^[)b[bd[�e[�f\l\t\u\,v\<w\�x\�y]�]0]D]H6_~_�6
a��a�a�a�ga�hbClibss1.42.919.el7.tuxcare.els1Command line interface parsing libraryThis is libss, a command line interface parsing library, part of e2fsprogs.

This package includes a tool that parses a command table to generate
a simple command-line interface parser, the include files needed to
compile and use it.

It was originally inspired by the Multics SubSystem library.f��buildfarm05-new.corp.cloudlinux.comACentOSTuxCareMITTuxCare Packaging Team <packager@tuxcare.com>Development/Librarieshttp://e2fsprogs.sourceforge.net/linuxx86_64o(�����A큤f�Jf�Mf��J�n�c336d3f36b8ae19b8e7776b6b6f3e0d9e58e9f26dfe1ccdf2fda875f0b7e6497680f852df303874fe9c722283a7da571ae9a0477768df8af1e363298e2adc51elibss.so.2.0rootrootrootrootrootrootrootroote2fsprogs-1.42.9-19.el7.tuxcare.els1.src.rpm����������������libsslibss(x86-64)libss.so.2()(64bit)@@@@@@@@@@


@
/sbin/ldconfig/sbin/ldconfiglibc.so.6()(64bit)libc.so.6(GLIBC_2.11)(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.17)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libcom_err(x86-64)libcom_err.so.2()(64bit)libdl.so.2()(64bit)libdl.so.2(GLIBC_2.2.5)(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rtld(GNU_HASH)rpmlib(PayloadIsXz)1.42.9-19.el7.tuxcare.els13.0.4-14.6.0-14.0-15.2-14.11.3e�,�_c�^���]҇�]��\v{�\s�[!@Z��@Z
�X�~@W^�@V��T���TJ?@T�S��R�U�R��R�@R�k�Q�*@Q��Q��P�@Pj�@Pj�@P,�Pw@P�@O�/@O�]@O��O��O�O�O��@Ou�@Or�@Oq��OB5�O�N��@N�=@N�=@N���N��N��N��@N�i@NA!@NA!@MQ0@M9�M�@ME@L�!�L�d�L<U@L;�LG�K��K�/�K�!@K��@K��@KuB�KuB�Kr��Kn�@KZ�J�U�J�U�J�2@J�T�J�1@J�0@J��@J�/@Jyt@JlE@Jj�Ji�@J`g�JY�@JI�@JD�@J:,@J,�@J,�@J'�@J!�I�I��I��I�@I��@I��@I��@I��@I��@Iu��Ih��H�	@H�	@H�H�H���Hu��Hr@Hr@H[��HX��HF��HF��H6��H(1@Hj�G�h�G�h�G��@G��G��@G�D@G��G�}�G�,@G�,@G��G��@Gz+@Gz+@Gz+@G^{�GUA@GL�G�@G�GV@G2�F�F�F�=@F�_�F�v�F��F��@F�@F{��Fy�Fy�E��@E�@E��@E���E-@E
8�D�f�DĶ@D�p@D��@D�A@D��@D���D�D^�D�@D
u�D
u�C��@C�R@C��@C�@C�C��@C�P@C���C�g@C�q�Cs6@Cq�C '�Dmitrii Samoilov <dsamoilov@cloudlinux.com> - 1.45.6-19.tuxcare.els1Lukas Czerner <lczerner@redhat.com> 1.45.6-19Lukas Czerner <lczerner@redhat.com> 1.42.9-18Lukas Czerner <lczerner@redhat.com> 1.42.9-17Lukas Czerner <lczerner@redhat.com> 1.42.9-16Lukas Czerner <lczerner@redhat.com> 1.42.9-15Lukas Czerner <lczerner@redhat.com> 1.42.9-14Lukas Czerner <lczerner@redhat.com> 1.42.9-13Lukas Czerner <lczerner@redhat.com> 1.42.9-12Lukas Czerner <lczerner@redhat.com> 1.42.9-11Lukas Czerner <lczerner@redhat.com> 1.42.9-10Eric Sandeen <sandeen@redhat.com> 1.42.9-9Eric Sandeen <sandeen@redhat.com> 1.42.9-8Eric Sandeen <sandeen@redhat.com> 1.42.9-7Eric Sandeen <sandeen@redhat.com> 1.42.9-6Eric Sandeen <sandeen@redhat.com> 1.42.9-5Lu�x�������������H��������X�#�eJjEV_R��������0��)�����^�����������������)�)9��56434)
- prevent truncation of copied files to ~2Mb (#155916)
- install /usr/bin/php from CLI build alongside CGI
- enable sysvmsg extension (#142988)- prevent build of builtin dba as well as shared extension- split out dba and bcmath extensions into subpackages
- BuildRequire gcc-c++ to avoid AC_PROG_CXX{,CPP} failure (#155221)
- pear: update to DB-1.7.6
- enable FastCGI support in /usr/bin/php-cgi (#149596)- build /usr/bin/php with the CLI SAPI, and add /usr/bin/php-cgi,
  built with the CGI SAPI (thanks to Edward Rudd, #137704)
- add php(1) man page for CLI
- fix more test cases to use -n when invoking php- rebuild for new libpq soname- bundle from PEAR: HTTP, Mail, XML_Parser, Net_Socket, Net_SMTP
- snmp: disable MSHUTDOWN function to prevent error_log noise (#153988)
- mysqli: add fix for crash on x86_64 (Georg Richter, upstream #32282)- build shared objects as PIC (#154195)- fix PEAR installation and bundle PEAR DB-1.7.5 package- update to 5.0.4 (#153068)
- add .phps AddType to php.conf (#152973)
- better gcc4 fix for libxmlrpc- BuildRequire mysql-devel >= 4.1
- don't mark php.ini as noreplace to make upgrades work (#152171)
- fix subpackage descriptions (#152628)
- fix memset(,,0) in Zend (thanks to Dave Jones)
- fix various compiler warnings in Zend- package mysqli extension in php-mysql
- really enable pcntl (#142903)
- don't build with --enable-safe-mode (#148969)
- use "Instant Client" libraries for oci8 module (Kai Bolay, #149873)- fix build with GCC 4- install the ext/gd headers (#145891)
- enable pcntl extension in /usr/bin/php (#142903)
- add libmbfl array arithmetic fix (dcb314@hotmail.com, #143795)
- add BuildRequire for recent pcre-devel (#147448)- update to 5.0.3 (thanks to Robert Scheck et al, #143101)
- enable xsl extension (#142174)
- package both the xsl and dom extensions in php-xml
- enable soap extension, shared (php-soap package) (#142901)
- add patches from upstream 5.0 branch:
 * Zend_strtod.c compile fixes
 * correct php_sprintf return value usage- update for db4-4.3 (Robert Scheck, #140167)
- build against mysql-devel
- run tests in %check- truncate changelog at 4.3.1-1
- merge from 4.3.x package:
 - enable mime_magic extension and Require: file (#130276)- fix dom/sqlite enable/without confusion- fix phpize installation for lib64 platforms
- add fix for segfault in variable parsing introduced in 5.0.2- update to 5.0.2 (#127980)
- build against mysqlclient10-devel
- use new RTLD_DEEPBIND to load extension modules
- drop explicit requirement for elfutils-devel
- use AddHandler in default conf.d/php.conf (#135664)
- "fix" round() fudging for recent gcc on x86
- disable sqlite pending audit of warnings and subpackage split- don't build dom extension into 2.0 SAPI- ExclusiveArch: x86 ppc x86_64 for the moment- fix default extension_dir and conf.d/php.conf- update to 5.0.1
- only build shared modules once
- put dom extension in php-dom subpackage again
- move extension modules into %{_libdir}/php/modules
- don't use --with-regex=system, it's ignored for the apache* SAPIs- Merge in some spec file changes from Jeff Stern (jastern@uci.edu)- bump to 5.0.0
- add patch to prevent clobbering struct re_registers from regex.h
- remove domxml references, replaced with dom now built-in
- fix php.ini to refer to php5 not php4hou-2 17768065275.6.40-24.26.14.cpanel5.6.40-24.26.14.cpanelgettext.inigettext.so/opt/cpanel/ea-php56/root/etc/php.d//opt/cpanel/ea-php56/root/usr/lib64/php/modules/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1  -m64 -mtune=genericobs://private/EA4-production/CentOS_7/332fd02c5847241a14fca8fd424b648d-scl-php56cpioxz2x86_64-redhat-linux-gnu.&n�J*	�Z0���?����i��#x��~�|�<�/�V���zM��=�.$߭Ey}���l�^��1�c�hV0��@2a�u����.��.��>2�]��K솮eA]���9��P�K�l���௒�=`N�vt�є����+�%+�Pw6�W#�l�b�F��w�G
H��˄����b��-���~�x����������������������X�#�gJj�Bp��������m�����_�����������������m�mqA�E�A
@Ag@Chris Castillo <chris.castillo@webpros.com> - 5.5.38-64Julian Brown <julian.brown@cpanel.net> - 5.5.38-63Tim Mullin <tim@cpanel.net> - 5.5.38-62Julian Brown <julian.brown@cpanel.net> - 5.5.38-61Brian Mendoza <brian.mendoza@cpanel.net> - 5.5.38-60Travis Holloway <t.holloway@cpanel.net> - 5.5.38-59Dan Muey <dan@cpanel.net> - 5.5.38-58Travis Holloway <t.holloway@cpanel.net> - 5.5.38-57Cory McIntire <cory@cpanel.net> - 5.5.38-56Tim Mullin <tim@cpanel.net> - 5.5.38-55Tim Mullin <tim@cpanel.net> - 5.5.38-54Tim Mullin <tim@cpanel.net> - 5.5.38-53Tim Mullin <tim@cpanel.net> - 5.5.38-52Daniel Muey <dan@cpanel.net> - 5.5.38-51Julian Brown <julian.brown@cpanel.net> - 5.5.38-50Tim Mullin <tim@cpanel.net> - 5.5.38-49Daniel Muey <dan@cpanel.net> - 5.5.38-48Tim Mullin <tim@cpanel.net> - 5.5.38-47Cory McIntire <cory@cpanel.net> - 5.5.38-46Cory McIntire <cory@cpanel.net> - 5.5.38-45Tim Mullin <tim@cpanel.net> - 5.5.38-44Daniel Muey <dan@cpanel.net> - 5.5.38-43Tim Mullin <tim@cpanel.net> - 5.5.38-42Tim Mullin <tim@cpanel.net> - 5.5.38-41Cory McIntire <cory@cpanel.net> - 5.5.38-40Tim Mullin <tim@cpanel.net> - 5.5.38-39Rishwanth Yeddula <rish@cpanel.net> - 5.5.38-38Rishwanth Yeddula <rish@cpanel.net> - 5.5.38-37Rishwanth Yeddula <rish@cpanel.net> - 5.5.38-36Cory McIntire <cory@cpanel.net> - 5.5.38-35Daniel Muey <dan@cpanel.net> - 5.5.38-34<darren@cpanel.net> - 5.5.38-33<darren@cpanel.net> - 5.5.38-32<cory@cpanel.net> - 5.5.38-31<julian.brown@cpanel.net> - 5.5.38-30<dan@cpanel.net> - 5.5.38-29<dan@cpanel.net> - 5.5.38-28<cory@cpanel.net> - 5.5.38-27Tim Mullin <tim@cpanel.net> - 5.5.38-26Dan Muey <dan@cpanel.net> - 5.5.38-25Dan Muey <dan@cpanel.net> - 5.5.38-24Dan Muey <dan@cpanel.net> - 5.5.38-23Dan Muey <dan@cpanel.net> - 5.5.38-22Jacob Perkins <jacob.perkins@cpanel.net> - 5.5.38-21Jacob Perkins <jacob.perkins@cpanel.net> - 5.5.38-20Jacob Perkins <jacob.perkins@cpanel.net> - 5.5.38-19Jacob Perkins <jacob.perkins@cpanel.net> - 5.5.38-18Jacob Perkins <jacob.perkins@cpanel.net> - 5.5.38-17Jacob Perkins <jacob.perkins@cpanel.net> - 5.5.38-16Jacob Perkins <jacob.perkins@cpanel.net> - 5.5.38-15Dan Muey <dan@cpanel.net> - 5.5.38-14Cory McIntire <cory@cpanel.net> - 5.5.38-13Cory McIntire <cory@cpanel.net> - 5.5.38-12Dan Muey <dan@cpanel.net> - 5.5.38-11Dan Muey <dan@cpanel.net> - 5.5.38-10Dan Muey <dan@cpanel.net> - 5.5.38-9Dan Muey <dan@cpanel.net> - 5.5.38-8Matt Dees <matt.dees@cpanel.net> 5.5.38-7S. Kurt Newman <kurt.newman@cpanel.net> - 5.5.38-6Edwin Buck <e.buck@cpanel.net> 5.5.38-5Jacob Perkins <jacob.perkins@cpanel.net> 5.5.38-4Matt Dees <matt@cpanel.net> - 5.5.38-3S. Kurt Newman <kurt.newman@cpanel.net> - 5.5.38-2Edwin Buck <e.buck@cpanel.net> - 5.5.38-1Darren Mobley <darren@cpanel.net> - 5.5.37-7Julian Brown <julian.brown@cpanel.net> - 5.5.37-6Jacob Perkins <jacob.perkins@cpanel.net> - 5.5.37-1Dan Muey <dan@cpanel.net> - 5.5.36-5S. Kurt Newman <kurt.newman@cpanel.net> - 5.5.36-4Jacob Perkins <jacob.perkins@cpanel.net> 5.5.36-3Jacob Perkins <jacob.perkins@cpanel.net> 5.5.36-2Jacob Perkins <jacob.perkins@cpanel.net> - 5.5.36-1Jacob Perkins <jacob.perkins@cpanel.net> - 5.5.35-1S. Kurt Newman <kurt.newman@cpanel.net> - 5.5.34-2Jacob Perkins <jacob.perkins@cpanel.net> - 5.5.34-1Jacob Perkins <jacob.perkins@cpanel.net> - 5.5.33-1S. Kurt Newman <kurt.newman@cpanel.net> - 5.5.32-3S. Kurt Newman <kurt.newman@cpanel.net> - 5.5.32-2Jacob Perkins <jacob.perkins@cpanel.net> - 5.5.32-1David Nielson <david.nielson@cpanel.net> - 5.5.31-2Jacob Perkins <jacob.perkins@cpanel.net> - 5.5.31-1S. Kurt Newman <kurt.newman@cpanel.net> - 5.5.30-7Jacob Perkins <jacob.perkins@cpanel.net> - 5.5.30-6S. Kurt Newman <kurt.newman@cpanel.net> - 5.5.30-5Dan Muey <dan@cpanel.net> - 5.5.30-4S. Kurt Newman <kurt.newman@cpanel.net> - 5.5.30-3Dan Muey <dan@cpanel.net> - 5.5.30-2Jacob Perkins <jacob.perkins@cpanel.net> - 5.5.30-1Jacob Perkins <jacob.perkins@cpanel.net> - 5.5.29-1Kurt Newman <kurt.newman@cpanel.net> - 5.5.28-1Trinity Quirk <trinity.quirk@cp�x�������������8~�������X;#gJjx�����Ȗġ�����,����������������ġá�?��?��d����	+�	d����������#�	'�=�Q�W`h	l
px�
�DLx�(d8l@9	l@:?!@F��G��H��I�X�Y�\�<]�D^�Ub��c�pd��e��f��l��z��������$�4
�L��x�|��g��h��Cea-php55-php-soap5.5.3864.65.14.cpanelA module for PHP applications that use the SOAP protocolThe ea-php55-php-soap package contains a dynamic shared object that will add
support to PHP for using the SOAP web services protocol.i��hou-2��EA4-production / CentOS_7cPanel, Inc.PHPDevelopment/Languageshttp://www.php.net/linuxx86_641͘����i��[i��Q42b7e56668969cf9346acfc467068988ac2dc7d62eaabae136b93ae098ffbbd59a1b9bf1c829651a8b1325708759c9e1f906944d6ddd6bf652acc9102e314e78rootrootrootrootea-php55-php-5.5.38-64.65.14.cpanel.src.rpm��������ea-php55-php-soapea-php55-php-soap(x86-64)


@@@@@@@@@
ea-php55-php-commonea-php55-php-clirpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(CompressedFileNames)libc.so.6()(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.4)(64bit)libdl.so.2()(64bit)libm.so.6()(64bit)libm.so.6(GLIBC_2.2.5)(64bit)libxml2.so.16()(64bit)rtld(GNU_HASH)rpmlib(PayloadIsXz)5.5.38-64.65.14.cpanel5.5.38-64.65.14.cpanel4.6.0-14.0-13.0.4-15.2-14.11.3h�;@f�)@e\��dd��d[�@b\@a�@`ٹ�`B@_�]@_R,@_�@^|�@^`�^^F�]��]��]z3@]5�@]#0@]�\��@\���\��\J�@[O+�[{@Z�3@ZԐ@Z���Z���Za�ZX�@ZWQ�ZN@Z)-@ZN�Y�@Y�Y�A@Y�3�Yw2�YS�@YK�@Y;@Y�Y�@Yi@X�:@X��@X�P@X�C�X��@X�e@X�p�X�*�XEV�X.�@X.�@X-��W�W��@W�@W�
�Wv[@Wu	�Wq@Wg�W_�W^�@WM|�WF�@W!�@WK�V�b�V�'@V��V��@V�=@V��@V�S@Vr��Vr��Vj��Vh�VE�V��V
 @U�U�@U�L@U�n�U�n�Um��Ud`@U:�Ut@T�	�TH�TD�@T5'@Sr	@S,)�S?�S��R�@R��@R��@R��R�R�R�R�R_�@R:�@R��Q��@Q�Y@Q�Y@Q��Q��Q��@Q��@Q��Qy�Qf��Q@j@P��@PѬ@P��P�@P�@P�*�P��@P��@P�)�P�)�P���P���P���P���P���P�5@P{��Px@Pl(�Pj�@Pi��Pi��Pe�@P`K@PY��PY��PY��PXb@PW�PS@P2&�P.2@P	H@O�@O�@O��O��@O�\@O�s@O��@O��@Ov�OtN�OpZ@OpZ@OP�@O?��O-�O�O�@O	�@N��N��N��@N��@N�@NoE�NS�@NL��N7@M���M��M���MT�Mt�Mk�@MfH@MR��M'@M�@M�@Mg�L�8�LΫ�Lʷ@L���LH2�K��@K��@K�C�K�@K
@K��K�@J��@JlE@J_@J_@J\s@JY�@J> �I�'@I��@I��I��@I��@I}��I|T@Iy�@IC��I>]�I:i@I9�I*�@I9@H˫@H�(�H{?�Hv@G��G�Z@Gt�@GV��GV��GV@F��Fڥ�F�@F�S@F�S@F�]�F��Fw�@FiD�FA��F@f@F; @F�@F@Eّ@E�K@E��E�3@Eu_@El$�El$�Ej�@E[@E[@EG:�E#�@D�,@D��@D�b�D�b�D�(@DtJ�Dla�D_2�DX�@D;@C�@C�C�Q@Cˊ�Cǖ@C�
@C��C�f@C�q�C� @C��@C�7@C��@Cs6@CoA�CgX�C(�B�i�B{\@Bwg�Bl�B]	�B]	�B]	�B[�@BZf�BQ,@BM7�BJ��BB��B�B	�@A�@A��A��A�_�A�_�A�_�AJ�AJ�AJ�A@E�A
@Ag@Chris Castillo <chris.castillo@webpros.com> - 5.5.38-64Julian Brown <julian.brown@cpanel.net> - 5.5.38-63Tim Mullin <tim@cpanel.net> - 5.5.38-62Julian Brown <julian.brown@cpanel.net> - 5.5.38-61Brian Mendoza <brian.mendoza@cpanel.net> - 5.5.38-60Travis Holloway <t.holloway@cpanel.net> - 5.5.38-59Dan Muey <dan@cpanel.net> - 5.5.38-58Travis Holloway <t.holloway@cpanel.net> - 5.5.38-57Cory McIntire <cory@cpanel.net> - 5.5.38-56Tim Mullin <tim@cpanel.net> - 5.5.38-55Tim Mullin <tim@cpanel.net> - 5.5.38-54Tim Mullin <tim@cpanel.net> - 5.5.38-53Tim Mullin <tim@cpanel.net> - 5.5.38-52Daniel Muey <dan@cpanel.net> - 5.5.38-51Juli�x��������������m�������X�#�gJjh������H�������=�����p�����������������=�=�=�ation(RHBZ#1237242)
- Fixes removal of destination addresses for services in permanent view in
  firewall-config (RHBZ#1278281)
- Fixes firewall-config usage over ssh (RHBZ#1281416)
- Fixes reload disconnects with existing connections (RHBZ#1287449)
- Fixes ICMP packet drops while reloading (RHBZ#1288177)
- Adds option to add a new zone, service, .. from existing file (RHBZ#1292926)
- Adds improved checks for file readers, fixes error reporting of strings
  containing illegal characters (RHBZ#1303026)
- Transforms direct.passthrough errors into warnings (RHBZ#1301573)
- Reduced getprotobyname and getservbyname calls for NIS use (RHBZ#1305434)
- Fixes (repeated) firewalld reload by sending SIGHUP signal (RHBZ#1313023)
- Adds After=dbus.service to service file to fix shutdown (RHBZ#1313845)
- Adds ICMP block inversion support (RHBZ#1325335)
- Fixes local traffic issue with masquerading in default zone (RHBZ#1326130)
- Adds destination rich rules without an element (RHBZ#1326462)
- Fixes reload after default zone change to newly introduced zone (RHBZ#1273888)
- Fixes start without ipv6_rpfilter module (RHBZ#1285769)
- Adds log of denied packets option (RHBZ#1322505)- Fixed file mode of schema configuration file verifier check.sh als in files
  (RHBZ#994479)- Fixed file mode of schema configuration file verifier check.sh (RHBZ#994479)
- Include upstream testsuite in SRPM package (RHBZ#1261502)
- Added missing ports to RH-Satellite-6 mservice (RHBZ#1254531)- New schema configuration file verifier (RHBZ#994479)
- More information about interface handling with and without NetworkManager
  (RHBZ#1122739) (RHBZ#1128563)
- Apply all rich rules for non-default targets (RHBZ#1142741)
- New iscsi service (RHBZ#1150656)
- New rsync service (RHBZ#1150659)
- ipXtables: use -w or -w2 if supported (RHBZ#1161745)
- Do not use ipv6header for protocol matching. (RHBZ#1164605)
- Iptables does not like limit of 1/d (RHBZ#1176813)
- Fix readdition of removed permanent direct settings (RHBZ#1182671)
- Fix bugs found by upstream test suite (RHBZ#1183008)
- Fix polkit auth for query and get passthroughs methods (RHBZ#1183688)
- New vdsm service (RHBZ#1194382)
- New freeipa services (RHBZ#1206490)
- Add missing parts to firewall-offline-cmd man page (RHBZ#1217678)- added missing upstream commit 265bfe90 for (RHBZ#993650)
- also add log message in the firewall-cmd output (RHBZ#1057095)- additional upstream commits for (RHBZ#993650)
- additional upstream commits for (RHBZ#1127706)- added lost runtime passthrough check and reverse patch (RHBZ#993650)- fixed GUI missing name of active zone (RHBZ#993655)
- recreate man pages at build time (RHBZ#1071303)
  - fixes rich language log level (RHBZ#993740)
  - fixes typo in firewall-cmd man page (RHBZ#1064401)
- new support to save runtime as permanent (RHBZ#993650)
- new cli --timeout time specifiers support (RHBZ#994044)
- updated translations (RHBZ#1048119) (RHBZ#1083592)
- more descriptive error message in case of mistakes in iptables (RHBZ#1057095)
- use apparent name for default target (RHBZ#1075675)
- simplified firewalld usage on servers by dropping at_console (RHBZ#1097765)
- fixed enable/disable of lockdown (RHBZ#1111573)
- new Satellite 6 service (RHBZ#1135634)
- fixed inconsistent color usage for firewall-cmd messages (RHBZ#1097841)
- fixed missing -Es in lockdown whitelist firewall-config command (RHBZ#1099065)
- unified runtime and permanent D-Bus API (RHBZ#1127706)
- fixed missing update of the connections menu in firewall-config (RHBZ#1120212)
- better docs for interface bindings in firewalld and NetworkManager (RHBZ#1112742)
- firewall-config: Show target REJECT (RHBZ#1058794)
- fixed inconsistent PolicyKit domain usage in main D-Bus interface (RHBZ#1061809)- firewall-cmd: prevent argparse from parsing iptables options (RHBZ#1070683)- firewall-offline-cmd: options from 'firewall-cmd --permanent *' (RHBZ#1059800)- fixed rich language log level (RHBZ#993740)
- firewall-config: use simple tool to change zones for connections (RHBZ#993782)
- translations update�x�����X�F�����=�ebio_PrivateKey_traditional.htmlPEM_write_bio_RSAPrivateKey.htmlPEM_write_bio_RSAPublicKey.htmlPEM_write_bio_RSA_P�H���������������p\�������XcgJjp�1	E�a����������������	E�D���Orton <jorton@redhat.com> 5.3.0-4Joe Orton <jorton@redhat.com> 5.3.0-3Joe Orton <jorton@redhat.com> 5.3.0-2Remi Collet <Fedora@famillecollet.com> 5.3.0-1Remi Collet <Fedora@famillecollet.com> 5.2.10-1Remi Collet <Fedora@FamilleCollet.com> - 5.2.9-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 5.2.8-10Joe Orton <jorton@redhat.com> 5.2.8-9Joe Orton <jorton@redhat.com> 5.2.8-8Joe Orton <jorton@redhat.com> 5.2.8-7Joe Orton <jorton@redhat.com> 5.2.8-5Joe Orton <jorton@redhat.com> 5.2.8-4Joe Orton <jorton@redhat.com> 5.2.8-3Remi Collet <Fedora@FamilleCollet.com> 5.2.8-2Remi Collet <Fedora@FamilleCollet.com> 5.2.8-1Remi Collet <Fedora@FamilleCollet.com> 5.2.7-1.1Remi Collet <Fedora@FamilleCollet.com> 5.2.7-1Joe Orton <jorton@redhat.com> 5.2.6-7Joe Orton <jorton@redhat.com> 5.2.6-6Remi Collet <Fedora@FamilleCollet.com> 5.2.6-5Remi Collet <Fedora@FamilleCollet.com> 5.2.6-4Joe Orton <jorton@redhat.com> 5.2.6-3Joe Orton <jorton@redhat.com> 5.2.5-7Fedora Release Engineering <rel-eng@fedoraproject.org> - 5.2.5-6Joe Orton <jorton@redhat.com> 5.2.5-5Joe Orton <jorton@redhat.com> 5.2.5-4Release Engineering <rel-eng at fedoraproject dot org> - 5.2.5-3Joe Orton <jorton@redhat.com> 5.2.5-2Joe Orton <jorton@redhat.com> 5.2.4-3Joe Orton <jorton@redhat.com> 5.2.4-2Joe Orton <jorton@redhat.com> 5.2.3-9Joe Orton <jorton@redhat.com> 5.2.3-8Hans de Goede <j.w.r.degoede@hhs.nl> 5.2.3-7Joe Orton <jorton@redhat.com> 5.2.3-6Joe Orton <jorton@redhat.com> 5.2.3-5Joe Orton <jorton@redhat.com> 5.2.3-4Joe Orton <jorton@redhat.com> 5.2.3-3Joe Orton <jorton@redhat.com> 5.2.3-2Joe Orton <jorton@redhat.com> 5.2.2-4Joe Orton <jorton@redhat.com> 5.2.2-3Joe Orton <jorton@redhat.com> 5.2.2-2Joe Orton <jorton@redhat.com> 5.2.1-5Joe Orton <jorton@redhat.com> 5.2.1-4Joe Orton <jorton@redhat.com> 5.2.1-3Joe Orton <jorton@redhat.com> 5.2.1-2Joe Orton <jorton@redhat.com> 5.2.0-10Joe Orton <jorton@redhat.com> 5.2.0-9Joe Orton <jorton@redhat.com> 5.2.0-8Joe Orton <jorton@redhat.com> 5.2.0-7Joe Orton <jorton@redhat.com> 5.2.0-6Joe Orton <jorton@redhat.com> 5.2.0-5Joe Orton <jorton@redhat.com> 5.2.0-4Joe Orton <jorton@redhat.com> 5.2.0-3Joseph Orton <jorton@redhat.com> 5.1.6-4Joe Orton <jorton@redhat.com> 5.1.6-3Joe Orton <jorton@redhat.com> 5.1.6-2Jesse Keating <jkeating@redhat.com> - 5.1.4-8.1Joe Orton <jorton@redhat.com> 5.1.4-8Joe Orton <jorton@redhat.com> 5.1.4-7Joe Orton <jorton@redhat.com> 5.1.4-6Radek Vokal <rvokal@redhat.com> 5.1.4-5.1Joe Orton <jorton@redhat.com> 5.1.4-5Joe Orton <jorton@redhat.com> 5.1.4-3Joe Orton <jorton@redhat.com> 5.1.3-3Joe Orton <jorton@redhat.com> 5.1.2-5Jesse Keating <jkeating@redhat.com> - 5.1.2-4.3Jesse Keating <jkeating@redhat.com> - 5.1.2-4.1Joe Orton <jorton@redhat.com> 5.1.2-4Joe Orton <jorton@redhat.com> 5.1.2-3Joe Orton <jorton@redhat.com> 5.1.2-2Joe Orton <jorton@redhat.com> 5.1.1-8Joe Orton <jorton@redhat.com> 5.1.1-7Joe Orton <jorton@redhat.com> 5.1.1-6Jesse Keating <jkeating@redhat.com>Joe Orton <jorton@redhat.com> 5.1.1-5Joe Orton <jorton@redhat.com> 5.1.1-4Joe Orton <jorton@redhat.com> 5.1.1-3Joe Orton <jorton@redhat.com> 5.1.1-2Tomas Mraz <tmraz@redhat.com> 5.0.5-6Joe Orton <jorton@redhat.com> 5.0.5-5Joe Orton <jorton@redhat.com> 5.0.5-4Joe Orton <jorton@redhat.com> 5.0.5-3Joe Orton <jorton@redhat.com> 5.0.4-11Joe Orton <jorton@redhat.com> 5.0.4-10Joe Orton <jorton@redhat.com> 5.0.4-9Joe Orton <jorton@redhat.com> 5.0.4-8Joe Orton <jorton@redhat.com> 5.0.4-7Joe Orton <jorton@redhat.com> 5.0.4-6Joe Orton <jorton@redhat.com> 5.0.4-5Joe Orton <jorton@redhat.com> 5.0.4-4Joe Orton <jorton@redhat.com> 5.0.4-3Joe Orton <jorton@redhat.com> 5.0.4-2Joe Orton <jorton@redhat.com> 5.0.4-1Joe Orton <jorton@redhat.com> 5.0.3-5Joe Orton <jorton@redhat.com> 5.0.3-4Joe Orton <jorton@redhat.com> 5.0.3-3Joe Orton <jorton@redhat.com> 5.0.3-2Joe Orton <jorton@redhat.com> 5.0.3-1Joe Orton <jorton@redhat.com> 5.0.2-8Joe Orton <jorton@redhat.com> 5.0.2-7Joe Orton <jorton@redhat.com> 5.0.2-6Joe Orton <jorton�x��������������K�������X�#�fJj��H3H�����[����������������3H�vs,�get/57264
- backport color diagnostics support from trunk, enable with
  -fdiagnostics-color=auto, -fdiagnostics-color=always or
  having non-empty GCC_COLORS variable in environment
- backport -fstack-protector-strong support from trunk- update from the 4.8 branch
  - PRs bootstrap/54281, bootstrap/54659, c++/57047, c++/57068, c++/57222,
	fortran/57142, libstdc++/57212, middle-end/56988, target/55033,
	target/57237, tree-optimization/57200, tree-optimization/57214
- fix up strlen pass (PR tree-optimization/57230)- update from the 4.8 branch
  - PRs ada/56474, c++/50261, c++/56450, c++/56859, c++/56970, c++/57064,
	c++/57092, c++/57183, debug/57184, fortran/51825, fortran/52512,
	fortran/53685, fortran/56786, fortran/56814, fortran/56872,
	fortran/56968, fortran/57022, libfortran/51825, libfortran/52512,
	libfortran/56786, libstdc++/57010, middle-end/57103,
	rtl-optimization/56605, rtl-optimization/56847,
	rtl-optimization/57003, rtl-optimization/57130,
	rtl-optimization/57131, rtl-optimizations/57046, sanitizer/56990,
	target/44578, target/55445, target/56797, target/56866, target/57018,
	target/57091, target/57097, target/57098, target/57106, target/57108,
	target/57150, tree-optimization/57051, tree-optimization/57066,
	tree-optimization/57083, tree-optimization/57104,
	tree-optimization/57149, tree-optimization/57185
  - fix gcj with -fsection-anchors (#952673, PR libgcj/57074)
- enable libitm on s390{,x}
- error when linking with both -fsanitize=address and -fsanitize=thread
  (#957778)- update from the 4.8 branch
  - PRs c++/56388, fortran/56816, fortran/56994, rtl-optimization/56992,
	target/56890, target/56903, target/56948, tree-optimization/56962,
	tree-optimization/56984
- fix up LRA caused miscompilation of xulrunner on i?86
  (#949553, PR rtl-optimization/56999)
- reassoc fix for -Ofast -frounding-math (PR tree-optimization/57000)- update from the 4.8 branch
  - PRs c++/35722, c++/45282, c++/52014, c++/52374, c++/52748, c++/54277,
	c++/54359, c++/54764, c++/55532, c++/55951, c++/55972, c++/56039,
	c++/56447, c++/56582, c++/56646, c++/56692, c++/56699, c++/56722,
	c++/56728, c++/56749, c++/56772, c++/56774, c++/56793, c++/56794,
	c++/56821, c++/56895, c++/56913, debug/56819, fortran/54932,
	fortran/56696, fortran/56735, fortran/56737, fortran/56782,
	libstdc++/55977, libstdc++/55979, libstdc++/56002, libstdc++/56678,
	libstdc++/56834, lto/56777, middle-end/56694, middle-end/56768,
	middle-end/56883, other/55274, rtl-optimization/48182,
	rtl-optimization/56745, sanitizer/55702, target/54805, target/55487,
	target/56560, target/56720, target/56771, tree-optimization/48184,
	tree-optimization/48186, tree-optimization/48762,
	tree-optimization/56407, tree-optimization/56501,
	tree-optimization/56817, tree-optimization/56837,
	tree-optimization/56899, tree-optimization/56918,
	tree-optimization/56920- update from the 4.8 branch
  - GCC 4.8.0 release
  - PRs c++/56607, other/43620
  - fix length in .debug_aranges in some cases
- improve debug info for optimized away global vars (PR debug/56608)
- don't warn about signed 1-bit enum bitfields containing values 0 and -1
  or just -1 (PR c/56566)- update from the 4.8 branch
  - PRs libstdc++/56468, target/56640, tree-optimization/56635,
	tree-optimization/56661
- package libasan_preinit.o- update from trunk and the 4.8 branch
  - PRs ada/52123, c++/51412, c++/51494, c++/51884, c++/52183, c++/56222,
	c++/56346, c++/56565, c++/56567, c++/56611, c++/56614, debug/56307,
	fortran/56575, fortran/56615, libstdc++/56492, libstdc++/56609,
	libstdc++/56613, lto/56557, middle-end/56524, middle-end/56571,
	target/40797, target/49880, target/56470, target/56591, target/56619,
	testsuite/54119, tree-optimization/53265, tree-optimization/56478,
	tree-optimization/56570, tree-optimization/56608- updated from trunk
  - PRs bootstrap/56509, c++/54383, c++/55135, c++/56464, c++/56530,
	c++/56534, c++/56543, debug/55364, debug/56510, libquadmath/55473,
	lto/50293, lto/56515, middle-end/50494, middle-end/56294,
	middle-end/56525, middle-end/56526, middle-e�x�������������`;�������X#�fJj��8&������I�����f����������������I�F�ªnm0n����p��(Ɔ\���:af��:Fn�r5t�^�@�����i��#x��~�|�:�J���]�ԓ�ڶN൨��="bțj��[
`�Uf��ߎt��r*4����|n��	�S�
V��W�*�@�%n@�08��4�	Oo��P]�\'���_Aٱ[ٳ�!Om=��q�=�l	ֻK��>%��f�;����j�A-9���S�����@@�/������"&�2>�['�y�jNz����6g��6ܬ�x���#
��`�EM���I1#��扇(s�13x�|��x�h��TL�7�L)�ϝ���#��kD����k{�S�; �[�y�!r��S.�rM�e���r\1������<џ>j#���C3Tl5��(��=n���X��B�
��[i7��W�Oou��ӹ]⸇�=�&��?��I:@�y�*\>�u,��y��6� 6#k��-k�|��qR�Ae*-v�7���{m_�)���W�Ę�;��ȭ�1>2�I��f��d޴�< "M��N��n�;�����X����D�wIR�_$�F�C��408a613815b1ca8fbd537fd7b1d26a1c6fbcb18bi�ZT�0i�From xen "clockchip" (Radim Krcmar) [1003683]
- [virt] xen: Convert printks to pr_<level> (Radim Krcmar) [1003683]
- [virt] xen: ifdef CONFIG_HIBERNATE_CALLBACKS xen_*_suspend (Radim Krcmar) [1003683]
- [virt] xen-blkfront: set blk_queue_max_hw_sectors correctly (Radim Krcmar) [1003683]
- [virt] xen/io: new macro to detect whether there are too many requests on the ring (Radim Krcmar) [1003683]
- [virt] xen-netfront: use skb_partial_csum_set() to simplify the codes (Radim Krcmar) [1003683]
- [virt] xen/time: Free onlined per-cpu data structure if we want to online it again (Radim Krcmar) [1003683]
- [virt] xen/time: Check that the per_cpu data structure has data before freeing (Radim Krcmar) [1003683]
- [virt] xen/time: Don't leak interrupt name when offlining (Radim Krcmar) [1003683]
- [virt] xen/time: Encapsulate the struct clock_event_device in another structure (Radim Krcmar) [1003683]
- [virt] xen/spinlock: Don't leak interrupt name when offlining (Radim Krcmar) [1003683]
- [virt] xen/smp: Don't leak interrupt name when offlining (Radim Krcmar) [1003683]
- [virt] xen/smp: Set the per-cpu IRQ number to a valid default (Radim Krcmar) [1003683]
- [virt] xen/smp: Introduce a common structure to contain the IRQ name and interrupt line (Radim Krcmar) [1003683]
- [virt] xen/smp: Coalesce the free_irq calls in one function (Radim Krcmar) [1003683]
- [virt] xen-blkback: Use physical sector size for setup (Radim Krcmar) [1003683]
- [virt] xen-blkfront: Introduce a 'max' module parameter to alter the amount of indirect segments (Radim Krcmar) [1003683]
- [virt] xen/netif: document feature-split-event-channels (Radim Krcmar) [1003683]
- [virt] xen-netfront: split event channels support for Xen frontend driver (Radim Krcmar) [1003683]
- [virt] xen-netfront: avoid leaking resources when setup_netfront fails (Radim Krcmar) [1003683]
- [virt] xen-blkfront: use a different scatterlist for each request (Radim Krcmar) [1003683]
- [virt] xen-block: implement indirect descriptors (Radim Krcmar) [1003683]
- [acpi] Try harder to resolve _ADR collisions for bridges (Myron Stowe) [1003183]
- [cpufreq] rename ignore_nice as ignore_nice_load (Myron Stowe) [1003183]
- [acpi] processor: move try_offline_node() after acpi_unmap_lsapic() (Myron Stowe) [1003183]
- [acpi] Drop physical_node_id_bitmap from struct acpi_device (Myron Stowe) [1003183]
- [acpi] pm: Walk physical_node_list under physical_node_lock (Myron Stowe) [1003183]
- [acpi] video: improve quirk check in acpi_video_bqc_quirk() (Myron Stowe) [1003183]
- [kernel] freezer: set PF_SUSPEND_TASK flag on tasks that call freeze_processes (Myron Stowe) [1003183]
- [acpi] battery: Fix parsing _BIX return value (Myron Stowe) [1003183]
- [cpufreq] Fix cpufreq driver module refcount balance after suspend/resume (Myron Stowe) [1003183]
- [cpufreq] intel_pstate: Change to scale off of max P-state (Myron Stowe) [1003183]
- [acpi] video: ignore BIOS initial backlight value for Fujitsu E753 (Myron Stowe) [1003183]
- [pnp] acpi: avoid garbage in resource name (Myron Stowe) [1003183]
- [power] sleep: Fix comment typo in pm_wakeup.h (Myron Stowe) [1003183]
- [power] sleep: avoid 'autosleep' in shutdown progress (Myron Stowe) [1003183]
- [acpi] scan: Always call acpi_bus_scan() for bus check notifications (Myron Stowe) [1003183]
- [acpi] scan: Do not try to attach scan handlers to devices having them (Myron Stowe) [1003183]- [powerpc] Avoid link sta�x��������������*�������X9#�gJjkctlh������a		������a����������������	��
��padd to use simple authentication in migration scripts
- add indexing of a few attributes to the default configuration
- add commented-out section on using TLS to default configuration- update to 2.0.6
- add buildprereq on cyrus-sasl-devel, krb5-devel, openssl-devel
- take the -s flag off of slapadd invocations in migration tools
- add the cosine.schema to the default server config, needed by inetorgperson- add the nis.schema and inetorgperson.schema to the default server config
- make ldapadd a hard link to ldapmodify because they're identical binaries- update to 2.0.4- remove prereq on /etc/init.d (#17531)
- update to 2.0.3
- add saucer to the included clients- update to 2.0.1- update to 2.0.0
- patch to build against MIT Kerberos 1.1 and later instead of 1.0.x- remove that pesky default password
- change "Copyright:" to "License:"- adjust permissions in files lists
- move libexecdir from %{_prefix}/sbin to %{_sbindir}- add migrate_automount.pl to the migration scripts set- build a semistatic slurpd with threads, everything else without
- disable reverse lookups, per email on OpenLDAP mailing lists
- make sure the execute bits are set on the shared libraries- change logging facility used from local4 to daemon (#11047)- split off clients and servers to shrink down the package and remove the
  base package's dependency on Perl
- make certain that the binaries have sane permissions- move the init script back- tweak the init script to only source /etc/sysconfig/network if it's found- automatic rebuild- switch to gdbm; I'm getting off the db merry-go-round
- tweak the init script some more
- add instdir to @INC in migration scripts- tweak init script to return error codes properly
- change initscripts dependency to one on /etc/init.d- prereq initscripts
- make migration scripts use mktemp- do condrestart in post and stop in preun
- move init script to /etc/init.d- update to 1.2.11
- add condrestart logic to init script
- munge migration scripts so that you don't have to be
  /usr/share/openldap/migration to run them
- add code to create pid files in /var/run- FHS tweaks
- fix for compiling with libdb2- minor tweak so it builds on ia64- more minimalistic fix for bug #11111 after consultation with OpenLDAP team
- backport replacement for the ldapuser patch- fix segfaults from queries with commas in them in in.xfingerd (bug #11111)- update to 1.2.10
- add revamped version of patch from kos@bastard.net to allow execution as
  any non-root user
- remove test suite from %build because of weirdness in the build system- move the defaults for databases and whatnot to /var/lib/ldap (bug #10714)
- fix some possible string-handling problems- start earlier, stop later.- auto rebuild in new environment (release 4)- add -D_REENTRANT to make threaded stuff more stable, even though it looks
  like the sources define it, too
- mark *.ph files in migration tools as config files- update to 1.2.9- strip files- update to 1.2.7
- fix some bugs from bugzilla (#4885, #4887, #4888, #4967)
- take include files out of base package- missing ;; in init script reload) (#4734).- move stuff from /usr/libexec to /usr/sbin
- relocate config dirs to /etc/openldap- initscript munging- add the migration tools to the package- upgrade to 1.2.6
- add rc.d script
- split -devel package- upgrade to latest stable (1.1.4), it now uses configure macro.- build on arm, glibc2.1- initial cut.
- patches for signal handling on the alpha	

2.4.46-13.el72.4.46-13.el7openldapcertsldap.confliblber-2.4.so.2liblber-2.4.so.2.10.9libldap-2.4.so.2libldap-2.4.so.2.10.9libldap_r-2.4.so.2libldap_r-2.4.so.2.10.9libslapi-2.4.so.2libslapi-2.4.so.2.10.9openldapalt-openldap11-2.4.46ANNOUNCEMENTCHANGESREADMEalt-openldap11-2.4.46�x�������������P�������X�#�fJj���������)������Oq�����'����������������OqDrNq�7.2.25-2Cory McIntire <cory@cpanel.net> - 7.2.25-1Cory McIntire <cory@cpanel.net> - 7.2.24-1Cory McIntire <cory@cpanel.net> - 7.2.23-1Tim Mullin <tim@cpanel.net> - 7.2.22-2Cory McIntire <cory@cpanel.net> - 7.2.22-1Cory McIntire <cory@cpanel.net> - 7.2.21-1Cory McIntire <cory@cpanel.net> - 7.2.20-3Cory McIntire <cory@cpanel.net> - 7.2.20-2Cory McIntire <cory@cpanel.net> - 7.2.20-1Tim Mullin <tim@cpanel.net> - 7.2.19-2Cory McIntire <cory@cpanel.net> - 7.2.19-1Julian Brown <julian.brown@cpanel.net> - 7.2.18-2Cory McIntire <cory@cpanel.net> - 7.2.18-1Daniel Muey <dan@cpanel.net> - 7.2.17-4Tim Mullin <tim@cpanel.net> - 7.2.17-3Tim Mullin <tim@cpanel.net> - 7.2.17-2Cory McIntire <cory@cpanel.net> - 7.2.17-1Cory McIntire <cory@cpanel.net> - 7.2.16-2Cory McIntire <cory@cpanel.net> - 7.2.16-1Cory McIntire <cory@cpanel.net> - 7.2.15-1Tim Mullin <tim@cpanel.net> - 7.2.14-3Cory McIntire <cory@cpanel.net> - 7.2.14-2Cory McIntire <cory@cpanel.net> - 7.2.14-1Cory McIntire <cory@cpanel.net> - 7.2.13-1Cory McIntire <cory@cpanel.net> - 7.2.12-1Tim Mullin <tim@cpanel.net> - 7.2.11-2Cory McIntire <cory@cpanel.net> - 7.2.11-1Cory McIntire <cory@cpanel.net> - 7.2.10-1Cory McIntire <cory@cpanel.net> - 7.2.9-1Tim Mullin <tim@cpanel.net> - 7.2.8-2Cory McIntire <cory@cpanel.net> - 7.2.8-1Cory McIntire <cory@cpanel.net> - 7.2.7-1Rishwanth Yeddula <rish@cpanel.net> - 7.2.6-2Cory McIntire <cory@cpanel.net> - 7.2.6-1Cory McIntire <cory@cpanel.net> - 7.2.5-1Rishwanth Yeddula <rish@cpanel.net> - 7.2.4-3Rishwanth Yeddula <rish@cpanel.net> - 7.2.4-2Daniel Muey <dan@cpanel.net> - 7.2.4-1Cory McIntire <cory@cpanel.net> - 7.2.3-3Daniel Muey <dan@cpanel.net> - 7.2.3-2Daniel Muey <dan@cpanel.net> - 7.2.3-1Daniel Muey <dan@cpanel.net> - 7.2.2-1<darren@cpanel.net> - 7.2.1-5<darren@cpanel.net> - 7.2.1-4Cory McIntire <cory@cpanel.net> - 7.2.1-3<julian.brown@cpanel.net> - 7.2.1-2Jacob Perkins <jacob.perkins@cpanel.net> - 7.2.1-1<dan@cpanel.net> - 7.2.0-13<cory@cpanel.net> - 7.2.0-12<cory@cpanel.net> - 7.2.0-11.RC6<dan@cpanel.net> - 7.2.0-10.RC5Jacob Perkins <jacob.perkins@cpanel.net> - 7.2.0-9.RC5Dan Muey <dan@cpanel.net> - 7.2.0-8.RC3<cory@cpanel.net> - 7.2.0-7.RC3Tim Mullin <tim@cpanel.net> - 7.2.0-6.RC3Dan Muey <dan@cpanel.net> - - 7.2.0-5.RC3<dan@cpanel.net> - 7.2.0-4.RC3<dan@cpanel.net> - 7.2.0-3.RC1Dan Muey <dan@cpanel.net> - 7.2.0-2.beta3Dan Muey <dan@cpanel.net> - 7.2.0-1.beta3- EA4-136: Fix libxml2 v2.15.0 compatibility- ZC-12167: Correct libxml2 problem- EA-11821: Patch to build with the latest ea-libxml2- ZC-10873: Do not build on Ubuntu 22- EA-10532: Update litespeed to 8.0.1- EA-9013: Disable %check section- EA-9625: Update litespeed to 7.9- ZC-8005: Replace ea-openssl11 with system openssl on C8- ZC-7893: Update DSO config to factor in PHP 8- EA-9390: Fix build with latest ea-brotli (v1.0.9)- EA-9338: Update scl-php72 from v7.2.33 to v7.2.34- EA-9281: Update litespeed from upstream to 7.8- EA-9222: Update scl-php72 from v7.2.32 to v7.2.33- EA-9189: Update litespeed from upstream to 7.7- EA-9152: Update scl-php72 from v7.2.31 to v7.2.32- ZC-6875: Build on C8- EA-9087: Fix PHP version in DSO description- EA-9067: Update scl-php72 from v7.2.30 to v7.2.31- EA-9015: Update scl-php72 from v7.2.29 to v7.2.30- EA-8928: Updated the required version for ea-libcurl- EA-8931: Update scl-php72 from v7.2.28 to v7.2.29- ZC-6247: Remove conflict between php-fpm and runtime.- EA-8873: Update scl-php72 from v7.2.27 to v7.2.28- EA-8854: Fix circular dependencies in our PHP packages- EA-8850: Update scl-php72 from v7.2.26 to v7.2.27- ZC-4361: Update ea-openssl requirement to v1.1.1 (ZC-5583)- EA-8797: Update scl-php72 from v7.2.25 to v7.2.26- EA-8762: Update litespeed from upstream to 7.6- EA-8760: Update scl-php72 from v7.2.24 to v7.2.25- EA-8718: Update scl-php72 from v7.2.23 to v7.2.24- EA-8670: Update scl-php72 from v7.2.22 to v7.2.23- EA-8549: Build php-fpm with pcntl- EA-8635: Update scl-php72 from v7.2.21 to v7.2.22- EA-8593: Update scl-php72 fr�x��������������	�������X�#fJjtial��	5X�����]����������������5X4X6X�- GUI: added action to applet to directly report last crash (jmoskovc@redhat.com)
- Never flag backtrace as binary file (fixes problem observed in bz#571411) (vda.linux@googlemail.com)
- improve syslog file detection. closes bz#565983 (vda.linux@googlemail.com)
- add arch, package and release in comment (npajkovs@redhat.com)
- add ProcessUnpackaged option to abrt.conf (vda.linux@googlemail.com)
- abrt-debuginfo-install: use -debuginfo repos which match enabled "usual" repos (vda.linux@googlemail.com)
- fix format security error (fcrozat@mandriva.com)
- icons repackaging (jmoskovc@redhat.com)
- partial fix for bz#565983 (vda.linux@googlemail.com)
- SPEC: Updated source URL (jmoskovc@redhat.com)
- removed unneeded patches
- and much more ...- fixed kerneloops reporting rhbz#570081
- fixed Source url
- fixed debuginfo-install to work on F13
  - improved debuginfo-install (vda.linux@googlemail.com)
  - fix debuginfo-install to work with yum >= 3.2.26 (jmoskovc@redhat.com)- fix initscript even more (npajkovs@redhat.com)
- remove -R2 from yum command line- fix initscript (npajkovs@redhat.com)
- Kerneloops: make hashing more likely to produce same hash on different oopses (vda.linux@googlemail.com)- Kerneloops: make hashing more likely to produce same hash on different oopses (vda.linux@googlemail.com)
- make abrt work with the latest kernels (>= 2.6.33) (jmoskovc@redhat.com)
- lib/Utils/abrt_dbus: utf8-sanitize all strings in dbus messages (fixes #565876) (vda.linux@googlemail.com)- enabled column sorting rhbz#541853
- Load plugin settings also from ~/.abrt/*.conf (kklic@redhat.com)
- fix bz#541088 "abrt should not catch python excp EPIPE" (vda.linux@googlemail.com)
- fix bz#554242 "Cannot tab between input areas in report dialog" (vda.linux@googlemail.com)
- fix bz#563484 "abrt uses unnecessary disk space when getting debug info" (vda.linux@googlemail.com)
- Don't show empty 'Not loaded plugins' section - fix#2 rhbz#560971 (jmoskovc@redhat.com)
- fix big-endian build problem (vda.linux@googlemail.com)
- Fixes, displays package owners (kklic@redhat.com)
- GUI: fixed exception in plugin settings dialog rhbz#560851 (jmoskovc@redhat.com)
- GUI: respect system settings for toolbars rhbz#552161 (jmoskovc@redhat.com)
- python hook: move UUID generation to abrtd; generate REASON, add it to bz title (vda.linux@googlemail.com)
- make "reason" field less verbose; bz reporter: include it in "summary" (vda.linux@googlemail.com)
- added avant-window-navigator to blacklist per maintainer request (jmoskovc@redhat.com)
- CCpp analyzer: fix rhbz#552435 (bt rating misinterpreting # chars) (vda.linux@googlemail.com)
- Ask for login and password if missing from reporter plugin. (kklic@redhat.com)
- abrtd: fix handling of dupes (weren't deleting dup's directory); better logging (vda.linux@googlemail.com)
- abrtd: handle "perl -w /usr/bin/script" too (vda.linux@googlemail.com)
- Component-wise duplicates (kklic@redhat.com)
- abrtd: fix rhbz#560642 - don't die on bad plugin names (vda.linux@googlemail.com)
- Fixed parsing backtrace from rhbz#549293 (kklic@redhat.com)
- GUI: fixed scrolling in reporter dialog rhbz#559687 (jmoskovc@redhat.com)
- fixed button order in plugins windows rhbz#560961 (jmoskovc@redhat.com)
- GUI: fixed windows icons and titles rhbz#537240, rhbz#560964 (jmoskovc@redhat.com)
- Fix to successfully parse a backtrace from rhbz#550642 (kklic@redhat.com)
- cli: fix the problem of not showing oops text in editor (vda.linux@googlemail.com)
- GUI: fix rhbz#560971 "Don't show empty 'Not loaded plugins' section" (vda.linux@googlemail.com)- print __glib_assert_msg (rhbz#549735);
- SPEC: added some requires to abrt-cli to make it work out-of-the-box (jmoskovc@redhat.com)
- abrt-hook-ccpp: fix rhbz#560612 "limit '18446744073709551615' is bogus" rhbz#560612(vda.linux@googlemail.com)
- APPLET: don't show the icon when abrtd is not running rhbz#557866 (jmoskovc@redhat.com)
- GUI: made report message labels wrap (jmoskovc@redhat.com)
- GUI: don't die if daemon doesn't send the gpg keys (jmoskovc@redhat.com)
- di�x�������������@��������X�#�fJjIB (�jX�����2�����k����������������28�?0d���%�	1�	}�������	
��.�4<D	H
LT�
����,4��O(u8|9�:�GpHxI�X�Y�\�]�^�brd	efl�,@D
T����g�h�Ccpanel-perl-536-colon-config0.0041.cp108~el7CPAN module - XS helper to read a configuration file using ':' as separatorCpanel build perl module 'Colon::Config'XS helper to read a configuration file using ':' as separatorb�Kbh-centos-7.dev.cpanel.net]�perlcpanel/perlhttps://metacpan.orglinuxx86_64*�3�$�$\&^�b�K7a1157cf6b3729d3b93c7a26bece6215424908f90993ee63773d4ca8f95323764f8de230de1ce0d9c6a799ebf6f2982be8866017df7b3b223b8ca2ebc6563bcfrootrootrootrootcpanel-perl-536-colon-config-0.004-1.cp108~el7.src.rpm��������cpanel-perl(Colon::Config)cpanel-perl-colon-configcpanel-perl-536-colon-configcpanel-perl-536-colon-config(x86-64)




cpanel-perl-536rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(CompressedFileNames)rpmlib(PayloadIsXz)rpmlib(TildeInVersions)4.6.0-14.0-13.0.4-15.2-14.10.0-14.11.1b�@`-@\&@\�@\��Busy Camels <bc@cpanel.net> - 0.004-1.cp108Busy Camels <bc@cpanel.net> - 0.004-1.cp1198Nicolas Rochelemagne <rochelemagne@cpanel.net> - 0.004-1.cp1178Nicolas Rochelemagne <rochelemagne@cpanel.net> - 0.003-1.cp1178Nicolas Rochelemagne <rochelemagne@cpanel.net> - 0.002-1.cp1178- Bump to 1.cp108 for re-build- Bump to 1.cp1198 for debian re-build- Update from upstream: Colon-Config 0.004- Update from upstream: Colon-Config 0.003- Update from upstream: Colon-Config 0.0020.0040.0040.004-1.cp108~el70.004-1.cp108~el7Config.pmConfig.so/usr/local/cpanel/3rdparty/perl/536/cpanel-lib/x86_64-linux/Colon//usr/local/cpanel/3rdparty/perl/536/cpanel-lib/x86_64-linux/auto/Colon/Config/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches   -m64 -mtune=genericcpioxz2x86_64-redhat-linux-gnu?���&\�^��z�
;�''�d5cbffdbba12508e6a3035a83e3a926308b52fb0c�VC_�c�VA@cpanel.net> - 2.4.33-2Daniel Muey <dan@cpanel.net> - 2.4.33-1Rishwanth Yeddula <rish@cpanel.net> - 2.4.29-12Rishwanth Yeddula <rish@cpanel.net> - 2.4.29-11Cory McIntire <cory@cpanel.net> - 2.4.29-10Dan Muey <dan@cpanel.net> - 2.4.29-9Dan Muey <dan@cpanel.net> - 2.4.29-8Rishwanth Yeddula <rish@cpanel.net> - 2.4.29-7Cory McIntire <cory@cpanel.net> - 2.4.29-6Rishwanth Yeddula <rish@cpanel.net> - 2.4.29-5Cory McIntire <cory@cpanel.net> - 2.4.29-4Cory McIntire <cory@cpanel.net> - 2.4.29-3Cory McIntire <cory@cpanel.net> - 2.4.29-2Jacob Perkins <jacob.perkins@cpanel.net> - 2.4.29-1Jacob Perkins <jacob.perkins@cpanel.net> - 2.4.28-1Jacob Perkins <jacob.perkins@cpanel.net> - 2.4.27-8Dan Muey <dan@cpanel.net> - 2.4.27-7Dan Muey <dan@cpanel.net> - 2.4.27-6Jacob Perkins <jacob.perkins@cpanel.net> - 2.4.27-5Felipe Gasper <felipe@cpanel.net> - 2.4.27-4Cory McIntire <cory@cpanel.net> - 2.4.27-3Felipe Gasper <felipe@cpanel.net> - 2.4.27-2Jacob Perkins <jacob.perkins@cpanel.net> - 2.4.27-1Jacob Perkins <jacob.perkins@cpanel.net> - 2.4.25-12Jacob Perkins <jacob.perkins@cpanel.net> - 2.4.25-11Jacob Perkins <jacob.perkins@cpanel.net> - 2.4.25-10Cory McIntire <cory@cpanel.net> - 2.4.25-9Dan Muey <dan�x��������������������XT#�fJj add����������t���������������������t�,�?.<?)�d����	/�	l�������������	�������	
 �
������(`�(	8X9pX:�XF'�G'�H'�I'�X'�Y'�\'�]'�^(b(^c)#d)te)yf)|l)~z)��)�)�)�+�+�
-��.(.,.0g.4h.8Cea-php72-php-fileinfo7.2.3411.13.13.cpanelA module for PHP applications that need to detect file typesThe php-fileinfo package delivers a module which will allow PHP
scripts to try to guess the content type and encoding of a file by
looking for certain magic byte sequences at specific positions within
the file. While this is not a bullet proof approach the heuristics
used do a very good job.i��Ohou-2T�aEA4-production / CentOS_7cPanel, Inc.PHPDevelopment/Languageshttp://www.php.net/linuxx86_649T�(����i��i��b0075e0522dc1baf4c164c804f9efb4e4e9be7db8d75073a0362356bcb9160bb63960ff4dfa064ebf12f653ee4df9bb065c73814c8e4f7339afd557bf87b0dd5rootrootrootrootea-php72-php-7.2.34-11.13.13.cpanel.src.rpm��������ea-php72-php-fileinfoea-php72-php-fileinfo(x86-64)


@@@@@@@@
ea-php72-php-commonea-php72-php-clirpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(CompressedFileNames)libc.so.6()(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.3)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libc.so.6(GLIBC_2.8)(64bit)rtld(GNU_HASH)rpmlib(PayloadIsXz)7.2.34-11.13.13.cpanel7.2.34-11.13.13.cpanel4.6.0-14.0-13.0.4-15.2-14.11.3h�R@f�)@e\��d,@b\@`ٹ�`B@_���_���_�]@_u�_R,@_+�_�@_�^��^��@^�2�^��@^|�@^s^�^[��^Nt�^=Q@^)��]�f@]��]��]�|@]��@]���]z3@]nU�]B�@]5�@]#0@];�]�\�@\�s@\��\��@\���\��\��\�M�\��\\�\P@@\J�@\73�\	@[�%@[��[�;@[�Q@[y[�[U�@[P}@[0�@[{@[��Z�@Z�3@ZԐ@Z�@Z���Z���Z��@ZtR�Za�ZX�@ZWQ�ZT��ZOh�Z'�Z%8�Z�@ZN�Y��Y�B@Y�@Y�Y�d�Y�*@Y��@Y���Y��Chris Castillo <chris.castillo@webpros.com> - 7.2.34-11Julian Brown <julian.brown@cpanel.net> - 7.2.34-10Tim Mullin <tim@cpanel.net> - 7.2.34-9Julian Brown <julian.brown@cpanel.net> - 7.2.34-8Travis Holloway <t.holloway@cpanel.net> - 7.2.34-7Travis Holloway <t.holloway@cpanel.net> - 7.2.34-6Cory McIntire <cory@cpanel.net> - 7.2.34-5Julian Brown <julian.brown@cpanel.net> - 7.2.34-4Daniel Muey <dan@cpanel.net> - 7.2.34-3Tim Mullin <tim@cpanel.net> - 7.2.34-2Cory McIntire <cory@cpanel.net> - 7.2.34-1Tim Mullin <tim@cpanel.net> - 7.2.33-2Cory McIntire <cory@cpanel.net> - 7.2.33-1Tim Mullin <tim@cpanel.net> - 7.2.32-2Cory McIntire <cory@cpanel.net> - 7.2.32-1Julian Brown <julian.brown@cpanel.net> - 7.2.31-3Tim Mullin <tim@cpanel.net> - 7.2.31-2Cory McIntire <cory@cpanel.net> - 7.2.31-1Cory McIntire <cory@cpanel.net> - 7.2.30-1Tim Mullin <tim@cpanel.net> - 7.2.29-2Cory McIntire <cory@cpanel.net> - 7.2.29-1Julian Brown <julian.brown@cpanel.net> - 7.2.28-2Cory McIntire <cory@cpanel.net> - 7.2.28-1Tim Mullin <tim@cpanel.net> - 7.2.27-2Cory McIntire <cory@cpanel.net> - 7.2.27-1Daniel Muey <dan@cpanel.net> - 7.2.26-2Cory McIntire <cory@cpanel.net> - 7.2.26-1Tim Mullin <tim@cpanel.net> - 7.2.25-2Cory McIntire <cory@cpanel.net> - 7.2.25-1Cory McIntire <cory@cpanel.net> - 7.2.24-1Cory McIntire <cory@cpanel.net> - 7.2.23-1Tim Mullin <tim@cpanel.net> - 7.2.22-2Cory Mc�x�������������0�������XK#�eJj��������xd|����������������������|�{�}��pyclookup.cpython-311.opt-1.pyclookup.cpython-311.pycmodel.cpython-311.opt-1.pycmodel.cpython-311.pycutils.cpython-311.opt-1.pycutils.cpython-311.pyccheckers.pyconstants.pycontrol.pyexceptions.pyhooks.pylookup.pymodel.pyplugins__init__.py__pycache____init__.cpython-311.opt-1.pyc__init__.cpython-311.pycnative.cpython-311.opt-1.pycnative.cpython-311.pycnative.pyrpc__init__.py__pycache____init__.cpython-311.opt-1.pyc__init__.cpython-311.pycendpoints__init__.py__pycache____init__.cpython-311.opt-1.pyc__init__.cpython-311.pycnative.cpython-311.opt-1.pycnative.cpython-311.pycshow.cpython-311.opt-1.pycshow.cpython-311.pycupdate.cpython-311.opt-1.pycupdate.cpython-311.pycutils.cpython-311.opt-1.pycutils.cpython-311.pycnative.pyshow.pyupdate.pyutils.pyschemanative.picklenative.yamlshow.pickleshow.yamlupdate.pickleupdate.yamlutils.pyfiles__init__.py__pycache____init__.cpython-311.opt-1.pyc__init__.cpython-311.pychooks.cpython-311.opt-1.pychooks.cpython-311.pychooks.pyhooks__init__.py__pycache____init__.cpython-311.opt-1.pyc__init__.cpython-311.pycexecute.cpython-311.opt-1.pycexecute.cpython-311.pycnative.cpython-311.opt-1.pycnative.cpython-311.pycexecute.pynative.pyinternals__init__.py__pycache____init__.cpython-311.opt-1.pyc__init__.cpython-311.pycauth_protocol.cpython-311.opt-1.pycauth_protocol.cpython-311.pyccln.cpython-311.opt-1.pyccln.cpython-311.pycdeadlock_detecting_lock.cpython-311.opt-1.pycdeadlock_detecting_lock.cpython-311.pycglobal_scope.cpython-311.opt-1.pycglobal_scope.cpython-311.pyciaid.cpython-311.opt-1.pyciaid.cpython-311.pyclazy_load.cpython-311.opt-1.pyclazy_load.cpython-311.pyclogger.cpython-311.opt-1.pyclogger.cpython-311.pyclogging_protocol.cpython-311.opt-1.pyclogging_protocol.cpython-311.pycpersistent_message.cpython-311.opt-1.pycpersistent_message.cpython-311.pycthe_sink.cpython-311.opt-1.pycthe_sink.cpython-311.pycauth_protocol.pycln.pydeadlock_detecting_lock.pyglobal_scope.pyiaid.pylazy_load.pylogger.pylogging_protocol.pypersistent_message.pythe_sink.pymigrate.pymigrations001_initial.py002_infected_domain_list.py003_import_from_list.py004_add_username_to_infected_domain_list.py005_timeout_in_iplist.py006_comment_in_plist.py007_add_country_code_fields.py008_fill_countries.py009_drop_blocklist_history.py010_drop_country_entities.py011_create_new_country_entities.py012_fill_countries_and_subnets.py013_add_indexes_to_iplist.py014_add_malware_hits.py015_add_iplist_expiration_index.py016_fix_autowhitelist_expiration.py017_remove_sensor_prefix.py018_license_info.py019_purge_old_configs.py020_malware_scan_types.py021_add_testing_repo.py022_mod_security_vendors_migrations.py023_add_default_rule_in_modsec_custom_conf.py024_ignore_from_graylist.py025_malware_config_realtime.py026_remove_old_temporary_file.py027_disable_comdo_fp_rules.py028_set_permanent_ttl_for_blacklist.py029_custom_quarantine.py030_rename_max_incident_repetition.py031_add_mode_field.py031_modsec_config_for_plesk_include.py032_chmod_quarantine.py033_disable_cphulk.py034_hits_extras.py035_add_dos_expiration_field.py036_add_block_port.py037_disabled_rules.py038_disabled_rules_import.py039_fix_malware_hits.py040_ignore_mod_sec_rule_214920.py041_fix_invalid_ignore_filed.py042_rebuildinstalledssldb.py043_disable_dos_scan_by_default.py044_ignore_virtfs_on_cpanel.py045_ignore_vdserver_dir_in_csf.py046_foreign_key_fix.py047_license_in_file.py048_malware_hits_vendor_field.py049_add_auto_added_field_to_iplist.py050_fill_auto_whitelisted.py051_cleanup_vd_license.py052_whitelisted_crawlers.py053_populate_whitelisted_crawlers.py054_add_malicious_and_added_date_fileds.py055_migrate_move_to_quar_option.py056_populate_malicious_with_quarantined.py057_filename_is_blob.py058_convert_license_last_attempt.py059_scans_error_field.py061_migrate_backup_system_conf.py062_drop_malware_extra_data.py062_fix_null_expiration.py063_fix_graylist_doslist_expiration_discrepancy.py064_�x���������������������X#,gJj �������pK�H�����-�����������������H1��y�rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootkrb5-1.15.1-55.el7_9.tuxcare.els2.src.rpm����������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������config(krb5-libs)krb5-libskrb5-libs(x86-64)libgssapi_krb5.so.2()(64bit)libgssapi_krb5.so.2(HIDDEN)(64bit)libgssapi_krb5.so.2(gssapi_krb5_2_MIT)(64bit)libgssrpc.so.4()(64bit)libgssrpc.so.4(HIDDEN)(64bit)libgssrpc.so.4(gssrpc_4_MIT)(64bit)libk5crypto.so.3()(64bit)libk5crypto.so.3(HIDDEN)(64bit)libk5crypto.so.3(k5crypto_3_MIT)(64bit)libkdb5.so.8()(64bit)libkdb5.so.8(HIDDEN)(64bit)libkdb5.so.8(kdb5_8_MIT)(64bit)libkrad.so.0()(64bit)libkrad.so.0(HIDDEN)(64bit)libkrad.so.0(krad_0_MIT)(64bit)libkrb5.so.3()(64bit)libkrb5.so.3(HIDDEN)(64bit)libkrb5.so.3(krb5_3_MIT)(64bit)libkrb5support.so.0()(64bit)libkrb5support.so.0(HIDDEN)(64bit)libkrb5support.so.0(krb5support_0_MIT)(64bit)@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@


@
/bin/sh/sbin/ldconfig/sbin/ldconfigconfig(krb5-libs)coreutilsgawkgrepkeyutils-libslibc.so.6()(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.15)(64bit)libc.so.6(GLIBC_2.16)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.3)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libc.so.6(GLIBC_2.7)(64bit)libc.so.6(GLIBC_2.8)(64bit)libcom_err.so.2()(64bit)libcrypto.so.10()(64bit)libcrypto.so.10(libcrypto.so.10)(64bit)libdl.so.2()(64bit)libdl.so.2(GLIBC_2.2.5)(64bit)libgssapi_krb5.so.2()(64bit)libgssapi_krb5.so.2(gssapi_krb5_2_MIT)(64bit)libgssrpc.so.4()(64bit)libgssrpc.so.4(gssrpc_4_MIT)(64bit)libk5crypto.so.3()(64bit)libk5crypto.so.3(k5crypto_3_MIT)(64bit)libkeyutils.so.1()(64bit)libkeyutils.so.1(KEYUTILS_0.3)(64bit)libkeyutils.so.1(KEYUTILS_1.0)(64bit)libkeyutils.so.1(KEYUTILS_1.5)(64bit)libkrb5.so.3()(64bit)libkrb5.so.3(krb5_3_MIT)(64bit)libkrb5support.so.0()(64bit)libkrb5support.so.0(krb5support_0_MIT)(64bit)libresolv.so.2()(64bit)libresolv.so.2(GLIBC_2.2.5)(64bit)libselinux.so.1()(64bit)libssl.so.10()(64bit)libssl.so.10(libssl.so.10)(64bit)libverto.so.1()(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rtld(GNU_HASH)sedrpmlib(PayloadIsXz)1.15.1-55.el7_9.tuxcare.els21.5.83.0.4-14.6.0-14.0-15.2-14.11.3if ! grep -q 'includedir /etc/krb5.conf.d' /etc/krb5.conf ; then
    sed -i '1i # Other applications require this directory to perform krb5 configuration.\nincludedir /etc/krb5.conf.d/\n' /etc/krb5.conf
fikrb5-libs1.15.1-13g�;�f�cjD�bi0@bN�@ap�^��^��^��^��]>�]>�]>�]>�]>�]>�]8H@]5�@]5�@\�@\��\��[a��[D��[d@[o�[o�[@[@[@[@[@[@Z�@Z�3@Z��Z���Z�<�ZO�Y��Y��Y��Y��Y�{�Y�A@Y��@Y���Y��@Y.�X�@X�-�X�g@X�g@X���X�O@X�O@X��@Xl�X�@W�Q�W�Q�W�@W��W�E@W�E@W�g�W�g�Ws�@WaC@W^�@WP�WI�@WH6�WE��W!�@Wo@W�W��W�@WK�WK�W��V���V���V�a�V��@V��@U�U�A�U�o�U�o�U�o�Uĝ�U�n�UhT�U]�UU�UU�UT�@UG_@U:0@T�,@T��@T��T��T�A@T~�@T
�@T
�@T	��S��S�v�S�S�@S�@S�@S�j@S��S�i@S�#@S���S�h@S��@S�P@S�@S��R��R�@R�@R�a@R�@R��@RΏ@RΏ@Rʚ�R�T�R�T�R��R��R��R��@R��@R��@R�S�R�v@R�R�R�@R�@R�@R��Rx�Rw�@Rfh�R_�@R^�R].@R[�R[�RN��RL
�RIg�RD!�RB�@RB�@RA~�R@-@R:�@R2�@R2�@R-�@R-�@R)�RN�R�Q�Y@Q�d�Q��Q�*@Q�o@Q��@Q��Q���Q�?@Q�?@Q��@Q�a�Q��Q~`�Qvw�Qn��Qk�Qg�@Qd�Q\�QT0�QQ��QG�Q=�@Q/F�Q-�@Q+R@Q�P�Z�P��@P��@P��@P�*�P�*�P��@P~��Pa��PM�@PI�PH�@P?U�P?U��x������������� ��������X�#�fJjx����?����������������������?@�64-redhat-linux-gnuASCII textdirectoryELF 64-bit LSB executable, x86-64, version 1 (GNU/Linux), dynamically linked (uses shared libs), for GNU/Linux 2.6.32, BuildID[sha1]=559cdc92f4a2f924013d7abdbb82c5ce6d1a57e7, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=4b534b9a22770d3cba20bc1fa46287cc60410431, strippedELF 64-bit LSB executable, x86-64, version 1 (GNU/Linux), dynamically linked (uses shared libs), for GNU/Linux 2.6.32, BuildID[sha1]=d6f7158e51192762ad3e580a052415bcee3dd7a8, strippedq{q
rRVR?R/R%R7RwR=RsRrRtRuRqRXR1RBRFRNRQRMRERORPRIRJRRRKRGRDRHRLR!RRRR:RjRdRhRgR`RfRcRiReRlR\R[RaRkRbR^R]R_RZRRRRRRRRRRRR
RWR<R.R;R>RCR6R8RUR RSRYR)R3R2RRARR@RvRRRR
R	RR9R0R#R,R+R-R*R4RRnRmRoRR5RpR"R'R(RR$RR?R&RRRRRR>R$RRVR?R/R%R7RTRwR=RsRrRtRuRqRXR1RBRFRNRQRMRERORPRIRJRRRKRGRDRHRLR!RRRR:RjRdRhRgR`RfRcRiReRlR\R[RaRkRbR^R]R_RZRRRRRRRRRRRR
RWR<R.R;R>RCR6R8RUR RSRYR)R3R2RRARR@RvRRRR
R	RR9R0R#R,R+R-R*R4RRnRmRoRR5RpR"R'R(RR$R?���0����>���W�ra1?ߩ�Ff+�|
	����K�~~c�̬
���,�O'��v���Sv��hy����]�yŊP6��Ff+�|
	����K�~В�{�����IFw�⹫{&BԨ���~�GGO��*��Ci~ړ�3554c6a547f4832c78e9b0cbeeee52ba7ece1798h��a���/h��`83ea1a4e64f7afdec820f03b5c5033942e4161dc6bf85207a33ade2650f97f1eaa3392b4e96cd46595f1600e8b4e43909b601ba5167ed5657fe167881256bbb87a3df72fb6154fc33f296d50e78fdac108afe49818babf497a823f35e98028542378495a9428c8e0f73ba1854aed4475b2c99f9386211c2d531a6ae067dc5ed3f7d32bff3175c8ade9fb6c96b242e8fff092a7440d86e55b98862c69e5528ed224eba9208e824d2ca4495f87de538e036318e71c71d353d067bef83fa06f5bd0e8b329029bd98577f57ad8ba5ba6d14c31d1b2065d83e76cf4a6cad607544163160f5dae25c52b4018df6c84347cfa8b2b15951ebf9f834bb20241511f988fb4a9beeb9c7e77b4907c90bcf09533d7b740ffcd83d35bd6575e1897f992705f47a59d02fefbf2772a59c833a66511f6fa23568fd089169f9493e73f736ca523a16fa282f689b8fa63bea7950ce6a21bf52ed88ea0d77673ee76e6de12f51191174d91b8a00ad36965633092a713ba944df40f2eb236143950c4e3429b35a69b245557878b5260c15862b07e093a421dd9ff517b41b8eae9254aca00563711695421861422faefdc14900b1d02ff9161bdbaac94568d277b3ef01a0acc5ef5eba8d6e6c52e836689e45b9c123dc04c7857b5cc672758a1446bfb92aeb995a3310e3eb0974774b16e1be421b175832f120ab7ac529b8f18a45c82dcc0f97aee792a4bd6f198a92d6a7d94ca209c7406138e1a975dfff2fa368afc39e89c47eb4cf2f4467ce966da9fc15474506e6f14f48e34015b7d686f648aed02406ed730ebd1ed0e398b076b988588dfa2866586db6837e0a7a2ebe91c3ffb703f02bc7e638cf25c24549506f52ca7abe9325aceefe5c7e0ab0589e89fc8be0c871193292972546ea617b20ec0476cb6d32cbcdbc1f81b552ec52bf4bdf43248eed6ebffb48285254cadbbbf91267996bdaa3e265f07fb8dffd46236a05f31f34ecd5a8073badd6d56c2427752a954a6e78e77004cfdc946708812122d2295b36b93c4d1e9a4feea28d320c10252a6a7de84bc553d6ee84732896284118dbb9dc8dacfa3e8c74e9699e6c227a17af5c9307f96d6031192955069ea1fae05ca8922e220fb61b722b29f32a94d30436bbae253031423670dc45e678d8651d828a5afae217c1987e06194c6aadbf9d4f5ae868374a77dda6a2ef3bdd6b401fd9f79c6346c3c28779153f1fe97b8423e34199f7df3e65fd53c4df067a56ab6fe0f2296474ba7da0656460c509aeb3be64e428d7e0004ce224620ab01bf94adaacefbb449611939df56bc5b6b813a2c7a62646fa9346c05b1145b01b2181227d06d46d464839995b98f2518b31b3497256262f2d3eacc9fbf0f2ad6d3674520e6b11383c2760ea72da517e8334c18bfe6d007a0bcb6f1e7b3619b9592acea6ce60775d6f8d3d56f7ca8d50b�x����������������������X&#�gJj��������������vG���������������������vG�G`� Collect package manager issues as they relate to traffic stats collection.- WPX-8246: Track WP2 feature usage- CPANEL-46464: Collect number of resellers, cPanel, and webmail users consenting to analytics- CPANEL-47889: Collect OCSP stats on SSL certificates.
  Note that release 1.4.56-3 existed and was built, but reverted in favor of this version.- CPANEL-48285: Revert CPANEL-48079 changes:
  Reverted commit: fcc24be - Remove personhood input from whm, cpanel, and webmail templates'- CPANEL-48079: Remove personhood input from whm, cpanel, and webmail templates.- CPANEL-48009: Squash "Not a HASH reference" errors from Elevate.pm.- CPANEL-48009: Further suppress "Not an ARRAY reference" errors from Elevate.pm.- CPANEL-47717: Fix bug where traffic logs were not read properly in all cases.- CPANEL-47560: Fix bug where traffic logs were not rotated properly- CPANEL-46535: Improve the email statistics gathering.- CPANEL-46499: Report NS management information- Add visitors data to hash from cpanel-server-traffic.- Collect data from /var/log/cpanel-server-traffic- Move Elevate logic into its' own module
- Collect data about what distro version a server may have elevated from- Collect AppConfig information- Fix data collection for Xovi & SocialBee plugins.
- The is-plugin-usable righly looks for feature installation
- The addressable-cpanel-users excludes suspended users
- Move _add_SocialBee_data & _add_XOVI_data at the top to workaround init_acls
issue which causes ACL check to fail- Collect additional Roundcube usage data.- Add Roundcube mixpanel_analytics plugin.- DUCKS-1492: Report XOVI and SocialBee data- HB-8102: Set defaults for known eximlog keys- DUCKS-6: Report the 360 Monitoring data.- HB-7985: Fixup for count of domains that are using remote MX.- HB-7814: Update malware detection stats to fail gracefully.
- HB-8007: Add root of reported SMTP host to EximMainlog stats- HB-7985: Count remote Mail eXchange records in DNS zones.- HB-7864: Gather details about custom SpamAssassin rules.- HB-7807: Add more stats related to remote mail delivery- HB-7814: Add Imunify malware detection to UpdateGatherer- HB-7805: Total Email Sent/Received via Exim- HB-7812: Add more mail quota analytics- HB-7813: Add SpamAssassin analytics- GDATA-838: Adjust regex to add more cpanel plugin packages.- RE-893: Subtract the number of addon domains from subdomain count in
  domains_by_type breakdown.- MOON-434: WHM's analytics template persists slideout dismissal.- HB-7906: Update README and bump release- HB-7929: Adjust email account count collection method.- RE-765: Begin collecting data on domain counts *by type* (addon, park, sub).
- Fix bug in count for 'domains_per_account' where total count was incorrect.- MOONS-1598: Redesign and add personhood dropdown in consent privacy flyout.- ZC-12106: Introduce Ubuntu EasyApache4 data reporting.- HB-7766: Gather the number of domains with a DMARC zone record.- HB-7584: Gather "previous day" CalDAV/CardDAV usage data.- QUACKEN-288: Modify sitejet domains field to include just the published domains.- PHX-669: Add some basic server configurations- PHX-743: Fix Mixpanel initialization on opt-in- PH-20731
- Remove Mixpanel distribution and instrumentation from cpanel-analytics package.
- Moved it into cpanel code base.
- Marked Analytics.pm module as `DEPRECATED`.- BOO-4166: Gather domains per user account data.- RE-282: Don't send back blocker file info if blocker file is older than 8 days- PHX-423: Add a couple of fields to elevate data- RE-285: Send back 'cloudlinux_database_installed' key with elevate data- PHX-257: Fix elevate data structure- BOO-3969: Fixed cPanel-Tools-Nav-Link and cPanel-Main-Menu-Nav-Link mixpanel events.- BOO-3970: Ensure Cpanel::Pkgr is present before trying to use it.- PHX-263: Remove repeated errors of invalid data type- BOO-3830: Gather data for Site Quality Monitoring.- RE-229: Send back '/var/cpanel/elevate' instead of '/var/cpanel/version/elevate'- PHX-181: Update mailbox disk sizes to hav�x���������������������X1#`fJj1479��������P��������������������������������� !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMwhiptaillibnewt.so.0.52libnewt.so.0.52.15newt-0.52.15COPYINGnewt.monewt.monewt.monewt.monewt.monewt.monewt.monewt.monewt.monewt.monewt.monewt.monewt.monewt.monewt.monewt.monewt.monewt.monewt.monewt.monewt.monewt.monewt.monewt.monewt.monewt.monewt.monewt.monewt.monewt.monewt.monewt.monewt.monewt.monewt.monewt.monewt.monewt.monewt.monewt.monewt.monewt.monewt.monewt.monewt.monewt.monewt.monewt.monewt.monewt.monewt.monewt.monewt.monewt.monewt.monewt.monewt.monewt.monewt.monewt.monewt.monewt.monewt.monewt.monewt.monewt.monewt.monewt.monewt.monewt.monewt.monewt.monewt.mowhiptail.1.gz/usr/bin//usr/lib64//usr/share/doc//usr/share/doc/newt-0.52.15//usr/share/locale/ar/LC_MESSAGES//usr/share/locale/as/LC_MESSAGES//usr/share/locale/ast/LC_MESSAGES//usr/share/locale/bal/LC_MESSAGES//usr/share/locale/bg/LC_MESSAGES//usr/share/locale/bn/LC_MESSAGES//usr/share/locale/bn_IN/LC_MESSAGES//usr/share/locale/bs/LC_MESSAGES//usr/share/locale/ca/LC_MESSAGES//usr/share/locale/cs/LC_MESSAGES//usr/share/locale/cy/LC_MESSAGES//usr/share/locale/da/LC_MESSAGES//usr/share/locale/de/LC_MESSAGES//usr/share/locale/dz/LC_MESSAGES//usr/share/locale/el/LC_MESSAGES//usr/share/locale/eo/LC_MESSAGES//usr/share/locale/es/LC_MESSAGES//usr/share/locale/et/LC_MESSAGES//usr/share/locale/eu/LC_MESSAGES//usr/share/locale/fa/LC_MESSAGES//usr/share/locale/fi/LC_MESSAGES//usr/share/locale/fr/LC_MESSAGES//usr/share/locale/ga/LC_MESSAGES//usr/share/locale/gl/LC_MESSAGES//usr/share/locale/gu/LC_MESSAGES//usr/share/locale/he/LC_MESSAGES//usr/share/locale/hi/LC_MESSAGES//usr/share/locale/hr/LC_MESSAGES//usr/share/locale/hu/LC_MESSAGES//usr/share/locale/ia/LC_MESSAGES//usr/share/locale/id/LC_MESSAGES//usr/share/locale/it/LC_MESSAGES//usr/share/locale/ja/LC_MESSAGES//usr/share/locale/km/LC_MESSAGES//usr/share/locale/kn/LC_MESSAGES//usr/share/locale/ko/LC_MESSAGES//usr/share/locale/ku/LC_MESSAGES//usr/share/locale/lt/LC_MESSAGES//usr/share/locale/lv/LC_MESSAGES//usr/share/locale/mg/LC_MESSAGES//usr/share/locale/mk/LC_MESSAGES//usr/share/locale/ml/LC_MESSAGES//usr/share/locale/mr/LC_MESSAGES//usr/share/locale/ms/LC_MESSAGES//usr/share/locale/nb/LC_MESSAGES//usr/share/locale/nds/LC_MESSAGES//usr/share/locale/ne/LC_MESSAGES//usr/share/locale/nl/LC_MESSAGES//usr/share/locale/nn/LC_MESSAGES//usr/share/locale/pa/LC_MESSAGES//usr/share/locale/pl/LC_MESSAGES//usr/share/locale/pt/LC_MESSAGES//usr/share/locale/pt_BR/LC_MESSAGES//usr/share/locale/ro/LC_MESSAGES//usr/share/locale/ru/LC_MESSAGES//usr/share/locale/sk/LC_MESSAGES//usr/share/locale/sl/LC_MESSAGES//usr/share/locale/sq/LC_MESSAGES//usr/share/locale/sr/LC_MESSAGES//usr/share/locale/sr@latin/LC_MESSAGES//usr/share/locale/sv/LC_MESSAGES//usr/share/locale/ta/LC_MESSAGES//usr/share/locale/te/LC_MESSAGES//usr/share/locale/tg/LC_MESSAGES//usr/share/locale/th/LC_MESSAGES//usr/share/locale/tl/LC_MESSAGES//usr/share/locale/tr/LC_MESSAGES//usr/share/locale/uk/LC_MESSAGES//usr/share/locale/vi/LC_MESSAGES//usr/share/locale/wo/LC_MESSAGES//usr/share/locale/xh/LC_MESSAGES//usr/share/locale/zh_CN/LC_MESSAGES//usr/share/locale/zh_TW/LC_MESSAGES//usr/share/man/man1/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches   -m64 -mtune=genericcpioxz2x86_64-redhat-linux-gnu�x������S���������X�#�fJj����������������4�����g����������������44	sr/share/doc/bc-1.06.95/Examples//usr/share/info//usr/share/man/man1/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches   -m64 -mtune=genericcpioxz2x86_64-redhat-linux-gnuELF 64-bit LSB executable, x86-64, version 1 (SYSV), dynamically linked (uses shared libs), for GNU/Linux 2.6.32, BuildID[sha1]=0xfa14e3606e984ee8614bcc67fcdb6b98861f8a10, strippedELF 64-bit LSB executable, x86-64, version 1 (SYSV), dynamically linked (uses shared libs), for GNU/Linux 2.6.32, BuildID[sha1]=0xea98855fdeaac276dcb254f4b4728484bdd42e45, strippeddirectoryASCII textPascal source, ASCII texttroff or preprocessor input, ASCII text (gzip compressed data, from Unix, max compression)

RRR	RRRR
RRRRRR	RRRR?���@İ�S���$ƨ������������"�R���2�������%��Mq�j4���7+����[��#(�)��*�Qzn��a�I�i�¡�>�}:]�q4��-s�S��٠}2��4^����A�r�xT��xW��ٕ�p���&���L���&d��Zl�M-ɹ�f�&�i�����5�k��ٯ̣�ܶ���r�Ӷ8�B�ߌ
f�` � ���^L�E;[��{�Y.��VZO�7Z�t]�6M$<��Zv���j��С��>�E净�oODk�
F�F�y�����G�ݤ~�E��E3���i<��v��dm�V�/y�!�Ek��e�����Q��C��'��B�OӲ�ۉ�^ a�O�ُ��)�ѴZ�{����[�N�1/�+SC4%o��c��v�D�f���X�5B���5������r�i�RF��b�Z�(�<�s���MHn_���h�v�rK{�N�jVNP�rZ���0���k-��鎕�/��~̂	���bݯ�LE��S���$ƨ���� �~����tM�U %��\4R��%�@��s��!�(�A?����MN��ᡩW���y9)���L��a�b��,5�[�x��#�B�8�)5M�4�G����I��
H��~GJ�X�O/b�����*
��P��+$ķ�i�qb�'3�y�^�<�?�n�h��8��O���)�wQ w�Ƿ0+���wg{���W����t�?���~�e��i
�,?�"�\�"�7I��KY9�l���ǽ��Q-����E�yp����{J�b�c,NBZ��b�FW2�nr=��ʀP��	�Z}���f�����#�g�>���G�lQje���H���UJ���MlSC*�F}��Mļ���}5����E��6hњEũ�Ҕ�`~������ڟ�ܻ�&n	��1��N��t�ѹ�:k �_b�y��W�4������
��X�̦q�5��EtAe��;�j�͉:����򁫡Y����;3�t��/�ڧQM�~fefda9a94a0c94e3dbc04620ca13f6ebd1d53fe5bL�elbL��ze read-only module parameters (Mike Snitzer) [1049591]
- [md] dm-cache: actually resize cache (Mike Snitzer) [1049591]
- [md] dm-cache-policy-mq: fix promotions to occur as expected (Mike Snitzer) [1049591]
- [md] dm-thin: allow pool in read-only mode to transition to read-write mode (Mike Snitzer) [1049591]
- [md] dm-thin: re-establish read-only state when switching to fail mode (Mike Snitzer) [1049591]
- [md] dm-thin: always fallback the pool mode if commit fails (Mike Snitzer) [1049591]
- [md] dm-thin: switch to read-only mode if metadata space is exhausted (Mike Snitzer) [1049591]
- [md] dm-thin: switch to read only mode if a mapping insert fails (Mike Snitzer) [1049591]
- [md] dm-space-map-metadata: return on failure in sm_metadata_new_block (Mike Snitzer) [1049591]
- [md] dm-table: fail dm_table_create on dm_round_up overflow (Mike Snitzer) [1049591]
- [md] dm-snapshot: avoid snapshot space leak on crash (Mike Snitzer) [1049591]
- [md] dm-delay: fix a possible deadlock due to shared workqueue (Mike Snitzer) [1049591]
- [md] dm-cache: resolve small nits and improve Documentation (Mike Snitzer) [1049591]
- [md] dm-cache: add cache block invalidation support (Mike Snitzer) [1049591]
- [md] dm-cache: add remove_cblock method to policy interface (Mike Snitzer) [1049591]
- [md] dm-cache-policy-mq: reduce memory requirements (Mike Snitzer) [1049591]
- [md] dm-cache-metadata: check the metadata version when reading the superblock (Mike Snitzer) [1049591]
- [md] dm-cache: add passthrough mode (Mike Snitzer) [1049591]
- [md] dm-cache: cache shrinking support (Mike Snitzer) [1049591]
- [md] dm-cache: promotion optimisation for writes (Mike Snitzer) [1049591]
- [md] dm-cache: be much more aggressive about promoting writes to discarded �x�����PCu�������X�#3gJj4456�
������HM����� ����������������HMGM	O�hat.com>Nalin Dahyabhai <nalin@redhat.com> 1.3.1-4Dan Walsh <dwalsh@redhat.com> 1.3.1-3Nalin Dahyabhai <nalin@redhat.com> 1.3.1-2Nalin Dahyabhai <nalin@redhat.com> 1.3.1-1Nalin Dahyabhai <nalin@redhat.com> 1.3.1-0Nalin Dahyabhai <nalin@redhat.com> 1.3-2Nalin Dahyabhai <nalin@redhat.com> 1.3-1Nalin Dahyabhai <nalin@redhat.com> 1.2.8-4Nalin Dahyabhai <nalin@redhat.com> 1.3-0.beta.4Elliot Lee <sopwith@redhat.com>Jeremy Katz <katzj@redhat.com> 1.2.8-2Nalin Dahyabhai <nalin@redhat.com> 1.2.8-1Nalin Dahyabhai <nalin@redhat.com> 1.2.7-14Nalin Dahyabhai <nalin@redhat.com> 1.2.7-13Nalin Dahyabhai <nalin@redhat.com> 1.2.7-12Nalin Dahyabhai <nalin@redhat.com> 1.2.7-11Nalin Dahyabhai <nalin@redhat.com> 1.2.7-10Nalin Dahyabhai <nalin@redhat.com> 1.2.7-9Nalin Dahyabhai <nalin@redhat.com> 1.2.7-8Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 1.2.7-7Tim Powers <timp@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 1.2.7-5Bill Nottingham <notting@redhat.com> 1.2.7-4Jeremy Katz <katzj@redhat.com> 1.2.7-3Jakub Jelinek <jakub@redhat.com> 1.2.7-2Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 1.2.7-1Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 1.2.6-5Nalin Dahyabhai <nalin@redhat.com> 1.2.6-4Nalin Dahyabhai <nalin@redhat.com> 1.2.6-3Nalin Dahyabhai <nalin@redhat.com> 1.2.6-2Nalin Dahyabhai <nalin@redhat.com> 1.2.6-1Nalin Dahyabhai <nalin@redhat.com> 1.2.5-7Nalin Dahyabhai <nalin@redhat.com> 1.2.5-6Nalin Dahyabhai <nalin@redhat.com> 1.2.5-5Jakub Jelinek <jakub@redhat.com> 1.2.5-4Tim Powers <timp@redhat.com>Tim Powers <timp@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 1.2.5-1Nalin Dahyabhai <nalin@redhat.com> 1.2.4-1Nalin Dahyabhai <nalin@redhat.com> 1.2.3-5Florian La Roche <Florian.LaRoche@redhat.de>Nalin Dahyabhai <nalin@redhat.com> 1.2.3-3Nalin Dahyabhai <nalin@redhat.com> 1.2.3-2Nalin Dahyabhai <nalin@redhat.com> 1.2.3-1Nalin Dahyabhai <nalin@redhat.com> 1.2.2-14Nalin Dahyabhai <nalin@redhat.com> 1.2.2-13Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Elliot Lee <sopwith@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Than Ngo <than@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Jeff Johnson <jbj@redhat.com>Bill Nottingham <notting@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Prospector <bugzilla@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Bill Nottingham <notting@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nal�x�������������xd�������X�#gJj�����������6�����.�����������������6�6�?���@�=��M����	ܔ~=�c4654032ecbdffdd44c01bf4c79a4a40a6113e1b3d6A=3ld6A;,�	6�L�}������	
0�
 Hp���

�
(�8�9:>t@|B�F�G�H�IXYZ$[(\,]L^�b
d
�e
�f
�l
�t
�u
�v
�w@x`����
�����g�h�Ccpanel-php74-date-holidays-brazil0.1.21.cp11102PEAR: Driver based class to calculate holidays in BrazilDate_Holidays helps you calculate the dates and titles of holidays and
other special celebrations. This is the driver for calculating holidays in
Brazil.a�e\bh-centos-7.dev.cpanel.net-�PHP v3.01Development/Librarieshttp://pear.php.net/package/Date_Holidays_Brazillinuxnoarchecho /usr/local/cpanel/3rdparty/php/74/lib/pear/Date_Holidays_Brazil.xml >> /var/cpanel/.pending_pear_registrations# Only remove PEAR registry entry if this is a plain uninstall. For upgrades, leave it in place.
if [ x$1 = x0 ]; then echo pear.php.net/Date_Holidays_Brazil >> /var/cpanel/.pending_pear_deregistrations ; fi

#���A�A�A큤A�A큤H�fa�e\a�e\a�e\a�e\a�e\a�e\a�e\e70eec8b222b2d2d3978dd03ab17e0257e5c77aa86fdac63da7f84bd138659870917b83b355f3fa6974434f1a119f97f59d1b4d0e36b85b2e66c7bd1b230bf5ee3b0c44298fc1c149afbf4c8996fb92427ae41e4649b934ca495991b7852b855rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootcpanel-php74-date-holidays-brazil-0.1.2-1.cp11102.src.rpm��������������������������������cpanel-php74-date-holidays-brazil



/bin/sh/bin/shcpanel-php74cpanel-php74cpanel-php74cpanel-php74-date-holidaysrpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)3.0.4-14.6.0-14.0-15.2-14.11.1a��`OL@[D��Q�M�B. McMahon <b.mcmahon@cpanel.net> - 0.1.2-1.cp11102Nicolas Rochelemagne <nicolas.rochelemagne@cpanel.net> - 0.1.2-1.cp1198Julian Brown <julian.brown@cpanel.net> - 0.1.2-1.cp1176Nicolas Rochelemagne <nicolas.rochelemagne@cpanel.net> - 0.1.2-1.cp1142- Packaging for PHP v7.4- Rename package and add Ubuntu support- Updated to PHP 7.2.create first rpm version/bin/sh/bin/shcpanel-php73-date-holidays-brazil10-2-67-86.cprapid.com 16372489360.1.2-1.cp11102Date_Holidays_Brazil.xmlDateHolidaysDriverBrazil.phpdocscpanel-php74-date-holidays-brazil-0.1.2nodocs/usr/local/cpanel/3rdparty/php/74/lib/pear//usr/local/cpanel/3rdparty/php/74/lib/php//usr/local/cpanel/3rdparty/php/74/lib/php/Date//usr/local/cpanel/3rdparty/php/74/lib/php/Date/Holidays//usr/local/cpanel/3rdparty/php/74/lib/php/Date/Holidays/Driver//usr/share/doc//usr/share/doc/cpanel-php74-date-holidays-brazil-0.1.2/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches   -m64 -mtune=genericcpioxz2noarch-redhat-linux-gnuXML document textdirectoryC++ source, UTF-8 Unicode textempty?���x��������������S�������X6#NfJja) [��������(�	�c�����}�����������������c�c�c�-6Petr Oros <poros@redhat.com> - B.02.18-5Petr Oros <poros@redhat.com> - B.02.18-4Petr Oros <poros@redhat.com> - B.02.18-3Petr Oros <poros@redhat.com> - B.02.18-2Petr Oros <poros@redhat.com> - B.02.18-1Petr Oros <poros@redhat.com> - B.02.17-12Petr Oros <poros@redhat.com> - B.02.17-11Petr Oros <poros@redhat.com> - B.02.17-10Petr Oros <poros@redhat.com> - B.02.17-9Petr Oros <poros@redhat.com> - B.02.17-8Petr Oros <poros@redhat.com> - B.02.17-7Petr Oros <poros@redhat.com> - B.02.17-6Petr Oros <poros@redhat.com> - B.02.17-5Petr Oros <poros@redhat.com> - B.02.17-4Petr Oros <poros@redhat.com> - B.02.17-3Petr Oros <poros@redhat.com> - B.02.17-2Petr Oros <poros@redhat.com> - B.02.17-1- Fixes: f914f225975b ("report CPU family/model/stepping")- Report CPU family/model/stepping- Update help message and man page
- Do not show modified time with -notime option
- specfile: Fix version issue- Add a class 'nvme' for NVMe devices
- Fix lshw crashes with SEGV in privileged containers
- Display proper logical name of network device- Sync lshw package to the latest version
- Resolves: #1640692- Put back Add parsed firmware version info patch
- Resolves: #1536391- Add fixes for POWER9 support
- Resolves: #1537484- Fix Petitboot System Information output
- Fix compiler warnings
- Resolves: #1536391- Escape special characters in html output
- Resolves: #1446765- Proper detect vendor_id/device_id for virtual functions
- Sync SMBIOS with latest specification
- Resolves: #1445473- Revert Fix JSON output format
- Show right version number
- Resolves: #1447761- Fix JSON output format
- Resolves: #1205372- Re-enable sqlite support (for -dump)
- Resolves: #1446761- Fix tmp_device_id/tmp_vendor_id size
- Resolves: #1339378- Proper detect vendor_id/device_id for virtual functions
- Resolves: #1339378- Add missing doc files
- Resolves: #1368704- Rebase to lshw-B.02.18
- Sync with upstream git
- Apply patches from beaker-fork
- Resolves: #1368704- Revert: "better" handling of whole-disk volumes
- Resolves: #1358748- Resolves: #1360662- Add support for reporting virtio devices
- Resolves: #1360662- Add support for proper report cpuinfo on s390x arch
- Resolves: #1208276- Add pseries-guest information and PowerNV-firmware information
- Resolves: #1334603- Report the vendor_id field for x86 cpu's
- Resolves: #1215245- Use sysfs for DMI info when available
- Resolves: #1261570- Resolves: #1221933
- Remove Trailing newline in 0004-IBM-PowerNV.patch- Resolves: #1221933
- Fix malformed patch for PowerNV/bare-metal- Resolves: #1221933
- Add power specific patches to RHEL7.2 for PowerNV/bare-metal- Resolves: #1174195
- Don't look for SMBIOS structures on PowerPC and s390x systems- Resolves: #1101590
- Initial package.	
B.02.18-17.el7B.02.18-17.el7lshwlshw-B.02.18ChangelogIODC.txtREADME.mdTODOlshw.xsdproc_usb_info.txtlshw-B.02.18COPYINGlshw.1.gz/usr/sbin//usr/share/doc//usr/share/doc/lshw-B.02.18//usr/share/licenses//usr/share/licenses/lshw-B.02.18//usr/share/man/man1/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches   -m64 -mtune=genericcpioxz2x86_64-redhat-linux-gnuELF 64-bit LSB executable, x86-64, version 1 (SYSV), dynamically linked (uses shared libs), for GNU/Linux 2.6.32, BuildID[sha1]=a03d8162a22fa2c00ad2d54d9c043c2055ee6d2a, strippeddirectoryASCII textC source, ASCII textASCII text, with very long linesXML 1.0 document, ASCII textFORTRAN program, ASCII texttroff or preprocessor input, ASCII text, with very long lines (gzip compressed data, from Unix, max compression)RR
R
RRRRRRRR	RRR?����
4��x�������������hC�������X
#�fJj() (����5������]����������������5�|�<��bstdc++/59603, libstdc++/61947, libstdc++/63449,
	libstdc++/63840, libstdc++/65279, libstdc++/65543, lto/65015,
	lto/65193, middle-end/43631, middle-end/56917, middle-end/57748,
	middle-end/58624, middle-end/59990, middle-end/63608,
	middle-end/63665, middle-end/63704, middle-end/64067,
	middle-end/64111, middle-end/64199, middle-end/64225,
	middle-end/65409, middle-end/65680, middle-end/66133,
	middle-end/66251, pch/65550, preprocessor/60436,
	rtl-optimization/61058, rtl-optimization/63475,
	rtl-optimization/63483, rtl-optimization/63659,
	rtl-optimization/64037, rtl-optimization/64557, sanitizer/64265,
	target/49423, target/52941, target/53988, target/55351, target/56846,
	target/59593, target/60111, target/61413, target/62218, target/62642,
	target/63335, target/63428, target/63673, target/63947, target/64113,
	target/64115, target/64304, target/64358, target/64387, target/64409,
	target/64452, target/64453, target/64479, target/64513, target/64579,
	target/64580, target/64795, target/64882, target/64979, target/65138,
	target/65163, target/65196, target/65286, target/65368, target/65787,
	target/65849, target/66140, target/66148, target/66215, target/66275,
	target/66470, target/66474, tree-optimization/59124,
	tree-optimization/60656, tree-optimization/61634,
	tree-optimization/61686, tree-optimization/61969,
	tree-optimization/62031, tree-optimization/62167,
	tree-optimization/63375, tree-optimization/63379,
	tree-optimization/63551, tree-optimization/63593,
	tree-optimization/63605, tree-optimization/63841,
	tree-optimization/63844, tree-optimization/64269,
	tree-optimization/64277, tree-optimization/64493,
	tree-optimization/64495, tree-optimization/64563,
	tree-optimization/65063, tree-optimization/65388,
	tree-optimization/65518, tree-optimization/66123,
	tree-optimization/66233, tree-optimization/66251,
	tree-optimization/66272- enable Ada for ppc64le (#1162196)- fix PowerPC unaligned vectorization bug (#1146871,
  PR tree-optimization/63341)
- fix another -fcompare-debug issue (PR debug/63284)- update from the 4.8 branch
  - fix ppc32 libgo.so.4 to avoid RWE PT_GNU_STACK- update from the 4.8 branch (#1140019)
  - PRs c++/58714, c++/59823, c++/59956, c++/60241, c++/60361, c++/61959,
	c/61271, debug/55794, debug/60655, debug/61923, fortran/61999,
	fortran/62214, fortran/62270, ipa/61986, ipa/62015, libgfortran/62188,
	libstdc++/58962, libstdc++/61946, middle-end/61010, middle-end/61045,
	middle-end/62103, rtl-optimization/62004, rtl-optimization/62030,
	target/61996, target/62038, target/62195, testsuite/56194,
	tree-optimization/60196, tree-optimization/60707,
	tree-optimization/61452, tree-optimization/62073,
	tree-optimization/62075, tree-optimization/63189- backport aarch64 unwind info improvements (#1132636)- update from the 4.8 branch
  - PRs fortran/61780, libobjc/61920, target/47230, tree-optimization/61375,
	tree-optimization/61964
  - fix libgfortran overflows on allocation (CVE-2014-5044)
- backport ibm-ldouble performance improvements (#1090620)- on ppc64le use -mtune=power8 by default (#1123484)- update from the 4.8 branch
  - PRs c++/61500, c++/61539, c++/61647, fortran/58883, fortran/61459,
	middle-end/53590, rtl-optimization/61801, target/61542, target/61586,
	tree-optimization/61306, tree-optimization/61684
- for rhel 7.1 keep the old 4.8.2 pathnames and use 4.8.3 symlinks
- merge in aarch64 support (#1070290)
- small improvements on s390x for z196 and later (#1088542)
- make sure OpenMP outlined artificial functions have DW_AT_name (#844959)- update from the 4.8 branch
  - GCC 4.8.3 release
  - PRs c++/60605, c++/60731, c++/61134, fortran/45187, ipa/61393,
	libfortran/61187, libfortran/61310, libstdc++/60734, libstdc++/60966,
	rtl-optimization/60866, rtl-optimization/60901, rtl-optimization/61094,
	rtl-optimization/61446, target/61044, target/61193, target/61202,
	target/61208, target/61231, target/61239, target/61249, target/61300,
	target/61415, target/61423, target/61431, target/61443, target/61483,
	target/61545, target/61570, tree-optimization/61383- up�x��������������2�������X�#@gJj���bO�����
����������������bOcO6��of #540769)- make krb5-server-ldap also depend on the same version-release of krb5-libs,
  as the other subpackages do, if only to make it clearer than it is when we
  just do it through krb5-server
- drop explicit linking with libtinfo for applications that use libss, now
  that readline itself links with libtinfo (as of readline-5.2-3, since
  fedora 7 or so)
- go back to building without strict aliasing (compiler warnings in gssrpc)- add patch to correct GSSAPI library null pointer dereference which could be
  triggered by malformed client requests (CVE-2010-1321, #582466)- fix output of kprop's init script's "status" and "reload" commands (#588222)- incorporate patch to fix double-free in the KDC (CVE-2010-1320, #581922)- fix a typo in kerberos.ldif- update to 1.8.1
  - no longer need patches for #555875, #561174, #563431, RT#6661, CVE-2010-0628
- replace buildrequires on tetex-latex with one on texlive-latex, which is
  the package that provides it now- kdc.conf: no more need to suggest a v4 mode, or listening on the v4 port- drop patch to suppress key expiration warnings sent from the KDC in
  the last-req field, as the KDC is expected to just be configured to either
  send them or not as a particular key approaches expiration (#556495)- add upstream fix for denial-of-service in SPNEGO (CVE-2010-0628, #576325)
- kdc.conf: no more need to suggest keeping keys with v4-compatible salting- remove the krb5-appl bits (the -workstation-clients and -workstation-servers
  subpackages) now that krb5-appl is its own package
- replace our patch for #563431 (kpasswd doesn't fall back to guessing your
  principal name using your user name if you don't have a ccache) with the
  one upstream uses- add documentation for the ticket_lifetime option (#561174)- pull up patch to get the client libraries to correctly perform password
  changes over IPv6 (Sumit Bose, RT#6661)- update to 1.8
  - temporarily bundling the krb5-appl package (split upstream as of 1.8)
    until its package review is complete
  - profile.d scriptlets are now only needed by -workstation-clients
  - adjust paths in init scripts
  - drop upstreamed fix for KDC denial of service (CVE-2010-0283)
  - drop patch to check the user's password correctly using crypt(), which
    isn't a code path we hit when we're using PAM- fix a null pointer dereference and crash introduced in our PAM patch that
  would happen if ftpd was given the name of a user who wasn't known to the
  local system, limited to being triggerable by gssapi-authenticated clients by
  the default xinetd config (Olivier Fourdan, #569472)- fix a regression (not labeling a kdb database lock file correctly, #569902)- move the package changelog to the end to match the usual style (jdennis)
- scrub out references to $RPM_SOURCE_DIR (jdennis)
- include a symlink to the readme with the name LICENSE so that people can
  find it more easily (jdennis)- pull up the change to make kpasswd's behavior better match the docs
  when there's no ccache (#563431)- apply patch from upstream to fix KDC denial of service (CVE-2010-0283,- update to 1.7.1
  - don't trip AD lockout on wrong password (#542687, #554351)
  - incorporates fixes for CVE-2009-4212 and CVE-2009-3295
  - fixes gss_krb5_copy_ccache() when SPNEGO is used
- move sim_client/sim_server, gss-client/gss-server, uuclient/uuserver to
  the devel subpackage, better lining up with the expected krb5/krb5-appl
  split in 1.8
- drop kvno,kadmin,k5srvutil,ktutil from -workstation-servers, as it already
  depends on -workstation which also includes them- tighten up default permissions on kdc.conf and kadm5.acl (#558343)- use portreserve correctly -- portrelease takes the basename of the file
  whose entries should be released, so we need three files, not one- suppress warnings of impending password expiration if expiration is more than
  seven days away when the KDC reports it via the last-req field, just as we
  already do when it reports expiration via the key-expiration field (#556495)
- link with libtinfo rather than li�x�������������X"�������X�#0gJjrans��
���(����������������������(�Q��2-1Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 1.10.1-3Nalin Dahyabhai <nalin@redhat.com> 1.10.1-2Nalin Dahyabhai <nalin@redhat.com> 1.10.1-1Nalin Dahyabhai <nalin@redhat.com> 1.10-5Nathaniel McCallum <nathaniel@natemccallum.com> - 1.10-4Nathaniel McCallum <nathaniel@natemccallum.com> - 1.10-3Nalin Dahyabhai <nalin@redhat.com> 1.10-2Nalin Dahyabhai <nalin@redhat.com> 1.10-1Nathaniel McCallum <nathaniel@natemccallum.com> - 1.10-0.beta1.2Nalin Dahyabhai <nalin@redhat.com> 1.10-0.beta1.1Peter Robinson <pbrobinson@gmail.com>Nalin Dahyabhai <nalin@redhat.com> 1.10-0.alpha2.2Nalin Dahyabhai <nalin@redhat.com> 1.10-0.alpha2.1Nalin Dahyabhai <nalin@redhat.com> 1.10-0.alpha1.3Nalin Dahyabhai <nalin@redhat.com> 1.10-0.alpha1.2Nalin Dahyabhai <nalin@redhat.com> 1.10-0.alpha1.1Nalin Dahyabhai <nalin@redhat.com> 1.10-0.alpha1.0Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.9.1-19Nalin Dahyabhai <nalin@redhat.com> 1.9.1-18Nalin Dahyabhai <nalin@redhat.com> 1.9.1-17Nalin Dahyabhai <nalin@redhat.com> 1.9.1-16Tom Callaway <spot@fedoraproject.org> 1.9.1-15Tom Callaway <spot@fedoraproject.org> 1.9.1-14Tom Callaway <spot@fedoraproject.org> 1.9.1-13Nalin Dahyabhai <nalin@redhat.com> 1.9.1-12Nalin Dahyabhai <nalin@redhat.com> 1.9.1-11Nalin Dahyabhai <nalin@redhat.com> 1.9.1-10Nalin Dahyabhai <nalin@redhat.com> 1.9.1-9Nalin Dahyabhai <nalin@redhat.com> 1.9.1-8Nalin Dahyabhai <nalin@redhat.com> 1.9.1-7Nalin Dahyabhai <nalin@redhat.com> 1.9.1-6Nalin Dahyabhai <nalin@redhat.com> 1.9.1-5Nalin Dahyabhai <nalin@redhat.com> 1.9.1-4Nalin Dahyabhai <nalin@redhat.com> 1.9.1-3Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 1.9.1-2Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 1.9.1-1Nalin Dahyabhai <nalin@redhat.com> 1.9-9Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 1.9-8Nalin Dahyabhai <nalin@redhat.com> 1.9-7Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 1.9-6Nalin Dahyabhai <nalin@redhat.com> 1.9-5Nalin Dahyabhai <nalin@redhat.com> 1.9-4Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.9-3Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 1.9-2Nalin Dahyabhai <nalin@redhat.com> 1.9-1Nalin Dahyabhai <nalin@redhat.com> 1.9-0.beta3.1Nalin Dahyabhai <nalin@redhat.com> 1.9-0.beta3.0Nalin Dahyabhai <nalin@redhat.com> 1.9-0.beta2.0Nalin Dahyabhai <nalin@redhat.com> 1.9-0.beta1.1Nalin Dahyabhai <nalin@redhat.com> 1.9-0.beta1.0Nalin Dahyabhai <nalin@redhat.com> 1.8.3-8Nalin Dahyabhai <nalin@redhat.com> 1.8.3-7Nalin Dahyabhai <nalin@redhat.com> 1.8.3-6jkeating - 1.8.3-5Nalin Dahyabhai <nalin@redhat.com> 1.8.3-4Nalin Dahyabhai <nalin@redhat.com> 1.8.3-3Nalin Dahyabhai <nalin@redhat.com> 1.8.3-2Nalin Dahyabhai <nalin@redhat.com> 1.8.3-1Nalin Dahyabhai <nalin@redhat.com> 1.8.2-3Nalin Dahyabhai <nalin@redhat.com> 1.8.2-2Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 1.8.2-1Nalin Dahyabhai <nalin@redhat.com> 1.8.1-7Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 1.8.1-6Nalin Dahyabhai <nalin@redhat.com> 1.8.1-5Nalin Dahyabhai <nalin@redhat.com> 1.8.1-4Nalin Dahyabhai <nalin@redhat.com> 1.8.1-3Nalin Dahyabhai <nalin@redhat.com> 1.8.1-2Nalin Dahyabhai <nalin@redhat.com> 1.8.1-1Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> - 1.8-5Nalin Dahyabhai <nalin@redhat.com> - 1.8-4Nalin Dahyabhai <nalin@redhat.com> - 1.8-3Nalin Dahyabhai <nalin@redhat.com> - 1.8-2Nalin Dahyabhai <nalin@redhat.com> - 1.8-1Nalin Dahyabhai <nalin@redhat.com> - 1.7.1-6Nalin Dahyabhai <nalin@redhat.com> - 1.7.1-5Nalin Dahyabhai <nalin@redhat.com> - 1.7.1-4Nalin Dahyabhai <nalin@redhat.com> - 1.7.1-3Nalin Dahyabhai <nalin@redhat.com> - 1.7.1-2Nalin Dahyabhai <nalin@redhat.com> - 1.7.1-1Nalin Dahyabhai <nalin@redhat.com> - 1.�x���������������������Xy#AgJjx�8B6������^����������������6�bO7��bncurses, when we can, in future RHEL- krb5_get_init_creds_password: check opte->flags instead of options->flags
  when checking whether or not we get to use the prompter callback (#555875)- use portreserve to make sure the KDC can always bind to the kerberos-iv
  port, kpropd can always bind to the krb5_prop port, and that kadmind can
  always bind to the kerberos-adm port (#555279)
- correct inadvertent use of macros in the changelog (rpmlint)- add upstream patch for integer underflow during AES and RC4 decryption
  (CVE-2009-4212), via Tom Yu (#545015)- put the conditional back for the -devel subpackage
- back down to the earlier version of the patch for #551764; the backported
  alternate version was incomplete- use %global instead of %define
- pull up proposed patch for creating previously-not-there lock files for
  kdb databases when 'kdb5_util' is called to 'load' (#551764)- fix conditional for future RHEL- add upstream patch for KDC crash during referral processing (CVE-2009-3295),
  via Tom Yu (#545002)- refresh patch for #542868 from trunk- move man pages that live in the -libs subpackage into the regular
  %{_mandir} tree where they'll still be found if that package is the
  only one installed (#529319)- and put it back in- back that last change out- try to make gss_krb5_copy_ccache() work correctly for spnego (#542868)- make krb5-config suppress CFLAGS output when called with --libs (#544391)- ksu: move account management checks to before we drop privileges, like
  su does (#540769)
- selinux: set the user part of file creation contexts to match the current
  context instead of what we looked up
- configure with --enable-dns-for-realm instead of --enable-dns, which isn't
  recognized any more- move /etc/pam.d/ksu from krb5-workstation-servers to krb5-workstation,
  where it's actually needed (#538703)- add some conditional logic to simplify building on older Fedora releases- don't forget the README- specify the location of the subsystem lock when using the status() function
  in the kadmind and kpropd init scripts, so that we get the right error when
  we're dead but have a lock file - requires initscripts 8.99 (#521772)- if the init script fails to start krb5kdc/kadmind/kpropd because it's already
  running (according to status()), return 0 (part of #521772)- work around a compile problem with new openssl- rebuilt with new openssl- Rebuilt for https://fedoraproject.org/wiki/Fedora_12_Mass_Rebuild- rebuild to pick up the current forms of various patches- simplify the man pages patch by only preprocessing the files we care about
  and moving shared configure.in logic into a shared function
- catch the case of ftpd printing file sizes using %i, when they might be
  bigger than an int now- try to merge and clean up all the large file support for ftp and rcp
  - ftpd no longer prints a negative length when sending a large file
    from a 32-bit host- pam_rhosts_auth.so's been gone, use pam_rhosts.so instead- switch buildrequires: and requires: on e2fsprogs-devel into
  buildrequires: and requires: on libss-devel, libcom_err-devel, per
  sandeen on fedora-devel-list- fix a type mismatch in krb5_copy_error_message()
- ftp: fix some odd use of strlen()
- selinux labeling: use selabel_open() family of functions rather than
  matchpathcon(), bail on it if attempting to get the mutex lock fails- compile with %{?_smp_mflags} (Steve Grubb)
- drop the bit where we munge part of the error table header, as it's not
  needed any more- add and own %{_libdir}/krb5/plugins/authdata- update to 1.7
  - no need to work around build issues with ASN1BUF_OMIT_INLINE_FUNCS
  - configure recognizes --enable/--disable-pkinit now
  - configure can take --disable-rpath now
  - no more libdes425, krb524d, krb425.info
  - kadmin/k5srvutil/ktutil are user commands now
  - new kproplog
  - FAST encrypted-challenge plugin is new
- drop static build logic
- drop pam_krb5-specific configuration from the default krb5.conf
- drop only-use-v5 flags being passed to various things started by xi�x�������������H�������X�#.gJj���������������ٛ�����1����������������ٛ�y�Q�od <rharwood@redhat.com> - 1.15.1-8Robbie Harwood <rharwood@redhat.com> - 1.15.1-7Robbie Harwood <rharwood@redhat.com> - 1.15.1-6Robbie Harwood <rharwood@redhat.com> - 1.15.1-5Robbie Harwood <rharwood@redhat.com> - 1.15.1-4Robbie Harwood <rharwood@redhat.com> - 1.15.1-3Robbie Harwood <rharwood@redhat.com> - 1.15.1-2Robbie Harwood <rharwood@redhat.com> - 1.15.1-1Robbie Harwood <rharwood@redhat.com> - 1.15-2Robbie Harwood <rharwood@redhat.com> - 1.15-1Robbie Harwood <rharwood@redhat.com> - 1.14.1-27Robbie Harwood <rharwood@redhat.com> - 1.14.1-26Robbie Harwood <rharwood@redhat.com> - 1.14.1-25Robbie Harwood <rharwood@redhat.com> - 1.14.1-24Robbie Harwood <rharwood@redhat.com> - 1.14.1-23Robbie Harwood <rharwood@redhat.com> - 1.14.1-22Robbie Harwood <rharwood@redhat.com> - 1.14.1-21Robbie Harwood <rharwood@redhat.com> - 1.14.1-20Robbie Harwood <rharwood@redhat.com> - 1.14.1-19Robbie Harwood <rharwood@redhat.com> - 1.14.1-18Robbie Harwood <rharwood@redhat.com> - 1.14.1-17Robbie Harwood <rharwood@redhat.com> - 1.14.1-16Robbie Harwood <rharwood@redhat.com> - 1.14.1-15Robbie Harwood <rharwood@redhat.com> - 1.14.1-14Robbie Harwood <rharwood@redhat.com> - 1.14.1-13Robbie Harwood <rharwood@redhat.com> - 1.14.1-12Robbie Harwood <rharwood@redhat.com> - 1.14.1-11Robbie Harwood <rharwood@redhat.com> - 1.14.1-10Robbie Harwood <rharwood@redhat.com> - 1.14.1-9Robbie Harwood <rharwood@redhat.com> - 1.14.1-8Robbie Harwood <rharwood@redhat.com> - 1.14.1-7Robbie Harwood <rharwood@redhat.com> - 1.14.1-6Robbie Harwood <rharwood@redhat.com> - 1.14.1-5Robbie Harwood <rharwood@redhat.com> - 1.14.1-4Robbie Harwood <rharwood@redhat.com> - 1.14.1-3Robbie Harwood <rharwood@redhat.com> - 1.14.1-2Robbie Harwood <rharwood@redhat.com> - 1.14.1-1Robbie Harwood <rharwood@redhat.com> - 1.13.2-12Robbie Harwood <rharwood@redhat.com> - 1.13.2-11Robbie Harwood <rharwood@redhat.com> 1.13.2-9Roland Mainz <rmainz@redhat.com> - 1.13.2-9Roland Mainz <rmainz@redhat.com> - 1.13.2-8Roland Mainz <rmainz@redhat.com> - 1.13.2-7Roland Mainz <rmainz@redhat.com> - 1.13.2-6Roland Mainz <rmainz@redhat.com> - 1.13.2-5Roland Mainz <rmainz@redhat.com> - 1.13.2-4Roland Mainz <rmainz@redhat.com> - 1.13.2-3Roland Mainz <rmainz@redhat.com> - 1.13.2-2Roland Mainz <rmainz@redhat.com> - 1.13.2-1Roland Mainz <rmainz@redhat.com> - 1.13.2-0Roland Mainz <rmainz@redhat.com> - 1.13.1-2Roland Mainz <rmainz@redhat.com> - 1.13.1-1Roland Mainz <rmainz@redhat.com> - 1.13.1-0Roland Mainz <rmainz@redhat.com> - 1.12.2-14Roland Mainz <rmainz@redhat.com> - 1.12.2-13Roland Mainz <rmainz@redhat.com> - 1.12.2-12Roland Mainz <rmainz@redhat.com> - 1.12.2-11Roland Mainz <rmainz@redhat.com> - 1.12.2-10Roland Mainz <rmainz@redhat.com> - 1.12.2-9Nalin Dahyabhai <nalin@redhat.com> - 1.12.2-8Nalin Dahyabhai <nalin@redhat.com> - 1.12.2-7Nalin Dahyabhai <nalin@redhat.com> - 1.12.2-6Nalin Dahyabhai <nalin@redhat.com> - 1.12.2-5Nalin Dahyabhai <nalin@redhat.com> - 1.12.2-4Nalin Dahyabhai <nalin@redhat.com> - 1.12.2-3Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.12.1-15Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.12.2-2Nalin Dahyabhai <nalin@redhat.com> - 1.12.2-1Nalin Dahyabhai <nalin@redhat.com> - 1.12.1-14Nalin Dahyabhai <nalin@redhat.com> - 1.12.1-13Nalin Dahyabhai <nalin@redhat.com> - 1.12.1-12Tom Callaway <spot@fedoraproject.org> - 1.12.1-11Nalin Dahyabhai <nalin@redhat.com> - 1.12.1-10Nalin Dahyabhai <nalin@redhat.com> - 1.12.1-9Nalin Dahyabhai <nalin@redhat.com> - 1.12.1-8Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.12.1-7Nathaniel McCallum <npmccallum@redhat.com> - 1.12.1-6Nalin Dahyabhai <nalin@redhat.com> - 1.12.1-5Nalin Dahyabhai <nalin@redhat.com> - 1.12.1-4Nalin Dahyabhai <nalin@redhat.com> - 1.12.1-3Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> - 1.12.1-2Nalin Dahyabhai <nalin@redhat.com> - 1.12.1-1Nalin Dahyabhai <nalin@redhat.com> - 1.12-11Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> - 1.�x�������������������X2#�fJjZick���Y������<������T����������������<�5����date from the 4.8 branch
  - PRs c++/60367, c++/60628, c++/60689, c++/60708, c++/60713, debug/60603,
	driver/61106, libfortran/56919, libfortran/60810, libstdc++/60497,
	libstdc++/60594, libstdc++/61117, middle-end/36282, middle-end/55022,
	middle-end/60635, middle-end/60729, middle-end/60750,
	middle-end/60849, middle-end/60895, rtl-optimization/60769,
	target/57589, target/58595, target/59952, target/60516, target/60609,
	target/60672, target/60693, target/60839, target/60909, target/60941,
	target/60991, target/61026, target/61055, tree-optimization/57864,
	tree-optimization/59817, tree-optimization/60453,
	tree-optimization/60502, tree-optimization/60740,
	tree-optimization/60766, tree-optimization/60836,
	tree-optimization/60903, tree-optimization/60930,
	tree-optimization/60960
- backport OpenMP 4.0 support to libgomp (library only; PR libgomp/58691)- update from the 4.8 branch
  - PRs ada/51483, ada/60703, c/37743, c/59891, c/60101, c++/37140, c++/41174,
	c++/54652, c++/55800, c++/57043, c++/57524, c++/57899, c++/58466,
	c++/58504, c++/58606, c++/58632, c++/58639, c++/58672, c++/58812,
	c++/58814, c++/58835, c++/58837, c++/58845, c++/58873, c++/58965,
	c++/59097, c++/59224, c++/59646, c++/59989, c++/60108, c++/60146,
	c++/60182, c++/60187, c++/60216, c++/60219, c++/60248, debug/59776,
	fortran/49397, fortran/52370, fortran/55907, fortran/57033,
	fortran/58007, fortran/58803, fortran/59395, fortran/59414,
	fortran/59599, fortran/59700, fortran/59906, fortran/60231,
	fortran/60283, fortran/60341, fortran/60450, fortran/60522,
	fortran/60543, fortran/60576, fortran/60677, ipa/55260, ipa/60026,
	ipa/60419, ipa/60640, libfortran/38199, libfortran/58324,
	libfortran/59700, libfortran/59764, libfortran/59771,
	libfortran/59774, libfortran/59836, libfortran/60128, libgcc/60166,
	libgcj/55637, libstdc++/59215, libstdc++/59392, libstdc++/59548,
	libstdc++/59680, libstdc++/59738, libstdc++/60564, libstdc++/60658,
	middle-end/57499, middle-end/58809, middle-end/60004,
	middle-end/60221, middle-end/60291, objc/56870, other/56653,
	preprocessor/56824, preprocessor/58844, preprocessor/60400,
	rtl-optimization/56356, rtl-optimization/57422,
	rtl-optimization/57425, rtl-optimization/57569,
	rtl-optimization/57637, rtl-optimization/60116,
	rtl-optimization/60452, rtl-optimization/60601,
	rtl-optimization/60700, target/43546, target/48094, target/54083,
	target/54407, target/55426, target/56843, target/57052, target/57935,
	target/57949, target/58675, target/58710, target/59054, target/59379,
	target/59396, target/59462, target/59718, target/59777, target/59844,
	target/59880, target/59909, target/59929, target/60017, target/60032,
	target/60039, target/60062, target/60151, target/60193, target/60203,
	target/60207, target/60486, target/60568, target/60735,
	tree-optimization/56490, tree-optimization/59903,
	tree-optimization/60115, tree-optimization/60183,
	tree-optimization/60276, tree-optimization/60382,
	tree-optimization/60429, tree-optimization/60454,
	tree-optimization/60485
  - powerpc64 little endian support
- enable ppc64le in the spec file- fix up compare_exchange_* in libatomic too (PR c++/60272)- fix exception spec instantiation ICE (#1067398, PR c++/60046)
- fix pch on aarch64 (#1058991, PR pch/60010)
- configure with --enable-gnu-indirect-function on architectures
  and distros that support it and don't support it by default
  yet (#1067245)
- fix vector permutation handling on i?86/x86_64 (PR target/57896)
- fix __atomic_compare_exchange_* not to store into *expected
  on success (PR c++/60272)
- fix -march=native on VMs where saving/restoring of YMM state
  is not supported, yet CPU supports f16c (PR driver/60233)
- add ref7.C testcase (PR c++/60274)- remove libgo P.224 elliptic curve (#1066539)
- fix -mcpu=power8 ICE (#1064242, PR target/60137)- when removing -Wall from CXXFLAGS, if -Werror=format-security
  is present, add -Wformat to it, so that GCC builds on F21- update from the 4.8 branch (#1052892)
  - PRs c++/59838, debug/54694, fortran/34547, fortran/58410,
	middle-end/59827, �x�������������8������X�#�gJjceph@W�������!9J�����Q����������������9JAJ:J�- EA-11039: Ensure php.ini is marked as a config file on debian based systems- EA-11020: Update ea-php80 from v8.0.24 to v8.0.25
- GD: OOB read due to insufficient input validation in imageloadfont(). (CVE-2022-31630)
- Hash: buffer overflow in hash_update() on long parameter. (CVE-2022-37454)- EA-10961: Update ea-php80 from v8.0.23 to v8.0.24- ZC-10009: Add changes so that it builds on AlmaLinux 9- ZC-10260: Link deb against libcurl 4 explicitly- EA-10915: Update ea-php80 from v8.0.22 to v8.0.23- EA-10864: Update ea-php80 from v8.0.21 to v8.0.22- EA-10820: Update ea-php80 from v8.0.20 to v8.0.21- EA-10760: Update ea-php80 from v8.0.19 to v8.0.20- EA-10703: Update ea-php80 from v8.0.18 to v8.0.19- EA-10636: Update ea-php80 from v8.0.17 to v8.0.18- EA-10575: Update ea-php80 from v8.0.16 to v8.0.17- EA-10532: Update litespeed to 8.0.1- EA-10505: Update ea-php80 from v8.0.15 to v8.0.16- EA-10447: Update ea-php80 from v8.0.14 to v8.0.15- ZC-9599: Fix Ubuntu 21 global regs problem- ZC-9589: Update DISABLE_BUILD to match OBS- ZC-9611: Dependency issue with php-enchant on Ubuntu- ZC-7456: Add support for php-sodium- EA-10365: Update ea-php80 from v8.0.13 to v8.0.14- EA-10284: Update ea-php80 from v8.0.12 to v8.0.13- ZC-9470: Remove gmp extension from common’s built-in Provides list- EA-10225: Update ea-php80 from v8.0.11 to v8.0.12- EA-10044: Patch PHP-FPM/OpCache for kill_all_lockers bug (74709)- ZC-9370: Correct ea-php80 build issues- EA-10137: Disable upstream regression tests in favor of our own.- EA-10130: Update ea-php80 from v8.0.10 to v8.0.11- EA-10080: Update ea-php80 from v8.0.9 to v8.0.10- EA-10010: Update ea-php80 from v8.0.8 to v8.0.9- ZC-9089, ZC-9070: correction in opcache.ini- EA-9930: Update ea-php80 from v8.0.7 to v8.0.8- EA-9013: Optimize %check section- EA-9832: Update ea-php80 from v8.0.6 to v8.0.7- EA-9762: Update ea-php80 from v8.0.5 to v8.0.6- EA-9732: Update ea-php80 from v8.0.3 to v8.0.5- EA-9625: Update litespeed to 7.9- EA-9623: Update ea-php80 from v8.0.2 to v8.0.3- EA-9574: Update ea-php80 from v8.0.1 to v8.0.2- EA-9519: Update ea-php80 from v8.0.0 to v8.0.1- ZC-7880: Move PHP 8.0 to production- EA-9443: Update ea-php80 from v8.0.0rc4 to v8.0.0- ZC-8005: Replace ea-openssl11 with system openssl on C8- ZC-7865: Update to litespeed SAPI to 7.8- ZC-7985: remove libcurl updates for release- ZC-7969: Update description of non-DSO ea-php80-php to be more helpful- ZC-7961: Update to RC4- ZC-7862: Updates now that ea-libcurl builds on C8- EA-9390: Fix build with latest ea-brotli (v1.0.9)- ZC-7254: Get DSO to buid- ZC-7310: Update to RC3- ZC-7497: Reinstate `runselftest`- ZC-7523: Update to beta 4- ZC-7369: Remove DSO from rpm- ZC-6260: Initial alpha build of php8hou-1 17768082208.0.30-10.17.6.cpanel8.0.30-10.17.6.cpanel20-curl.inicurl.so/opt/cpanel/ea-php80/root/etc/php.d//opt/cpanel/ea-php80/root/usr/lib64/php/modules/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1  -m64 -mtune=genericobs://private/EA4-production/CentOS_7/9258ccb1490a78153e2adaac5f6010a8-ea-php80cpioxz2x86_64-redhat-linux-gnu�� �r���ʓ�[X@?�������i��\#x��~�|#n��.V��Z������f�d��D807����3��Ub���U0+�l�rӱ�5��9-*S�a%�:��G‚�k�H� �M���d�8^a�9���H��r�i,�{Yxo�Y)V474V��RƑle	X�¬"��az�|&u�$�B�Ij�<�gs\�Haz�0�Y�abS��HO��&ݤ��m.E���Bu(��U���#�GA;�_.�HH�Kw*��
f�R��V��IF��0>��(�~m��t-_O��<�o���!"j�X���]�֢tH'��|ƅ�'C���X�\[�`���ܧ{���y�c)"l��Za>��������?�Kx�BzB&��� *�(�5G4���ٻ��Av��~܏����B�B�:ɯy'ν��!Z�]C��o���bL� ��O���Lb?�+�/����f���G�5O��LNX��/���t�o��xA>�o�I�E�]So�m�"�s�ѝ�����woG�ծ��v��+zntv���w�9��i��\#x��~�|�a�X�Z�M^�����.,��Ɨ;ފ8?7Rdq5Mt�a<��;�)7�����cyIߣ|��M4볝G3�g{�
(��I��������>!�8���:��x�EV�O�쏳��1Roa��;lЦ7��E/��32��
H�X84�G�x���������������������X#SgJj: Mo�������%������������^�������������������G�?(d����	�	]������#�b�	��������				
$	H	�	
�		A	n�	��4�(89�:>M@\BkGx	H�	I�	X�Y�Z�[�\	](	^�b$d�e�f�l�t�	u	v(w�	x�	y��$8<Td
|���	�g�h�Cgraphite21.3.101.el7_3Font rendering capabilities for complex non-Roman writing systemsGraphite2 is a project within SIL’s Non-Roman Script Initiative and Language
Software Development groups to provide rendering capabilities for complex
non-Roman writing systems. Graphite can be used to create “smart fonts” capable
of displaying writing systems with various complex behaviors. With respect to
the Text Encoding Model, Graphite handles the "Rendering" aspect of writing
system implementation.Yq�!c1bm.rdu2.centos.org�TCentOS(LGPLv2+ or GPLv2+ or MPL) and (Netscape or GPLv2+ or LGPLv2+)CentOS BuildSystem <http://bugs.centos.org>Development/Toolshttps://sourceforge.net/projects/silgraphite/linuxx86_64^���& I"�g�����A큤��A큤��Yq�Yq�Yq�Yq�!Y��Y��Yq�!Y��Y��879b6eed656887a81a0fd109e997471daa99450b9c6ac29e93df0f79fe698af83fca41c8f82571bc214b1f14750cdd775a438fd1f3c77bc261f600a021c6047c2f5b5f05a5cec63ac41a035d312515f72d41836a0a6bbac62da1e68358deeebb2a7c5983531aa235a9f0d00fedead5c566e264356c78da2222ab9e6d943c3cfd4f5c886a12386def2e6e9cc45de3133299d57a1dc9ae61633b0758f6fe092134a9bdde5616ecdd1e980b44f360600ee8783b1f99b8cc83a2beb163a0a390e861libgraphite2.so.3.0.1��rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootgraphite2-1.3.10-1.el7_3.src.rpm������������������������������������graphite2graphite2(x86-64)libgraphite2.so.3()(64bit)@@@@@@@@@@@


@
/sbin/ldconfig/sbin/ldconfiglibc.so.6()(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libgcc_s.so.1()(64bit)libgcc_s.so.1(GCC_3.0)(64bit)libgraphite2.so.3()(64bit)libm.so.6()(64bit)libstdc++.so.6()(64bit)libstdc++.so.6(CXXABI_1.3)(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rtld(GNU_HASH)rpmlib(PayloadIsXz)3.0.4-14.6.0-14.0-15.2-14.11.3V�2�V�2�V�`�V��U�a@T�s@S�G�S���S=M@R���Q��Q�4�Q��@Q�?@Q��Q��Q��P��@Pl(�P��Oz�@OKp@O2c�O�N|t�NW��NW��NNP@NK�@NBr�Caolán McNamara <caolanm@redhat.com> - 1.3.10-1Caolán McNamara <caolanm@redhat.com> - 1.3.6-1Caolán McNamara <caolanm@redhat.com> - 1.3.5-1Fedora Release Engineering <releng@fedoraproject.org> - 1.2.4-6Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.2.4-5Till Maas <opensource@till.name> - 1.2.4-4Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.2.4-3Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.2.4-2Nicholas van Oudtshoorn <vanoudt@gmail.com> - 1.2.4-1Ville Skyttä <ville.skytta@iki.fi> - 1.2.2-5Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.2.2-4Caolán McNamara <caolanm@redhat.com> - 1.2.2-3Karsten Hopp <karsten@redhat.com> 1.2.2-2Nich�x�������������(��������X%#�gJj��O������=�����w�����������������=�=�=� settings after reload
- Removed conntrack --ctstate INVALID check from default ruleset, because it
  results in ICMP problems (RHBZ#806017).
- Update interfaces in default zone after reload (rhbz#804814)
- New man pages for firewalld(1), firewalld.conf(5), firewalld.icmptype(5),
  firewalld.service(5) and firewalld.zone(5), updated firewall-cmd man page
  (RHBZ#811257)
- Fixed firewall-cmd help output
- Fixed missing icon for firewall-applet (RHBZ#808759)
- Added root user check for firewalld (RHBZ#767654)
- Fixed requirements of firewall-applet sub package (RHBZ#808746)
- Update interfaces in default zone after changing of default zone (RHBZ#804814)
- Start firewalld before NetworkManager (RHBZ#811240)
- Add Type=dbus and BusName to service file (RHBZ#811240)- fixed firewalld.conf save exception if no temporary file can be written to 
  /etc/firewalld/- firewall-cmd: several changes and fixes
- code cleanup
- fixed icmp protocol used for ipv6 (rhbz#801182)
- added and fixed some comments
- properly restore zone settings, timeout is always set, check for 0
- some FirewallError exceptions were actually not raised
- do not REJECT in each zone
- removeInterface() don't require zone
- new tests in firewall-test script
- dbus_to_python() was ignoring certain values
- added functions for the direct interface: chains, rules, passthrough
- fixed inconsistent data after reload
- some fixes for the direct interface: priority positions are bound to ipv,
  table and chain
- added support for direct interface in firewall-cmd:
- added isImmutable(zone) to zone D-Bus interface
- renamed policy file
- enhancements for error messages, enables output for direct.passthrough
- added allow_any to firewald policies, using at leas auth_admin for policies
- replaced ENABLE_FAILED, DISABLE_FAILED, ADD_FAILED and REMOVE_FAILED by
  COMMAND_FAILED, resorted error codes
- new firewalld configuration setting CleanupOnExit
- enabled polkit again, found a fix for property problem with slip.dbus.service
- added dhcpv6-client to 'public' (the default) and to 'internal' zones.
- fixed missing settings form zone config files in
  "firewall-cmd --list=all --zone=<zone>" call
- added list functions for services and icmptypes, added --list=services and
  --list=icmptypes to firewall-cmd- enabled dhcpv6-client service for zones home and work
- new dhcpv6-client service
- firewall-cmd: query mode returns reversed values
- new zone.changeZone(zone, interface)
- moved zones, services and icmptypes to /usr/lib/firewalld, can be overloaded
  by files in /etc/firewalld (no overload of immutable zones block, drop,
  trusted)
- reset MinimalMark in firewalld.cnf to default value
- fixed service destination (addresses not used)
- fix xmlplus to be compatible with the python xml sax parser and python 3
  by adding __contains__ to xml.sax.xmlreader.AttributesImpl
- use icon and glib related post, postun and posttrans scriptes for firewall
- firewall-cmd: fix typo in state
- firewall-cmd: fix usage()
- firewall-cmd: fix interface action description in usage()
- client.py: fix definition of queryInterface()
- client.py: fix typo in getInterfaces()
- firewalld.service: do not fork
- firewall-cmd: fix bug in --list=port and --port action help message
- firewall-cmd: fix bug in --list=service- moved zones, services and icmptypes to /usr/lib/firewalld, can be overloaded
  by files in /etc/firewalld (no overload of immutable zones block, drop,
  trusted)- added missing firewall.dbus_utils- added glib2-devel to build requires, needed for gsettings.m4
- added --with-system-unitdir arg to fix installaiton of system file
- added glib-compile-schemas calls for postun and posttrans
- added EXTRA_DIST file lists- version 0.2.0 with new FirewallD1 D-BUS interface
- supports zones with a default zone
- new direct interface as a replacement of the partial virt interface with 
  additional passthrough functionality
- dropped custom rules, use direct interface instead
- dropped trusted interface funcionality, use trusted zone instead
- using zone, service�x������|���������X&#�eJj�������� ������=y�����U����������������=y�ʏ�t.pylve_utils_install.pymyimunify.pyping.pysend_domain_list.pysend_server_config.pywordpress.pyrouter.pyrpc_tools__init__.py__pycache____init__.cpython-311.opt-1.pyc__init__.cpython-311.pycexceptions.cpython-311.opt-1.pycexceptions.cpython-311.pyclookup.cpython-311.opt-1.pyclookup.cpython-311.pycmiddleware.cpython-311.opt-1.pycmiddleware.cpython-311.pycutils.cpython-311.opt-1.pycutils.cpython-311.pycvalidate.cpython-311.opt-1.pycvalidate.cpython-311.pycexceptions.pylookup.pymiddleware.pyutils.pyvalidate.pyrun.pysentry.pysimple_rpc__init__.py__pycache____init__.cpython-311.opt-1.pyc__init__.cpython-311.pycadvisor.cpython-311.opt-1.pycadvisor.cpython-311.pycanalyst_cleanup.cpython-311.opt-1.pycanalyst_cleanup.cpython-311.pycendpoints.cpython-311.opt-1.pycendpoints.cpython-311.pychooks.cpython-311.opt-1.pychooks.cpython-311.pychosting_panel.cpython-311.opt-1.pychosting_panel.cpython-311.pycmyimunify.cpython-311.opt-1.pycmyimunify.cpython-311.pycpermissions.cpython-311.opt-1.pycpermissions.cpython-311.pycplesk_stats.cpython-311.opt-1.pycplesk_stats.cpython-311.pycreputation_management.cpython-311.opt-1.pycreputation_management.cpython-311.pycschema.cpython-311.opt-1.pycschema.cpython-311.pycwordpress_security_plugin.cpython-311.opt-1.pycwordpress_security_plugin.cpython-311.pycwp_disabled_rules.cpython-311.opt-1.pycwp_disabled_rules.cpython-311.pycadvisor.pyanalyst_cleanup.pyendpoints.pyhooks.pyhosting_panel.pymyimunify.pypermissions.pyplesk_stats.pyreputation_management.pyschemaschema.pyadvisor.pickleadvisor.yamlanalyst-cleanup.pickleanalyst-cleanup.yamlauth-cloud.pickleauth-cloud.yamlbilling.picklebilling.yamlcheckdb.picklecheckdb.yamlconfig.pickleconfig.yamlconflicts.pickleconflicts.yamldoctor.pickledoctor.yamleula.pickleeula.yamlfiles.picklefiles.yamlget-news.pickleget-news.yamlgoogle-safe-engine.picklegoogle-safe-engine.yamlhook.picklehook.yamlhooks.picklehooks.yamlhosting-panel.picklehosting-panel.yamllogin.picklelogin.yamlpackage-versions.picklepackage-versions.yamlpermissions.picklepermissions.yamlplesk-stats.pickleplesk-stats.yamlregistration.pickleregistration.yamlsupport.picklesupport.yamlversion.pickleversion.yamlwordpress.picklewordpress.yamlwp-disabled-rules.picklewp-disabled-rules.yamlschema_responsesAnalystCleanupAllowedResponse.jsonAnalystCleanupGetRequestsResponse.jsonAnalystCleanupRequestResponse.jsonConfigAgentResponse.jsonFeaturesManagementDefaultsAgentResponse.jsonFeaturesManagementEditAgentResponse.jsonFeaturesManagementGetAgentResponse.jsonFeaturesManagementListAgentResponse.jsonFeaturesManagementNativeStatusAgentResponse.jsonFeaturesManagementShowAgentResponse.jsonGetNewsAgentResponse.jsonGetPackageVersionsAgentResponse.jsonNoItemsAndEulaAgentResponse.jsonNotificationConfigAgentResponse.jsonNullAgentResponse.jsonREADME.mdReputationAgentResponse.jsonTokenAgentResponse.jsonWhmcsUpdateResponse.jsonWordpressDomainsResponse.jsonWordpressIncidentsListAgentResponse.jsonwordpress_security_plugin.pywp_disabled_rules.pysubsys__init__.py__pycache____init__.cpython-311.opt-1.pyc__init__.cpython-311.pycbackup_systems.cpython-311.opt-1.pycbackup_systems.cpython-311.pycclcagefs.cpython-311.opt-1.pycclcagefs.cpython-311.pycnotifier.cpython-311.opt-1.pycnotifier.cpython-311.pycpersistent_state.cpython-311.opt-1.pycpersistent_state.cpython-311.pycsvcctl.cpython-311.opt-1.pycsvcctl.cpython-311.pycsysctl.cpython-311.opt-1.pycsysctl.cpython-311.pycsystemd_notifier.cpython-311.opt-1.pycsystemd_notifier.cpython-311.pycweb_server.cpython-311.opt-1.pycweb_server.cpython-311.pycbackup_systems.pyclcagefs.pyfeatures__init__.py__pycache____init__.cpython-311.opt-1.pyc__init__.cpython-311.pycabstract_feature.cpython-311.opt-1.pycabstract_feature.cpython-311.pyckernel_care.cpython-311.opt-1.pyckernel_care.cpython-311.pycabstract_feature.pykernel_care.pynotifier.pypanels__init__.py__pycache____init__.cpython-311.opt-1.pyc__init_�x���������������������X�#5gJjd bl`SP��������[������������������	O�J�31198- Add krb5 policy plugin interface
- Remove soname downgrade
- Resolves: #1462982- Make t_certauth.py runnable
- Resolves: #1443388- Add context SSF query support
- Resolves: #1472956- Remove incomplete PKINIT OCSP support
- Resolves: #1460089- Add kprop.service argument file
- Resolves: #1389073- Fix enterprise principal forwarding
- Resolves: #1378440- Fix bug in certauth backport
- Resolves: #1428484- rubygem-rkerberos still needs us to lie about soname
- Resolves: #1389073- Backport certauth plugin and related pkinit changes
- Note: related changes cannot be tested because RHEL does not allow
  binary git diffs
- Resolves: #1428484- Remove duplication between subpackages
- Resolves: #1254640- Add back deleted sources
- Resolves: #1389073- Bump to krb5-1.15.1 (very small change)
- Apply some sanity to our patches and ordering
- Resolves: #1389073- Reinstate e_data free method; bumps KDB to 6.1
- Resolves: #1389073- Rebase to 1.15-final
- Resolves: #1389073
- Resolves: #1367169
- Resolves: #1389072
- Resolves: #1366863- Properly handle EOF on libkrad sockets
- Resolves: #1382449- Use responder in non-preauth AS reqs
- Resolves: #1363690- Fix bad debug_log() call in selinux handling
- Resolves: #1292153- Fix KKDCPP with TLS SNI by always presenting "Host:" header
- Resolves: #1364993- Add dependency on libkadm5 to krb5-devel
- Resolves: #1347403- Builders have new version of mock; adapt.
- Resolves: #1290239- Fix CVE-2016-3120
- Resolves: #1361504- Make version dependencies on libkadm5 more explicit to appease rpmdiff
- Resolves: #1347403- Add in upstream version of kprop port and tests
- Resolves: #1292795- Fix incorrect recv() size calculation in libkrad
- Resolves: #1349042- Separate out the kadm5 libs
- Resolves: #1347403- Fix kprop/iprop handling of default realm
- Fix t_kprop.py
- Resolves: #1290561
- Resolves: #1302967
- Resolves: #1292795- Fix SPNEGO with NTLM to conform to MS-SPNG section 3.3.5.1
- Resolves: #1341726- Do not indicate depricated mechanisms when requested
- Resolves: #1293908- Fix OTP module incorrectly overwriting as_key
- Resolves: #1340304- Fix CVE-2016-3119 (LDAP NULL dereference)
- Resolves: #1339562- Make ksu not ask for password without -n
- Resolves: #1247261- Frob kadm5 soname version so that the rebase does not break things
- Resolves: #1292153- Revamp selinux patch to not leak memory
- Resolves: #1313457- Add snippet support in /etc/krb5.conf.d
- Resolves: #1146945- Skip unnecessary mech calls in gss_inquire_cred
- Resolves: #1314493- Fix impersonate_name to work with interposers
- Resolves: #1284987- Fix change tracking of krb5.conf
- Resolves: #1208243- Ensure log files are not world-readable
- Resolves: #1256735- Clean up initscript handling in spec file
- Resolves: #1283902
- Resolves: #1183058- Backport spec file changes from Fedora
- Resolves: #1290239- Rebase to new upstream version 1.14.1
- Remove pax logic
- Resolves: #1292153
- Resolves: #1135427
- Resolves: #1265509
- Resolves: #1265510
- Resolves: #1296241- Remove obsolete trigger to enable building of package
- Resolves: #1306970- Fix CVE-2015-8631, CVE-2015-8630, and CVE-2015-8629
- Resolves: #1306970- Add patch and test case for "KDC does not return proper
  client principal for client referrals"
- Resolves: #1259846- Ammend patch for RedHat bug #1252454 ('testsuite complains
  "Lifetime has increased by 32436 sec while 0 sec passed!",
  while rhel5-libkrb5 passes') to handle the newly introduced
  valgrind hits.- Add a patch to fix RH Bug #1250154 ("[s390x, ppc64, ppc64le]:
  kadmind does not accept ACL if kadm5.acl does not end with EOL")
  The code "accidently" works on x86/AMD64 because declaring a
  variable |char| results in an |unsigned char| by default while
  most other platforms (e.g. { s390x, ppc64, ppc64le, ...})
  default to |signed char| (still have to use lint(1) to clean
  up 38 more instances of this kind of bug).- Obsolete multilib versions of server packages to fix RH
  bug #1251913 ("krb5 should obsolete the multilib version�x����������������������Xf#DfJjkson��������0�
a�����	����������������a`�
pdate scl-php73 from v7.3.10 to v7.3.11- EA-8672: Update scl-php73 from v7.3.9 to v7.3.10- EA-8549: Build php-fpm with pcntl- EA-8636: Update scl-php73 from v7.3.8 to v7.3.9- EA-8594: Update scl-php73 from v7.3.7 to v7.3.8- EA-8576: Update litespeed from upstream to 7.5- EA-8558: Update litespeed from upstream to 7.4.2- EA-8561: Update scl-php73 from v7.3.6 to v7.3.7- EA-8538: Update litespeed from upstream to 7.4- EA-8515: Update scl-php73 from v7.3.5 to v7.3.6- ZC-5061: Add PLESK patches for FPM signal management- EA-8428: Update scl-php73 from v7.3.4 to v7.3.5- ZC-5036: Add find-latest-version (assumes PHP is checked out next ro ea-tools)- EA-8342: Update litespeed to new upstream update of 7.3- EA-8342: Update litespeed to 7.3- Updated to version 7.3.4 via update_pkg.pl (EA-8324)- EA-8280: Update opcache.blacklist filename location to match PHP version.- Updated to version 7.3.3 via update_pkg.pl (EA-8275)
- Added patch for phpize to handle autotools on C6- EA-8226: Update PHP 7.3 build process to use scl autoconf- ZC-4640: Initial packaginghou-1 17768075527.3.33-14.19.13.cpanel7.3.33-14.19.13.cpanel20-bz2.inibz2.so/opt/cpanel/ea-php73/root/etc/php.d//opt/cpanel/ea-php73/root/usr/lib64/php/modules/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1  -m64 -mtune=genericobs://private/EA4-production/CentOS_7/2e4087d1db581b6dac385b668208f0e4-scl-php73cpioxz2x86_64-redhat-linux-gnu.4�_K����Hc�ϋ?�������i���#x��~�|��ā�������^��u�r�L�':E�VZ�����􌫢o�]䄭�Dv�]\���c&8�������t���p��5H�G-�)�,Ku\����~�m�ɼ
���"����QF��O��;����1��޳d憂Y�Qv\���Mc>u�x�^�֝��Y�S�@���.][bg�{�����%�qF/��P�^���7�o�V�6��n}���ҏ�N:ǡۤT��
o1���I��^�Y�ܭ�9;Ѓ��b���p����O�����+��<���|Q
�L��[��� ]l�+1 �x}Y1'0tJAU����Oڤ����ha�؊b��0��e�zY���հx�������˲�p{�X��G��d��ּ�Q
��w���}^�����d�n?7������G8<�su� [��q�UHr-q����<y�A�7�u R�:3;��a4Rp�!�j�����m8�s#��r��^�4���n�$O��JM�c,l��.[:�z��e�낉i���#x��~�|��H_��^�w�Z�3�r*F>x{�~d�A��������AU�?�6[�Ьu�⳩�n��$EiY��H��5ۆ�"e�[�����VP���v�Ά3���A��n?�m*8�.n���Sr>m<�[�	��*�4\��?�c0�^�~�����O5�\�<�K�(�f��F��)�<��ۚ
�`1o�E�Hp���<=�yQ�����O4�"m��H.x/�5*��y�upK;Uy�g]i�%n�=vF�p�+K��8d��:��uM5�*L�\&�?���5]��Rj��,L*���X�NBN�B�'S;�d^��0�z������]+���'�5���/��1�$�����
��23S���ꚭ���@���3ɽ�(?}��uD%[R����3A�n�5�v�1M��C0P)���>��f��1�L,�Q�NL����z@�zF�Y�m@8"�ӡ&"���>����&O��}��AF��?��������1��9��;]2b08352fd4bda1876360fdbdb60cae7f9527e19bi�X��i�Fof page walk (Vitaly Kuznetsov) [1565739 1497611]
- [x86] kvm: svm: Add support for additional SVM NPF error codes (Vitaly Kuznetsov) [1565739 1497611]
- [x86] kvm: x86: CPUID.01H:EDX.APIC[bit 9] should mirror IA32_APIC_BASE[11] (Vitaly Kuznetsov) [1565739 1497611]
- [x86] kvm: nvmx: Fetch VM_INSTRUCTION_ERROR from vmcs02 on vmx->fail (Vitaly Kuznetsov) [1565739 1497611]
- [x86] kvm/x86: Replace smp_mb() with smp_store_mb/release() in the walk_shadow_page_lockless_begin/end() (Vitaly Kuznetsov) [1565739 1497611]
- [x86] kvm: mmu: coalesce more page zapping in mmu_sync_children (Vitaly Kuznetsov) [1565739 1497611]
- [x86] kvm: mmu: move zap/flush to kvm_mmu_get_page (Vitaly Kuznetsov) [1565739 1497611]
- [x86] kvm: mmu: invert return value of mmu.sync_page and *kvm_sync_page* (Vitaly Kuznetsov) [1565739 1497611]
- [x86] kvm: mmu: cleanup __kvm_sync_page and its callers (Vitaly Kuznetsov) [1565739 1497611]
- [x86] kvm: mmu: use kvm_sync_page in kvm_sync_pages (Vitaly Kuznetsov) [1565739 1497611]
- [x86] kvm: mmu: move TLB flush out of __kvm_sync_page (Vitaly Kuznetsov) [1565739 1497611]
- [x86] kvm: mmu: introduce kvm_mmu_flush_or_zap (Vitaly Kuznetsov) [1565739 1497611]
- [x86] kvm: mmu: Fix ubsan warnings (Vitaly Kuznetsov) [1565739 1497611]
- [x86] kvm: x86�x�������������}�������X#�fJj�������������������������������48fc29ec504b3a7c5247c5d628152a9deabf42a0c33a13dc21fe813e8ec21ab6bb4ab911ea8563d85dbe234a22a9fa051ad52a0cda37d808b660ba8fdcc04ff6205937641ac0c3f71ae1ba2bf1bd5df020f8fe9d62b0fb6e4bbbebfb8a70dc009bcefba75c90d1f819b171eb8316038a478f15c8e08d28946600a8e88508ebc6bcb4b9ce068d3e22a30329ff5f89b4bdea6d80979f8308512268568896b0bb7fa4c2bf368e434bcafb3e490d5965b56326d776d187bd36cb21aacfe16f5c140b593ec0dc8b8ae46b35b4ba8e71a39dc82af69d3d21bdbd4d434da755f1e0e138beba022125aab3a21ebe50b8cd0ed999f365c168b0cb9590e47aaf9553a817138c6fc5ccea49d451da212e9db0e85ab35e0c3f82f22dcae93415c30ff78c27f1b23d3b9dd3c6cb9a88a0869ae9a2399266ca06a6aed7a92f78f1849ecc2e6ea09ad9a3dd1f048ae16f37efab762065b401b92f8b1a83d5278debe14c0e9a08b9ebae74300159c878ab5015caf90c7a692f3356cab0b41f5fe2a75c56a86ffd87647d182a9bdafc02e5a1c370e9d92603b7e6d54f08656fe19551136c38843038291bed8d2d9b6a2775073226d9305524eee69330a5976e3a8393763455816f3720b335bbf3714477c46b2049f052d1ed537f456cc2dda3198ef99e68afea1b2c4e54432c4027f8ed575610ba9f312769e9d1b155c9d53351007bee9734b0eb82b1d25856df0fb72359e11fa311deee9fa291a78bbb6ff1f9817a49c24b7e8ba21d736b255b0af5a69b000dad2d05a469d59b2a8ad0600c06895e6be2acbd48680e193668f11055fe63a27493e1a989c335cc43ffa1cb4f01b4a39a31932b4b712599a302cccd83ad15771601aa109e9f86c4a826c0df62c446bad55e3426ee8be9eb3443ad5872661144a440ee563f7e0ed843293fc38d7a0ad64ab8aee9fd3e6dce5c5a96b9c954a6571770918290ec665481f7e6bb65e20437262ee80c78af3d9297eab2bff61f263aa99462cb046d5765724fe0439fbdf07f3e323e47e69eb89305782ac425c7b8e110f134ae589f81ca1286d2d68494bff07c3115bf02ec0d9a36433f0e4e3193ddb3c8c33083e33df257c63ad3a971e5d20ab4ce6036adbc51027070e54b54536d9918715cf9f74a15f00febf23910382a2f1935d75d248542c959906c2bc2e2c575c9c8e77f6bce5c7e933b47ede9abc82574bee0621ab75d54a98ac2505e7c432df3b5a49a697d26523e1790c0135694a09f6350d3a2fc671650225756d3ae01d261af504ab2b74564b3e66f8085420cf1c5744ec8796b3580c53ef7b440b94ed72f236a8010e075abf6210f7363e7fc1fd827af5e7db87d2ffd6dd126ed8d7103fce176173a3bc9462569d372203b4e1fb9bc6dbfca71e9f964580a05315f1f184406794e8d362f71b7c3892e6c2e9da18b108404b5852b8c7d3257177aa930b03ff1a94255154d7546cefe46a80350095libpwquality.so.1.0.2rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootlibpwquality-1.2.3-5.el7.src.rpm��������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������config(libpwquality)libpwqualitylibpwquality(x86-64)libpwquality.so.1()(64bit)libpwquality.so.1(LIBPWQUALITY_1.0)(64bit)@@@@@@@@@@@@@


@
/sbin/ldconfig/sbin/ldconfigconfig(libpwquality)cracklib-dictslibc.so.6()(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.3)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libcrack.so.2()(64bit)libpam.so.0()(64bit)libpam.so.0(LIBPAM_1.0)(64bit)libpam.so.0(LIBPAM_EXTENSION_1.0)(64bit)libpam.so.0(LIBPAM_EXTENSION_1.1.1)(64bit)libpwquality.so.1()(64bit)libpwquality.so.1(LIBPWQUALITY_1.0)(64bit)pam(x86-64)rpmli�x��������������l�������XN#�gJj����������=�����u�����������������=�=�=�by processing all remaining events (RHBZ#915892)
- Stop default zone rules being applied to all zones (RHBZ#912782)
- Firewall.start(): don't call set_default_zone()
- Add wiki's URL to firewalld(1) and firewall-cmd(1) man pages
- firewalld-cmd: make --state verbose (RHBZ#886484)
- improve firewalld --help (RHBZ#910492)
- firewall-cmd: --add/remove-* can be used multiple times (RHBZ#879834)
- Continue loading zone in case of wrong service/port etc. (RHBZ#909466)
- Check also services and icmptypes in Zone() (RHBZ#909466)
- Increase the maximum length of the port forwarding fields from 5 to 11 in
  firewall-config
- firewall-cmd: add usage to fail message
- firewall-cmd: redefine usage to point to man page
- firewall-cmd: fix visible problems with arg. parsing
- Use argparse module for parsing command line options and arguments
- firewall-cmd.1: better clarify where to find ACTIONs
- firewall-cmd Bash completion
- firewall-cmd.1: comment --zone=<zone> usage and move some options
- Use zone's target only in %s_ZONES chains
- default zone in firewalld.conf was set to public with every restart (#902845)
- man page cleanup
- code cleanup- Another fix for RHBZ#912782- Stop default zone rules being applied to all zones (RHBZ#912782)- Rebuilt for https://fedoraproject.org/wiki/Fedora_19_Mass_Rebuild- Default zone in firewalld.conf was reseted with every restart (RHBZ#902845)
- Add icon cache related scriptlets for firewall-config (RHBZ#902680)
- Fix typo in firewall-config (RHBZ#895812)
- Fix few mistakes in firewall-cmd(1) man page- firewall-cmd: use -V instead of -v for version info (RHBZ#886477)
- firewall-cmd: don't check reload()'s return value (RHBZ#886461)
- actually install firewalld.zones.5
- firewall-config: treat exceptions when adding new zone/service/icmp
  (RHBZ#886602)
- firewalld.spec: Fixed requirements of firewall-config to use gtk2 and
  pygobject3
- Fail gracefully when running in non X environment.(RHBZ#886551)
- offline-cmd: fail gracefully when no s-c-f config
- fix duplicated iptables rules (RHBZ#886515)
- detect errors and duplicates in config file (RHBZ#886581)
- firewall-config: don't make 'Edit Service' and 'Edit ICMP Type' insensitive
- firewalld.spec: fixed requirements, require pygobject3-base
- frewall-applet: Unused code cleanup
- firewall-applet: several usability fixes and enhancements
  (RHBZ#886531) (RHBZ#886534)
- firewall/server/server.py: fixed KeyboardInterrupt message (RHBZ#886558)
- Moved fallback zone and minimal_mark to firewall.config.__init__
- Do not raise ZONE_ALREADY_SET in change_zone if old zone is set again
  (RHBZ#886432)
- Make default zone default for all unset connections/interfaces
  (RHBZ#888288) (RHBZ#882736)
- firewall-config: Use Gtk.MessageType.WARNING for warning dialog
- firewall-config: Handle unknown services and icmptypes in persistent mode
- firewall-config: Do not load settings more than once
- firewall-config: UI cleanup and fixes (RHBZ#888242)
- firewall-cmd: created alias --change-zone for --change-interface
- firewall-cmd man page updates (RHBZ#806511)
- Merged branch 'build-cleanups'
- dropped call to autogen.sh in build stage, not needed anymore due to 
  'build-cleanups' merge- require pygobject3-base instead of pygobject3 (no cairo needed) (RHBZ#874378)
- fixed dependencies of firewall-config to use gtk3 with pygobject3-base and 
  not pygtk2- Fixed more _xmlplus (PyXML) incompatibilities to python xml
- Several man page updates
- Fixed error in addForwardPort, removeForwardPort and queryForwardPort
- firewall-cmd: use already existing queryForwardPort()
- Update firewall.cmd man page, use man page as firewall-cmd usage (rhbz#876394)
- firewall-config: Do not force to show labels in the main toolbar
- firewall-config: Dropped "Change default zone" from toolbar
- firewall-config: Added menu entry to change zones of connections
- firewall-applet: Zones can be changed now using nm-connection-editor
  (rhbz#876661)
- translation updates: cs, hu, ja- tests/firewalld_config.py: tests for config.service and config.icmptype
- �x��������������[�������XY#�gJjomeg��k������@K�����(����������������@K?K���- Upgrade to NSS 3.16.2.3 for Firefox 31.3- Resolves: Bug 1158161 - Upgrade to NSS 3.16.2.3 for Firefox 31.3
- Support TLS_FALLBACK_SCSV in tstclnt and ssltap- Resolves: Bug 1145434 - CVE-2014-1568
- Using a release number higher than on rhel-7.0 branch- Fix crash in stan_GetCERTCertificate
- Resolves: Bug 1094468- Generic 32/64 bit platform detection (fix ppc64le build)
- Resolves: Bug 1125619 - nss fails to build on arch: ppc64le (missing dependencies)
- Fix contributed by Peter Robinson <pbrobinson@redhat.com>- Fix libssl and test patches that disable ssl2 support
- Resolves: Bug 1123435
- Replace expired PayPal test certificate with current one- Rebase to nss-3.16.2
- Resolves: Bug 1103252 - Rebase RHEL 7.1 to at least NSS 3.16.1 (FF 31)
- Fix test failure detection in the %check section
- Move removal of unwanted source directories to the end of the %prep section
- Update various patches on account of the rebase
- Remove unused patches rendered obsolete by the rebase- Disallow disabling the internal module
- Resolves: Bug 1056036 - nss segfaults with opencryptoki module- Pick up a fix from rhel-6 and fix an rpm conflict
- Don't hold issuer cert handles in crl cache
- Resolves: Bug 1034409 - deadlock in trust domain and object lock
- Move nss shared db files to the main package
- Resolves: Bug 1050163 - Same files in two packages create rpm conflict- Update pem sources to latest from nss-pem upstream
- Pick up pem module fixes verified on RHEL and applied upstream
- Remove no loger needed pem patches on acccount on this update
- Add comments documenting the iquote.patch 
- Resolves: Bug 1054457 - CVE-2013-1740- Remove spurious man5 wildcard entry as all manpages are listed by name
- Resolves: Bug 1050163 - Same files in two packages create rpm conflict- Mass rebuild 2014-01-24- Rebase to nss-3.15.4
- Resolves: Bug 1054457 - CVE-2013-1740 nss: false start PR_Recv information disclosure security issue
- Remove no longer needed patches for manpages that were applied upstream
- Remove no longer needed patch to disable ocsp stapling tests
- Update iquote.patch on account of upstream changes
- Update and rename patch to pem/rsawrapr.c on account of upstream changes
- Use the pristine upstream sources for nss without repackaging
- Avoid unneeded manual step which may introduce errors- Fix the spec file to apply the nss ecc list patch for bug 752980
- Resolves: Bug 752980 - Support ECDSA algorithm in the nss package via puggable ecc- Move several nss-sysinit manpages tar archives to the %files
- Resolves: Bug 1050163 - Same files in two packages create rpm conflict- Fix a coverity scan compile time warning for the pem module
- Resolves: Bug 1002271 - NSS pem module should not require unique base file names- Resolves: Bug 1002271 - NSS pem module should not require unique base file names- Improve pluggable ECC support for ECDSA
- Resolves: Bug 752980 - [7.0 FEAT] Support ECDSA algorithm in the nss package- Mass rebuild 2013-12-27- Revoke trust in one mis-issued anssi certificate
- Resolves: Bug 1040284 - nss: Mis-issued ANSSI/DCSSI certificate (MFSA 2013-117) [rhel-7.0]- Update to NSS_3_15_3_RTM
- Resolves: Bug 1031463 - CVE-2013-5605 CVE-2013-5606 CVE-2013-1741- Fix path to script and remove -- from some options in nss-sysinit man page
- Resolves: rhbz#982723 - man page of nss-sysinit worong path and other flaws- Fix certutil man page options names to be consistent with help
- Resolves: rhbz#948495 - man page scan results for nss
- Remove incorrect count argument in status description in nss-sysinit man page
- Resolves: rhbz#982723 - man page of nss-sysinit incorrect option descriptions- Fix patch for disabling ssl2 in ssl to correctly set error code
- Fix syntax error reported in the build.log even tough it succeeds
- Add patch top ignore setpolicy result 
- Resolves: rhbz#1001841 - Disable SSL2 and the export cipher suites
- Resolves: rhbz#1026677 - Attempt to run ipa-client-install fails- Fix bash syntax error in patch for disabling ssl2 tests
- Resolves: rhbz#1001841 - Di�x�������������pK�������X�#�gJj wit���k�������������t������������������@K���sable SSL2 and the export cipher suites- Fix errors in ssl disabling patches for both library and tests
- Add s390x to the multilib_arches definition used for alt_ckbi
- Resolves: rhbz#1001841 - Disable SSL2 and the export cipher suites- Fix errors in nss-sysinit manpage options descriptions
- Resolves: rhbz#982723- Enable fips when system is in fips mode
- Resolves: rhbz#852023 - FIPS mode detection does not work- Remove unused and obsoleted patches
- Related: rhbz#1012656- Add description of the certutil's --email option to it's manpage
- Resolves: rhbz#Bug 948495 - Man page scan results for nss- Rebase to nss-3.15.2
- Resolves: rhbz#1012656 - pick up NSS 3.15.2 to fix CVE-2013-1739 and disable MD5 in OCSP/CRL- Install symlink to nss-sysinit.sh without the .sh suffix
- Resolves: rhbz#982723 - nss-sysinit man page has wrong path for the script- Resolves: rhbz#1001841 - Disable SSL2 and the export cipher suites- Add upstream bug URL for a patch subitted upstream and remove obsolete script- Update to NSS_3_15_1_RTM
- Apply various fixes to the man pages and add new ones
- Enable the iquote.patch to access newly introduced types
- Add man page for pkcs11.txt configuration file and cert and key databases
- Add missing option descriptions for {cert|cms|crl}util
- Resolves: rhbz#948495 - Man page scan results for nss
- Resolves: rhbz#982723 - Fix path to script in man page for nss-sysinit- Use the unstripped source tar ball- Install man pages for nss-tools and the nss-config and setup-nsssysinit scripts
- Resolves: rhbz#606020 - nss security tools lack man pages- Build nss without softoken or util sources in the tree
- Resolves: rhbz#689918- Update ssl-cbc-random-iv-by-default.patch- Fix generation of NSS_VMAJOR, NSS_VMINOR, and NSS_VPATCH for nss-config- Update to NSS_3_15_RTM- Reactivate nss-ssl-cbc-random-iv-off-by-default.patch- Add upstream patch to fix rhbz#872761- Update expired test certificates (fixed in upstream bug 852781)- Fix incorrect post/postun scripts. Fix broken links in posttrans.- Configure libnssckbi.so to use the alternatives system
  in order to prepare for a drop in replacement.- Update to NSS_3_14_3_RTM
- sync up pem rsawrapr.c with softoken upstream changes for nss-3.14.3
- Resolves: rhbz#908257 - CVE-2013-1620 nss: TLS CBC padding timing attack
- Resolves: rhbz#896651 - PEM module trashes private keys if login fails
- Resolves: rhbz#909775 - specfile support for AArch64
- Resolves: rhbz#910584 - certutil -a does not produce ASCII output- Allow building nss against older system sqlite- Update to NSS_3_14_2_RTM- Update to NSS_3_14_1_WITH_CKBI_1_93_RTM- Require nspr >= 4.9.4
- Fix changelog invalid dates- Update to NSS_3_14_1_RTM- Bug 879978 - Install the nssck.api header template where mod_revocator can access it
- Install nssck.api in /usr/includes/nss3/templates- Bug 879978 - Install the nssck.api header template in a place where mod_revocator can access it
- Install nssck.api in /usr/includes/nss3- Bug 870864 - Add support in NSS for Secure Boot- Disable bypass code at build time and return failure on attempts to enable at runtime
- Bug 806588 - Disable SSL PKCS #11 bypass at build time- Fix pk11wrap locking which fixes 'fedpkg new-sources' and 'fedpkg update' hangs
- Bug 872124 - nss-3.14 breaks fedpkg new-sources
- Fix should be considered preliminary since the patch may change upon upstream approval- Add a dummy source file for testing /preventing fedpkg breakage
- Helps test the fedpkg new-sources and upload commands for breakage by nss updates
- Related to Bug 872124 - nss 3.14 breaks fedpkg new-sources- Fix a previous unwanted merge from f18
- Update the SS_SSL_CBC_RANDOM_IV patch to match new sources while
- Keeping the patch disabled while we are still in rawhide and
- State in comment that patch is needed for both stable and beta branches
- Update .gitignore to download only the new sources- Fix the spec file so sechash.h gets installed
- Resolves: rhbz#871882 - missing header: sechash.h in nss 3.14- Update the license to MPLv2.�x��������������:�������X.c�fJj- 5.@ 
`1eer <�Y����������������1e0e2e�av Lichvar <mlichvar@redhat.com> 4.2.4p2-5Miroslav Lichvar <mlichvar@redhat.com> 4.2.4p2-4Jesse Keating <jkeating@redhat.com> - 4.2.4p2-3Miroslav Lichvar <mlichvar@redhat.com> 4.2.4p2-2Miroslav Lichvar <mlichvar@redhat.com> 4.2.4p2-1Miroslav Lichvar <mlichvar@redhat.com> 4.2.4p0-3Miroslav Lichvar <mlichvar@redhat.com> 4.2.4p0-2Miroslav Lichvar <mlichvar@redhat.com> 4.2.4p0-1Miroslav Lichvar <mlichvar@redhat.com> 4.2.4-4Miroslav Lichvar <mlichvar@redhat.com> 4.2.4-3Miroslav Lichvar <mlichvar@redhat.com> 4.2.4-1Miroslav Lichvar <mlichvar@redhat.com> 4.2.2p4-2Miroslav Lichvar <mlichvar@redhat.com> 4.2.2p4-1Miroslav Lichvar <mlichvar@redhat.com> 4.2.2p1-3Miroslav Lichvar <mlichvar@redhat.com> 4.2.2p1-2Miroslav Lichvar <mlichvar@redhat.com> 4.2.2p1-1Miroslav Lichvar <mlichvar@redhat.com> 4.2.2-3Miroslav Lichvar <mlichvar@redhat.com> 4.2.2-2Miroslav Lichvar <mlichvar@redhat.com> 4.2.2-1Miroslav Lichvar <mlichvar@redhat.com> - 4.2.0.a.20050816-14Miroslav Lichvar <mlichvar@redhat.com> - 4.2.0.a.20050816-13Miroslav Lichvar <mlichvar@redhat.com> - 4.2.0.a.20050816-12Miroslav Lichvar <mlichvar@redhat.com> - 4.2.0.a.20050816-11Jesse Keating <jkeating@redhat.com> - 4.2.0.a.20050816-10.2.1Jesse Keating <jkeating@redhat.com> - 4.2.0.a.20050816-10.2Jesse Keating <jkeating@redhat.com>Petr Raszyk <praszyk@redhat.com> 4.2.0.a.20050816-10Petr Raszyk <praszyk@redhat.com> 4.2.0.a.20050816-9Petr Raszyk <praszyk@redhat.com> 4.2.0.a.20050816-3Petr Raszyk <praszyk@redhat.com> 4.2.0.a.20050816-2Jindrich Novy <jnovy@redhat.com> 4.2.0.a.20050816-1Jiri Ryska <jryska@redhat.com> 4.2.0.a.20040617-8Jiri Ryska <jryska@redhat.com> 4.2.0.a.20040617-7Tim Waugh <twaugh@redhat.com> - 4.2.0.a.20040617-6Harald Hoyer <harald@redhat.com> - 4.2.0.a.20040617-5Harald Hoyer <harald@redhat.com> - 4.2.0.a.20040617-4Harald Hoyer <harald@redhat.com> - 4.2.0.a.20040617-3Harald Hoyer <harald@redhat.com> - 4.2.0.a.20040617-2Harald Hoyer <harald@redhat.com> - 4.2.0.a.20040617-1Harald Hoyer <harald@redhat.com> - 4.2.0.a.20040616-4Harald Hoyer <harald@redhat.com> - 4.2.0.a.20040616-3Harald Hoyer <harald@redhat.com> - 4.2.0.a.20040616-2Harald Hoyer <harald@redhat.com> - 4.2.0.a.20040616-1Elliot Lee <sopwith@redhat.com>Harald Hoyer <harald@redhat.com> - 4.2.0-7Elliot Lee <sopwith@redhat.com>Harald Hoyer <harald@faro.stuttgart.redhat.com> - 4.2.0-5Harald Hoyer <harald@redhat.de> 4.2.0-4Harald Hoyer <harald@redhat.de> 4.2.0-3Harald Hoyer <harald@redhat.de> 4.2.0-2Harald Hoyer <harald@redhat.de> 4.2.0-1Harald Hoyer <harald@redhat.de> 4.1.2-4Florian La Roche <Florian.LaRoche@redhat.de>Harald Hoyer <harald@redhat.de> 0:4.1.2-2Harald Hoyer <harald@redhat.de> 0:4.1.2-1.rc3.5Harald Hoyer <harald@redhat.de> 0:4.1.2-1.rc3.4Harald Hoyer <harald@redhat.de> 0:4.1.2-1.rc3.3Harald Hoyer <harald@redhat.de> 0:4.1.2-1.rc3.2Harald Hoyer <harald@redhat.de> 0:4.1.2-1.rc3.1Elliot Lee <sopwith@redhat.com>Harald Hoyer <harald@redhat.de> 0:4.1.2-0.rc2.2Harald Hoyer <harald@redhat.de> 0:4.1.2-0.rc2.1Harald Hoyer <harald@redhat.de> 0:4.1.2-0.rc1.3Harald Hoyer <harald@redhat.de> 0:4.1.2-0.rc1.2Harald Hoyer <harald@redhat.de> 1:4.1.1-2Harald Hoyer <harald@redhat.de> 4.1.1-1Harald Hoyer <harald@redhat.de> 4.1.73-2Harald Hoyer <harald@redhat.de> 4.1.73-1Tim Powers <timp@redhat.com>Harald Hoyer <harald@redhat.de> 4.1.1b-1Harald Hoyer <harald@redhat.de> 4.1.1a-12Harald Hoyer <harald@redhat.de>Harald Hoyer <harald@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Jeremy Katz <katzj@redhat.com>Harald Hoyer <harald@redhat.de>Harald Hoyer <harald@redhat.de>Harald Hoyer <harald@redhat.de>Tim Powers <timp@redhat.com>Harald Hoyer <harald@redhat.de> 4.1.1a-3Harald Hoyer <harald@redhat.de> 4.1.1a-1Harald Hoyer <harald@redhat.de> 4.1.1-1Harald Hoyer <harald@redhat.de> 4.1.0b-6Harald Hoyer <harald@redhat.de> 4.1.0b-5Harald Hoyer <harald@redhat.de> 4.1.0b-4Tim Powers <timp@redhat.com> 4.1.0b-3Harald Hoyer <harald@redhat.de> 4.1.0b-2Harald Hoyer <harald@redhat.de> 4.1.0b-1Harald Hoyer <harald@redhat.de> 4.1.�x�������������`*�������X�#-gJjX���y�����r�����������������y�Hٛ�P#�@Pk�Pk�P�P��O�^@O��OȮ�O��@O��@Ohq@OY�OWM�OC�@O'�O&�@O&�@O!@@O�@O
y�O?@N�x�N�>@N��N��N�T@N��@N�j@N��N��N�R@N��@Nw.�Nf@N_s�N^"@N?�N)f@N&�@N%q�N*�M�6@M�M@M�M@M�@�M��@M��M‘@M��@M���M��@M�I@MT�M]
�M[�@MR��MQ0@MO�MO�MG��M@�M�@ME@M	�@L��@L�7�L��L�@L���L���L�*@L��@L��@Ls�@LYV@L4l@LT@LT@L�L�@K�^�K�j@K�@K�@K͗@KŮ@K��K��@K��@K��@K�g@K�,�K��K��@K�O@K���K�f@K{�@Kz��Kie@K]��KY�@KTM@KPX�KO@KLd@KD{@KC)�KA�@KA�@K/c@K �K�@K?�K?�K��K�@K��J�J�k�J�0@J�G@J���J��@Ji�@JS8�JQ�@JI�@JI�@JH��JD�@J7�@J)�J'�@J�@J@I�X@I�@I�c�I�o@I�@@I��I���I�2�Ipv�H��H�@�H}�HwK@HS��H�@G�@G�#�G߮�G߮�G�@G­�G­�G­�G­�G�s@G��G��@G{|�Gg�@GV��G�@G�@Ga�G�@F�@F�@F��F�H�F��F�v�F���F�R@F�Q@F�@F�@F�@F~\�F~\�F~\�F{��F{��F{��FU~@FT,�FM�@FJ�@F; @F; @Fp�F�FA�Fo�Fo�E�{@E�5@E�n�E�@Eّ@E�3@E��@E��@E��@E�x@E���E�%�EE�@E<��E6@E6@E*9�E#�@D��@D�D�|�D�+@D��D��D�{�D��@D��@D���D��D�@Dq��DR�D?��C�@C�:@C�@C�@C�q�C��C|p�C&�@C��C��B�=�B@B@B�;�B���B���B���B{\@BAZ@B9q@B8�B��Aƾ�Aƾ�Aƾ�Aƾ�A��@A��A��A��A��A�%@Ao��A4h@A+-�A+-�A)�@A)�@AC�@��@͓@@�X�@�X�@�d@@�d@@�o�@�o�@��@~y@@{�@@O@@L`@@Dw@@,�@@'v@@;�@�@�@?��?�	�?r�?p5�?\o@?Xz�?U�?KK�?/�@?.J�?�@?�?	`�>�T@>��@>�j@>�@>�-�>z��>x[�>u��>g8@>g8@>?�@>>Y�>/�@>.��>%M@>d@>�@=�=��@=�K@=��=ϛ�=��@=��@=�@=�w@=�H@=��@=Jt@==E@=7�@=@<��@<��<m@<s��<R�@<Ek@<D�<=�@;j�@;j�@;g�@;X@;L?�;9�;5�@;�@;
T�:�
�:݁�:�u@:���:�t@:��:��@:�@:mr@:h,@:b�@:,�:'��9��@9�b�9�m@9��9��9��@9u�@9pR@9o�9m�@9i��9dt�9\��9[:@9Y�9WE�9N@9Kh@9H�@9Gs�9@�@9<�98�@9+�@9"��9!8@9�9�9�8��@8�*�8�8�A�8�@�8Ý�8��@8�W�8�c@8���8�V�8�m�8�J@8u�@8h�@8_k�8^@8\�7��@7���7�\@7��@7oz�7d�7=a�Koba Karaputadze <kkaraputadze@cloudlinux.com> - 1.15.1-55.tuxcare.els2Linar Nadeev <lnadeev@cloudlinux.com> - 1.15.1-55.tuxcare.els1Julien Rische <jrische@redhat.com> - 1.15.1-55Julien Rische <jrische@redhat.com> - 1.15.1-54Julien Rische <jrische@redhat.com> - 1.15.1-53Antonio Torres <antorres@redhat.com> - 1.15.1-51Robbie Harwood <rharwood@redhat.com> - 1.15.1-50Robbie Harwood <rharwood@redhat.com> - 1.15.1-49Robbie Harwood <rharwood@redhat.com> - 1.15.1-48Robbie Harwood <rharwood@redhat.com> - 1.15.1-47Robbie Harwood <rharwood@redhat.com> - 1.15.1-46Robbie Harwood <rharwood@redhat.com> - 1.15.1-45Robbie Harwood <rharwood@redhat.com> - 1.15.1-44Robbie Harwood <rharwood@redhat.com> - 1.15.1-43Robbie Harwood <rharwood@redhat.com> - 1.15.1-42Robbie Harwood <rharwood@redhat.com> - 1.15.1-41Robbie Harwood <rharwood@redhat.com> - 1.15.1-40Robbie Harwood <rharwood@redhat.com> - 1.15.1-39Robbie Harwood <rharwood@redhat.com> - 1.15.1-38Robbie Harwood <rharwood@redhat.com> - 1.15.1-37Robbie Harwood <rharwood@redhat.com> - 1.15.1-36Robbie Harwood <rharwood@redhat.com> - 1.15.1-35Robbie Harwood <rharwood@redhat.com> - 1.15.1-34Robbie Harwood <rharwood@redhat.com> - 1.15.1-33Robbie Harwood <rharwood@redhat.com> - 1.15.1-32Robbie Harwood <rharwood@redhat.com> - 1.15.1-31Robbie Harwood <rharwood@redhat.com> - 1.15.1-30Robbie Harwood <rharwood@redhat.com> - 1.15.1-29Robbie Harwood <rharwood@redhat.com> - 1.15.1-28Robbie Harwood <rharwood@redhat.com> - 1.15.1-27Robbie Harwood <rharwood@redhat.com> - 1.15.1-26Robbie Harwood <rharwood@redhat.com> - 1.15.1-25Robbie Harwood <rharwood@redhat.com> - 1.15.1-24Robbie Harwood <rharwood@redhat.com> - 1.15.1-23Robbie Harwood <rharwood@redhat.com> - 1.15.1-22Robbie Harwood <rharwood@redhat.com> - 1.15.1-21Robbie Harwood <rharwood@redhat.com> - 1.15.1-20Robbie Harwood <rharwood@redhat.com> - 1.15.1-19Robbie Harwood <rharwood@redhat.com> - 1.15.1-18Robbie Harwood <rharwood@redhat.com> - 1.15.1-17Robbie Harwood <rharwood@redhat.com> - 1.15.1-16Robbie Harwood <rharwood@redhat.com> - 1.15.1-15Robbie Harwood <rharwood@redhat.com> - 1.15.1-14Robbie Harwood <rharwood@redhat.com> - 1.15.1-13Robbie Harwood <rharwood@redhat.com> - 1.15.1-12Robbie Harwood <rharwood@redhat.com> - 1.15.1-11Robbie Harwood <rharwood@redhat.com> - 1.15.1-10Robbie Harwood <rharwood@redhat.com> - 1.15.1-9Robbie Harwo�x���������������������X�#�gJj��������H<k�����T����������������<k�S;k�Elio Maldonado <emaldona@redhat.com> - 3.12.9-9Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 3.12.9-8Elio Maldonado <emaldona@redhat.com> - 3.12.9-7Christopher Aillon <caillon@redhat.com> - 3.12.9-6Elio Maldonado <emaldona@redhat.com> - 3.12.9-5Elio Maldonado <emaldona@redhat.com> - 3.12.9-4Elio Maldonado <emaldona@redhat.com> - 3.12.9-3Elio Maldonado <emaldona@redhat.com> - 3.12.9-2Elio Maldonado <emaldona@redhat.com> - 3.12.9-1Elio Maldonado <emaldona@redhat.com> - 3.12.9-0.1.beta2Elio Maldonado <emaldona@redhat.com> - 3.12.8.99.2-1Elio Maldonado <emaldona@redhat.com> - 3.12.8.99.1-1Elio Maldonado <emaldona@redhat.com> - 3.12.8-9Elio Maldonado <emaldona@redhat.com> - 3.12.8-8Elio Maldonado <emaldona@redhat.com> - 3.12.8-7Elio Maldonado <emaldona@redhat.com> - 3.12.8-6Elio Maldonado <emaldona@redhat.com> - 3.12.8-5Elio Maldonado <emaldona@redhat.com> - 3.12.8-4Elio Maldonado <emaldona@redhat.com> - 3.12.8-3Elio Maldonado <emaldona@redhat.com> - 3.12.8-2Elio Maldonado <emaldona@redhat.com> - 3.12.8-1Elio Maldonado <emaldona@redhat.com> - 3.12.7.99.4-1Elio Maldonado <emaldona@redhat.com> - 3.12.7.99.3-2Elio Maldonado <emaldona@redhat.com> - 3.12.7.99.3-1Elio Maldonado <emaldona@redhat.com> - 3.12.7-3Elio Maldonado <emaldona@redhat.com> - 3.12.7-2Elio Maldonado <emaldona@redhat.com> - 3.12.7-1Elio Maldonado <emaldona@redhat.com> - 3.12.6-12Elio Maldonado <emaldona@redhat.com> - 3.12.6-11Elio Maldonado <emaldona@redhat.com> - 3.12.6-10Elio Maldonado <emaldona@redhat.com> - 3.12.6-9Dennis Gilmore <dennis@ausil.us> - 3.12.6-8Elio Maldonado <emaldona@redhat.com> - 3.12.6-7Elio Maldonado <emaldona@redhat.com> - 3.12.6-6Elio Maldonado <emaldona@redhat.com> - 3.12.6-5Elio Maldonado <emaldona@redhat.com> - 3.12.6-4Elio Maldonado <emaldona@redhat.com> - 3.12.6-3Elio Maldonado <emaldona@redhat.com> - 3.12.6-2Elio Maldonado <emaldona@redhat.com> - 3.12.6-1.2Elio Maldonado <emaldona@redhat.com> - 3.12.6-1.1Elio Maldonado <emaldona@redhat.com> - 3.12.6-1Elio Maldonado <emaldona@redhat.com> - 3.12.5-8Elio Maldonado <emaldona@redhat.com> - 3.12.5-5Elio Maldonado <emaldona@redhat.com> - 3.12.5-1.1Elio Maldonado<emaldona@redhat.com> - 3.12.5-1.13.2Elio Maldonado<emaldona@redhat.com> - 3.12.5-1.13.1Elio Maldonado<emaldona@redhat.com> - 3.12.5-1.13Elio Maldonado<emaldona@redhat.com> - 3.12.5-1.11Elio maldonado<emaldona@redhat.com> - 3.12.5-1.9Elio Maldonado<emaldona@redhat.com> - 3.12.5-2.7Elio Maldonado<emaldona@redhat.com> - 3.12.5-1.6Elio Maldonado<emaldona@redhat.com> - 3.12.5-1.5Elio Maldonado<emaldona@redhat.com> - 3.12.5-1.1Elio Maldonado<emaldona@redhat.com> - 3.12.5-1.1Elio Maldonado<emaldona@redhat.com> - 3.12.5-1Elio Maldonado<emaldona@redhat.com> - 3.12.4-14.1Elio Maldonado<emaldona@redhat.com> - 3.12.4-13.1Elio Maldonado<emaldona@redhat.com> - 3.12.4-13Elio Maldonado<emaldona@redhat.com> - 3.12.4-12Elio Maldonado<emaldona@redhat.com> - 3.12.4-11Elio Maldonado<emaldona@redhat.com> - 3.12.4-10Elio Maldonado<emaldona@redhat.com - 3.12.4-9Elio Maldonado<emaldona@redhat.com> - 3.12.4-8Elio Maldonado<emaldona@redhat.com - 3.12.4-7Elio Maldonado<emaldona@redhat.com> - 3.12.4-6Elio Maldonado<emaldona@redhat.com> - 3.12.4-5Elio Maldonado<emaldona@redhat.com> - 3.12.4-4Elio Maldonado<emaldona@redhat.com> - 3.12.4-3Elio Maldonado<emaldona@redhat.com> - 3.12.4-2Elio Maldonado<emaldona@redhat.com> - 3.12.4-1Elio Maldonado<emaldona@redhat.com> - 3.12.3.99.3-30Elio Maldonado<emaldona@redhat.com> - 3.12.3.99.3-29Elio Maldonado<emaldona@redhat.com> - 3.12.3.99.3-28Elio Maldonado<emaldona@redhat.com> - 3.12.3.99.3-27Elio Maldonado<emaldona@redhat.com> - 3.12.3.99.3-26Elio Maldonado<emaldona@redhat.com> - 3.12.3.99.3-25Warren Togami <wtogami@redhat.com> - 3.12.3.99.3-24Elio Maldonado<emaldona@redhat.com> - 3.12.3.99.3-23Elio Maldonado<emaldona@redhat.com> - 3.12.3.99.3-22Elio Maldonado<emaldona@redhat.com> - 3.12.3.99.3-21Elio Maldonado<emaldona@redhat.com> - 3.12.3.99.3-20Elio Maldonado<emaldona@redhat.com> - 3.12.3.99.3-19�x�������������P	�������X^#gJjpX@��E�����}�����������������E`����y across all
  SAPI types (EA-5587)- Make php-cli require php-litespeed- Set register_argc_argv default on to match EasyApache 3- Force users on jailshell and noshell to be chrooted when using php-fpm- Changed php-fpm.d directory to 0710 (EA-5097)- update PHP 5.5 to release 5.5.38 (EA-4886)- Apply previous patch code in spec file- PHP-FPM + .user.ini allows code execution as other users- Updated to version 5.5.37 via update_pkg.pl (EA-4730)- EA-4383: Update Release value to OBS-proof versioning- Removed unused global wsdl and session cache directories (EA-4691)- Added EasyApache 3 backwards compatibility php.ini patch (EA-4664)- Enabled PHP-Litespeed package- Updated to version 5.5.36 via update_pkg.pl (EA-4624)- Updated to version 5.5.35 via update_pkg.pl (EA-4483)- Now uses bundled gd (ZC-1563)
- Updated descriptions to use scl_prefix macros (like php7)- Updated to version 5.5.34 via update_pkg.pl (EA-4397)- Updated to version 5.5.33 via update_pkg.pl (EA-4218)- mod_php adjusted to conflict with other mod_php versions, and
  not itself.  this lets the user reinstall the package without
  conflict. (ZC-1459)- Added imap extension for all CentOS versions.  It now depends on
  our internal SCL libc-client package.- Updated to version 5.5.32 via update_pkg.pl (EA-4127)- Improve DSO conflicts (EA-3751)- Updated to version 5.5.31 via update_pkg.pl (EA-4050)- mod_php requires a non-threaded Apache mpm (EA-3982)- Enabled short_open_tags (ZC-1284)- Disable ZTS support (EA-3791)- make ea-php5x-php-fpm depend on ea-php5X-php-cli (EA-3836)- Rename www.conf to www.conf.example (ZC-1205)- Use libphp5.so as module name for simplicity/consistency (EA-3750)- Updated to version 5.5.30 via update_pkg.pl- Updated to version 5.5.29 via update_pkg.pl- Updated to version 5.5.28 via update_pkg.pl- Enabled mcrypt for all builds- Moved "ea-php-cli" to correct package- Added ea-php-cli requirement- Fix macros.php syntax error- Change ea-apache2 to ea-apache24- Set imap and recode to be incompatible
- developer version of opcache.ini is distributed instead of auto-gen- Updated to PHP 5.5.22
- Made compatible with EA web server namespace- Added back in the upstream archive, replaced the excised JSON- fileinfo: fix out-of-bounds read in elf note headers. CVE-2014-3710- xmlrpc: fix out-of-bounds read flaw in mkgmtime() CVE-2014-3668
- core: fix integer overflow in unserialize() CVE-2014-3669
- exif: fix heap corruption issue in exif_thumbnail() CVE-2014-3670- gd: fix NULL pointer dereference in gdImageCreateFromXpm().
  CVE-2014-2497
- gd: fix NUL byte injection in file names. CVE-2014-5120
- core: fix heap-based buffer overflow in DNS TXT record
  parsing. CVE-2014-4049
- network: fix segfault in dns_get_record
  (incomplete fix for CVE-2014-4049). CVE-2014-3597
- core: unserialize() SPL ArrayObject / SPLObjectStorage
  type confusion flaw. CVE-2014-3515
- core: type confusion issue in phpinfo(). CVE-2014-4721
- spl: fix use-after-free in ArrayIterator due to object
  change during sorting. CVE-2014-4698
- spl: fix use-after-free in SPL Iterators. CVE-2014-4670
- fileinfo: cdf_unpack_summary_info() excessive looping
  DoS. CVE-2014-0237
- fileinfo: CDF property info parsing nelements infinite
  loop. CVE-2014-0238
- fileinfo: cdf_read_short_sector insufficient boundary
  check. CVE-2014-0207
- fileinfo: fix extensive backtracking in regular expression
  (incomplete fix for CVE-2013-7345). CVE-2014-3538
- fileinfo: cdf_check_stream_offset insufficient boundary
  check. CVE-2014-3479
- fileinfo: cdf_count_chain insufficient boundary check
  CVE-2014-3480
- fileinfo: fix mconvert incorrect handling of truncated
  pascal string size. CVE-2014-3478
- fileinfo: cdf_read_property_info insufficient boundary
  check. CVE-2014-3487
- fileinfo: fix cdf_read_property_info
  (incomplete fix for CVE-2012-1571). CVE-2014-3587- fileinfo: fix out-of-bounds memory access CVE-2014-2270
- fileinfo: fix extensive backtracking CVE-2013-7345- gd: fix NULL deref in imagecrop CVE-2013-7327
- gd: drop vpx�x���������������������X#BfJjalwa���������	t���������������������t`�?&�?"(d����	*�	g�������������	��-�3<D	H
LT�
���� (T��(�8�H9H:THF 
G  H (I 0X 4Y <\ l] t^ �b �c!�d!�e!�f!�l!�z"�"$"8"<$T$d
&|�&�&�&�g&�h&�Cea-php73-php-bz27.3.3314.19.13.cpanelA module for PHP applications that interface with .bz2 filesThe php-bz2 package delivers a module which will allow PHP scripts to
interface with .bz2 files.i��hou-1��EA4-production / CentOS_7cPanel, Inc.PHPDevelopment/Languageshttp://www.php.net/linuxx86_64/�ȁ���i��Pi��Cb14ce0e0e58c0584530424a436c42138edc772f35ad91fbb1fc7902a67c6a6be192c458d57fba4e942801e0a2c57c191b98eaa26fb3d3f7856a8fd91a2e6d12erootrootrootrootea-php73-php-7.3.33-14.19.13.cpanel.src.rpm��������ea-php73-php-bz2ea-php73-php-bz2(x86-64)


@@@@@@
ea-php73-php-commonea-php73-php-clirpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(CompressedFileNames)libbz2.so.1()(64bit)libc.so.6()(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.4)(64bit)rtld(GNU_HASH)rpmlib(PayloadIsXz)7.3.33-14.19.13.cpanel7.3.33-14.19.13.cpanel4.6.0-14.0-13.0.4-15.2-14.11.3h�R@g�@f�)@f�@e�4@e\��dd��d[�@d,@cl�b\@a�q@a��a�@@a�@aw�a]��aLl@a'�@`ݮ@`ٹ�`���`B@`�_���_�0@_Í@_�F@_���_�]@_u�_R,@_P�_+�_�@_�^�)@^�n@^��@^�x�^�2�^�H�^|�@^s^�^[��^Nt�^=Q@^)��]�f@]��]��]�|@]��@]���]z3@]nU�]B�@]5�@]#0@];�]�\�@\�s@\��\��@\���\��\��\�M�\��\~d�\\�Chris Castillo <chris.castillo@webpros.com> - 7.3.33-14Julian Brown <julian.brown@cpanel.net> - 7.3.33-13Julian Brown <julian.brown@cpanel.net> - 7.3.33-12Dan Muey <dan@cpanel.net> - 7.3.33-11Travis Holloway <t.holloway@cpanel.net> - 7.3.33-10Tim Mullin <tim@cpanel.net> - 7.3.33-9Brian Mendoza <brian.mendoza@cpanel.net> - 7.3.33-8Brian Mendoza <brian.mendoza@cpanel.net> - 7.3.33-7Julian Brown <julian.brown@cpanel.net> - 7.3.33-6Travis Holloway <t.holloway@cpanel.net> - 7.3.33-5Travis Holloway <t.holloway@cpanel.net> - 7.3.33-4Julian Brown <julian.brown@cpanel.net> - 7.3.33-3Julian Brown <julian.brown@cpanel.net> - 7.3.33-2Cory McIntire <cory@cpanel.net> - 7.3.33-1Dan Muey <dan@cpanel.net> - 7.3.32-2Cory McIntire <cory@cpanel.net> - 7.3.32-1Julian Brown <julian.brown@cpanel.net> - 7.3.31-2Cory McIntire <cory@cpanel.net> - 7.3.31-1Cory McIntire <cory@cpanel.net> - 7.3.30-1Cory McIntire <cory@cpanel.net> - 7.3.29-1Travis Holloway <t.holloway@cpanel.net> - 7.3.28-2Cory McIntire <cory@cpanel.net> - 7.3.28-1Cory McIntire <cory@cpanel.net> - 7.3.27-2Cory McIntire <cory@cpanel.net> - 7.3.27-1Cory McIntire <cory@cpanel.net> - 7.3.26-1Julian Brown <julian.brown@cpanel.net> - 7.3.25-2Cory McIntire <cory@cpanel.net> - 7.3.25-1Cory McIntire <cory@cpanel.net> - 7.3.24-1Daniel Muey <dan@cpanel.net> - 7.3.23-3Tim Mullin <tim@cpanel.net> - 7.3.23-2Cory McIntire <cory@cpanel.net> - 7.3.23-1Tim Mullin <tim@cpanel.net> - 7.3.22-2Cory McIntire <cory@cpanel.net> - 7.3.22-1Cory McIntire <cory@cpanel.net> - 7.3.21-1Tim Mullin <tim@cpanel.net> - 7.3.20-2Cory McIntire <cory@cpanel.net> - 7.3.20-1Julian Brown <julian.brown@cpanel.net> - 7.3.19-2Cory McIntire <cory@cpanel.net> - 7.3.19-1Tim Mullin <tim@cpanel.net> �x�������������@������XI#�fJj - s(ds
6e�����^����������������6e5e7e�nfiguration- improved postsection
- BuildRequires readline-devel
- PreReq grep- set pool.ntp.org as the default timeserver pool- version ntp-stable-4.2.0a-20040617- added ntp-4.2.0-sbinpath.patch (bug 130536)- added ntp-stable-4.2.0a-20040616-groups.patch (bug 130112)- take chroot in account (bug 127252)- new version ntp-stable-4.2.0a-20040616
- removed most patches- rebuilt- ntpgenkey fixed (117378)
- fixed initscript to call ntpdate with -U (117894)- rebuilt- readded ntp-wait and ntptrace
- new filter-requires to prevent perl dependency- added autofoo patch- removed libmd5 dependency
- removed perl dependency- fixed initscript to use new FW chain name- 4.2.0
- added PIE- changed ntp.conf driftfile path #104207- also build as non-root- added ntpstat
- added manpages- move driftfile to /var- make a seperate directory for drift
- security fix, patch ntp-4.1.1c-rc3-authkey.patch #96927- %{_sysconfdir}/ntp/drift.TEMP needs to be writable by ntp #97754
- no duplicate fw entries #97624- changed permissions of config files- updated to rc3- rebuilt- corrected pid file name in %{_sysconfdir}/sysconfig/ntpd- update to 4.1.1rc2- better awk for timeservers #85090, #82713, #82714- added loopfilter patch, -x should work now!
- removed slew warning- ok, messed up with the versions... added epoch :(- going back to stable 4.1.1 with the limit patch
- added limit patch
- added slew warning- removed exit on ntpdate fail, better add '-g' option- update to version 4.1.73
- removed most of the patches
- limit ntp_adjtime parameters- rebuilt- updated to version 4.1.1b
- improved initscript - use ntpdate on -x
- improved initscript - open firewall only for timeservers
- ntp-4.1.1a-adjtime.patch removed (already in source)
- ntp-4.1.1a-mfp.patch removed (already in source)
- ntp-4.0.99j-vsnprintf.patch removed (already in source)- added adjtime patch #75558- more ntpd.init service description #77715- ntp-4.1.1a-mfp.patch fixes #77086- add option -n to initscript to avoid DNS lookups #72756- service should fail to start ntpd if running ntpdate fails- added two more 'echo's in the initscript- added firewall opener in initscript- removed libelf dependency
- removed stripping- automated rebuild- refixed #46464
- another genkeys/snprintf bugfix- update to version 4.1.1a- update to 4.1.1 (changes are minimal)
- more examples in default configuration- more secure default configuration (#62238)- more regex magic for the grep (#57837)- created drift with dummy value #58294
- grep for timeservers in ntp.conf also for ntpdate #57837
- check return value of ntpdate #58836- automated rebuild- added --enable-all-clocks --enable-parse-clocks (#57761)- bumped version
- fixed #57391, #44580
- set startup position to 58 after named- fixed #53184- fixed #53089 /bin/nologin -> /sbin/nologin- fixed #50247 thx to <enrico.scholz@informatik.tu-chemnitz.de>- wow, how stupid can a man be ;).. fixed #50698 
- updated to 4.1.0 (changes are small and in non-critical regions)- really, really :) fixed #52763, #50698 and #50526- rebuilt against newer libcap
- Copyright -> license- integrated droproot patch (#35653)
- removed librt and libreadline dependency- don't build build sgid root dirs- new snapshot
- removed typos and security patch (already there)
- commented multicastclient in config file- call libtoolize to compile on newer archs- remove ghost files make RHN happy
- modify initscript to match accordingly- Add the remote root exploit patch (based on ntp-hackers).
- Enhance droproot patch (more documentation, etc.) <Jarno.Huuskonen@uku.fi>
- Tweak the droproot patch to include sys/prctl.h, not linux/prctl.h
(implicit declarations)
- Remote groupdel commands, shouldn't be needed.
- Removed -Wcast-qual and -Wconversion due to excessive warnings (hackish).
- Make ntp compilable with both glibc 2.1 and 2.2.x (very dirty hack)
- Add %{_sysconfdir}/sysconfig/ntpd which drops root privs by default- security patch for ntpd- don't run configure macro twice (#32804)- require/buildprereq �x��������������X�#"fJj���������
�:����������������������:�
8�?�d���"�	.�	:�d�h�����	���������	�
���
������2(Y8`9p:6G�H�I�X�Y�\ ],^Mb�drewfzl|����
�����g�h�Ccpanel-perl-536-net-libidn0.121.cp108~el7CPAN moduleCpanel build perl module 'Net::LibIDN'b�bh-centos-7.dev.cpanel.net�Lperlcpanel/perlhttps://metacpan.orglinuxx86_64�l�Y�$�$�$b�b�b�e13bd83085f9793862deae33591f9d176ddeebc57173b1abe62a36b2a5894560d024a4106c89897ee88c1e1ecc0520c8ed9098603a0b37eec76e4efe79ebdafd729595625e2e6e1976288f9e7dc0e1e0136aa2000404f336169632839da21d65rootrootrootrootrootrootcpanel-perl-536-net-libidn-0.12-1.cp108~el7.src.rpm������������cpanel-perl(Net::LibIDN)cpanel-perl-net-libidncpanel-perl-536-net-libidncpanel-perl-536-net-libidn(x86-64)




cpanel-perl-536libidnrpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(CompressedFileNames)rpmlib(PayloadIsXz)rpmlib(TildeInVersions)4.6.0-14.0-13.0.4-15.2-14.10.0-14.11.1b�@`-@Yw2�Q+R@Busy Camels <bc@cpanel.net> - 0.12-1.cp108Busy Camels <bc@cpanel.net> - 0.12-1.cp1198Nicolas Rochelemagne <rochelemagne@cpanel.net> - 0.12-1.cp1162Todd Rinaldo <toddr@cpanel.net> - 0.12-1.cp1136- Bump to 1.cp108 for re-build- Bump to 1.cp1198 for debian re-build- Update patches: Net-LibIDN 0.12- Update from upstream: Net-LibIDN 0.120.120.120.12-1.cp108~el70.12-1.cp108~el7LibIDN.pmLibIDN.soautosplit.ix/usr/local/cpanel/3rdparty/perl/536/cpanel-lib/x86_64-linux/Net//usr/local/cpanel/3rdparty/perl/536/cpanel-lib/x86_64-linux/auto/Net/LibIDN/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches   -m64 -mtune=genericcpioxz2x86_64-redhat-linux-gnu?���2��a�^�b�b!y�հ�1e5080a04ed26a6a67fd445da391ebb51fb12e00c�VC�c�VA� �a�I�4�&�I�A�͟�ϏY����W�/8CSY���I֬��O�z�CimW޽sX)���R�Y��O85V�G$r�A�~"K��S�X	h����!C�W*�EJ�p�Mh)O@:�'��[wɿ�$��-a���B��)��I1�C�m����X-�0�y\h)��8`ՈrP<�bI��s�ͮ�����<~a�A�lO��9��e�<�*�A&�4����r��u*95"�fZ��}�a�]������y�!I�]C��51deda146139675b461d3d169847b1398a7fd36cc���-�c���ole: fix uninitialised ldisc semaphore (Don Zickus) [1232920]
- [usb] ohci: add a quirk for ULi M5237 blocking on reset (Don Zickus) [1232920]
- [usb] use *ph specifier in uss720 driver (Don Zickus) [1232920]
- [usb] use *ph specifier in mikrotek driver (Don Zickus) [1232920]
- [usb] core: buffer: smallest buffer should start at ARCH_DMA_MINALIGN (Don Zickus) [1232920]
- [usb] xhci: Add completion code to the debug ouput of unhandled transfer events (Don Zickus) [1232920]
- [usb] xhci: clean up work to remove unused parameters for functions in xhci-mem.c (Don Zickus) [1232920]
- [usb] xhci-mem: Use setup_timer (Don Zickus) [1232920]
- [usb] xhci: Use setup_timer (Don Zickus) [1232920]
- [usb] xhci: remove unused parameter 'xhci' in function xhci_handshake() (Don Zickus) [1232920]
- [usb] xhci: Clean up work to xhci_add_endpoint() (Don Zickus) [1232920]
- [usb] uas: Add US_FL_NO_ATA_1X for 2 more Seagate disk enclosures (Don Zickus) [1232920]
- [usb] uas: Do not blacklist ASM1153 disk enclosures (Don Zickus) [1232920]
- [us�x�������������0�������X�#�fJjtdrv�
`{������3e�����[����������������3e2e4e�te lengths of values in extension fields (CVE-2014-9297)
- drop packets with spoofed source address ::1 (CVE-2014-9298)
- reject packets without MAC when authentication is enabled (CVE-2015-1798)
- protect symmetric associations with symmetric key against DoS attack (CVE-2015-1799)
- fix generation of MD5 keys with ntp-keygen on big-endian systems (CVE-2015-3405)
- add option to set Differentiated Services Code Point (DSCP) (#1202828)
- add nanosecond support to SHM refclock (#1117702)
- allow creating all SHM segments with owner-only access (#1122012)
- allow different thresholds for forward and backward step (#1193154)
- allow symmetric keys up to 32 bytes again (#1191111)
- don't step clock for leap second with -x option (#1191122)
- don't drop packets with source port below 123 (#1171640)
- retry joining multicast groups (#1207014)
- increase memlock limit again (#1053569)
- warn when monitor can't be disabled due to limited restrict (#1191108)
- use larger RSA exponent in ntp-keygen (#1191116)
- fix crash in ntpq mreadvar command (#1180721)
- move sntp kod database to allow SELinux labeling (#1082934)
- fix typos in ntpd man page (#1195211)
- improve documentation of restrict command (#1213953)- don't generate weak control key for resolver (CVE-2014-9293)
- don't generate weak MD5 keys in ntp-keygen (CVE-2014-9294)
- fix buffer overflows via specially-crafted packets (CVE-2014-9295)
- don't mobilize passive association when authentication fails (CVE-2014-9296)- disable monitor in default ntp.conf (#1047856)- Mass rebuild 2014-01-24- refresh peers on routing updates (#1048132)
- fix calculation of root dispersion (#1045377)
- remove unnecessary IPv6 restrict line from default ntp.conf (#1048255)
- remove kod from default restrict in ntp.conf (#1048255)
- update logconfig documentation for patched default (#1048252)- Mass rebuild 2013-12-27- remove ControlGroup in ntpd service (#999980)
- don't build ntpsnmpd (#1015435)- ignore duplicate servers from dhclient
- don't use -Wstrict-overflow with -fno-strict-overflow
- buildrequire systemd-units
- remove pie test- workaround failing autogen
- move files from /lib
- don't own ntp-units.d directory
- drop old systemd scriptlets
- fix dates in changelog- avoid rereading /etc/services (#768804)
- remove ntp-wait dependency from ntpd service (#906753)
- add missing and remove unrecognized options in documentation
- update comments in some config files- Rebuilt for https://fedoraproject.org/wiki/Fedora_19_Mass_Rebuild- compile with -fno-strict-overflow- add option to set identity modulus size in ntp-keygen- allow selection of cipher for private key files
- set identity modulus size in ntp-keygen
- create sntp subpackage
- add sntp service
- use system libopts
- add Wants=ntp-wait.service to ntpd service
- don't fail when /etc/sysconfig/ntpd is missing
- modify mlock and multiopts patches to use autogen
- make perl subpackage noarch- bind broadcast client to new interfaces (#722690)
- decode hex encoded passwords in ntpq/ntpdc
- remove sample MD5 keys from default keys config- fix crash in FIPS mode (#839280)
- use systemd macros if available (#850235)
- remove obsolete macros- start ntpdate service after nss-lookup.target (#837486)
- update systemd-timedated integration (#846077)- Rebuilt for https://fedoraproject.org/wiki/Fedora_18_Mass_Rebuild- update service file for systemd-timedated-ntp target (#816495)
- allow service to set realtime scheduler (#810801)
- drop comment enabling local driver in default config- update to 4.2.6p5
- switch service type to forking- add default servers to step-tickers (#772389)
- enable PrivateTmp in ntpd service (#782520)- Rebuilt for https://fedoraproject.org/wiki/Fedora_17_Mass_Rebuild- update to 4.2.6p4
- buildrequire pps-tools-devel
- fix errors in ntpstat found by coverity- Rebuilt for rpm (#728707)- drop SysV init scripts (#697526, #714705)
- add ntp-wait service- fix systemd scriplets to properly handle upgrades- pull in time-sync.target from ntpdate.service (Lennart Poettering)
- link�x����������������������XP#�gJjchdo�i
��������o��������������������ommit that last fix correctly this time- fix incorrect use of find when attempting to detect a common permissions
  error in the init script (#114866)- add bug fix patch for DB 4.2.52- change logging facility used from daemon to local4 (#112730, reversing #11047)
  BEHAVIOR CHANGE - SHOULD BE MENTIONED IN THE RELEASE NOTES.- incorporate fix for logic quasi-bug in slapd's SASL auxprop code (Dave Jones)- update to 2.1.25, now marked STABLE- update to db-4.2.52.- add another section to the ABI note for the TLS libdb so that it's marked as
  not needing an executable stack (from Arjan Van de Ven)- force bundled libdb to not use O_DIRECT by making it forget that we have it- build bundled libdb for slapd dynamically to make the package smaller,
  among other things
- on tls-capable arches, build libdb both with and without shared posix
  mutexes, otherwise just without
- disable posix mutexes unconditionally for db 4.0, which shouldn't need
  them for the migration cases where it's used
- update to MigrationTools 45- upgrade db-4.1.25 to db-4.2.42.- drop rfc822-MailMember.schema, merged into upstream misc.schema at some point- actually require newer libtool, as was intended back in 2.1.22-0, noted as
  missed by Jim Richardson- enable rlookups, they don't cost anything unless also enabled in slapd's
  configuration file- rebuild- rebuild- rebuild- build- 2.1.22 now badged stable
- be more aggressive in what we index by default
- use/require libtool 1.5- update to 2.1.22- rebuilt- update to 2.1.21
- enable ldap, meta, monitor, null, rewrite in slapd- update to 2.1.20- update to 2.1.19- switch to db with crypto- install the db utils for the bundled libdb as %{_sbindir}/slapd_db_*
- install slapcat/slapadd from 2.0.x for migration purposes- update to 2.1.17
- disable the shell backend, not expected to work well with threads
- drop the kerberosSecurityObject schema, the krbName attribute it
  contains is only used if slapd is built with v2 kbind support- back down to db 4.0.x, which 2.0.x can compile with in ldbm-over-db setups
- tweak SuSE patch to fix a few copy-paste errors and a NULL dereference- rebuilt- rebuild- rebuild- check for setgid as well- rebuild- incorporate fixes from SuSE's security audit, except for fixes to ITS 1963,
  1936, 2007, 2009, which were included in 2.0.26.
- add two more patches for db 4.1.24 from sleepycat's updates page
- use openssl pkgconfig data, if any is available- add patches for db 4.1.24 from sleepycat's updates page- add a sample TLSCACertificateFile directive to the default slapd.conf- update to 2.0.27- update to 2.0.26, db 4.1.24.NC- change LD_FLAGS to refer to /usr/kerberos/_libdir instead of
  /usr/kerberos/lib, which might not be right on some arches- update to 2.0.25 "stable", ldbm-over-gdbm (putting off migration of LDBM
  slapd databases until we move to 2.1.x)
- use %{_smp_mflags} when running make
- update to MigrationTools 44
- enable dynamic module support in slapd- rebuild in new environment- use the gdbm backend again- make slapd.conf read/write by root, read by ldap- fix corner case in sendbuf fix
- 2.0.23 now marked "stable"- update to 2.0.23- switch to an internalized Berkeley DB as the ldbm back-end  (NOTE: this breaks
  access to existing on-disk directory data)
- add slapcat/slapadd with gdbm for migration purposes
- remove Kerberos dependency in client libs (the direct Kerberos dependency
  is used by the server for checking {kerberos} passwords)- update to 2.0.22- prereq chkconfig for server subpackage- update migration tools to version 40- free ride through the build system- update to 2.0.21, now earmarked as STABLE- temporarily disable optimizations for ia64 arches
- specify pthreads at configure-time instead of letting configure guess- and one for Raw Hide- build for RHL 7/7.1- update to 2.0.20 (security errata)- update to 2.0.19- fix the commented-out replication example in slapd.conf- update to 2.0.18- update to 2.0.17- disable kbind support (deprecated, and I suspect unused)
- co@x������������������@�8��������������������X�#ngJj�������@�������3Q�����[����������������3Q�:�l-lib/DateTime/Format//usr/local/cpanel/3rdparty/perl/536/cpanel-lib/DateTime/Format/Strptime/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches   -m64 -mtune=genericcpioxz2noarch-redhat-linux-gnu?���>\�/,꼒�@���.�#�@02876dcc269af2fc8841117235b7190bd64347a7c�VC�Dc�VA libc-client bump- Rebuild for openssl bump- update to 5.2.5- correct pcre BR version (#333021)
- restore metaphone fix (#205714)
- add READMEs to php-cli- update to 5.2.4- rebuild for fixed APR- add ldconfig post/postun for -embedded (Hans de Goede)- add php-embedded sub-package- fix build with new glibc
- fix License- define php_extdir in macros.php- obsolete php-dbase- add mcrypt, mhash, tidy, mssql subpackages (Dmitry Butskoy)
- enable dbase extension and package in -common- update to 5.2.3 (thanks to Jeff Sheltren)- fix php-pdo *_arg_force_ref global symbol abuse (#216125)- rebuild against uw-imap-devel- update to 5.2.2
- synch changes from upstream recommended php.ini- enable SASL support in LDAP extension (#205772)- drop mime_magic extension (deprecated by php-pecl-Fileinfo)- fix regression in str_{i,}replace (from upstream)- update to 5.2.1
- add Requires(pre) for httpd
- trim %changelog to versions >= 5.0.0- bump default memory_limit to 32M (#220821)
- mark config files noreplace again (#174251)
- drop trailing dots from Summary fields
- use standard BuildRoot
- drop libtool15 patch (#226294)- add php(api), php(zend-abi) provides (#221302)
- package /usr/share/php and append to default include_path (#225434)- fix filter.h installation path
- fix php-zend-abi version (Remi Collet, #212804)- rebuild again- rebuild for net-snmp soname bump- build json and zip shared, in -common (Remi Collet, #215966)
- obsolete php-json and php-pecl-zip
- build readline extension into /usr/bin/php* (#210585)
- change module subpackages to require php-common not php (#177821)- provide php-zend-abi (#212804)
- add /etc/rpm/macros.php exporting interface versions
- synch with upstream recommended php.ini- update to 5.2.0 (#213837)
- php-xml provides php-domxml (#215656)
- fix php-pdo-abi provide (#214281)- rebuild for curl soname bump
- add build fix for curl 7.16 API- from upstream: add safety checks against integer overflow in _ecalloc- update to 5.1.6 (security fixes)
- bump default memory_limit to 16M (#196802)- rebuild- Provide php-posix (#194583)
- only provide php-pcntl from -cli subpackage
- add missing defattr's (thanks to Matthias Saou)- move Obsoletes for php-openssl to -common (#194501)
- Provide: php-cgi from -cli subpackage- split out php-cli, php-common subpackages (#177821)
- add php-pdo-abi version export (#193202)- rebuilt for new libnetsnmp- provide mod_php (#187891)
- provide php-cli (#192196)
- use correct LDAP fix (#181518)
- define _GNU_SOURCE in php_config.h and leave it defined
- drop (circular) dependency on php-pear- update to 5.1.4- update to 5.1.3- provide php-api (#183227)
- add provides for all builtin modules (Tim Jackson, #173804)
- own %{_libdir}/php/pear for PEAR packages (per #176733)
- add obsoletes to allow upgrade from FE4 PDO packages (#181863)- bump again for double-long bug on ppc(64)- rebuilt for new gcc4.1 snapshot and glibc changes- rebuild for new libc-client soname- only build xmlreader and xmlwriter shared (#177810)- update to 5.1.2- rebuild again- rebuild for new net-snmp- enable short_open_tag in default php.ini again (#175381)- rebuilt- require net-snmp for php-snmp (#174800)- add /usr/share/pear back to hard-coded include_path (#174885)- rebuild for httpd 2.2- update to 5.1.1
- remove pear subpackage
- enable pdo extensions (php-pdo subpackage)
- remove non-standard conditional module builds
- enable xmlreader extension- rebuilt against new openssl- pear: update to XML_RPC 1.4.4, XML_Parser 1.2.7, Mail 1.1.9 (#172528)- rebuild for new libnetsnmp- update to 5.0.5
- add fix for upstream #34435
- devel: require autoconf, automa�x�������������X��������X#]fJj) [1���������������������������������������- remove workarounds for old bug in SLsmg_write_nstring
- improve SIGWINCH handling in form
- don't abort from whiptail gauge on SIGWINCH
- redisplay also last line
- update Polish translation (Piotr Drąg)
- update URL and Source tag- Autorebuild for GCC 4.3- enable slang utf8 mode (#425992)
- support --disable-nls option (patch by Natanael Copa)
- redraw screen when using entry in euc encodings- fix segfault in whiptail when no entry is selected in radiolist
- buildrequire popt-devel- rebuild- add back support for list of Entries in EntryWindow prompts in snack
  (#248878)
- update license tag
- split python module to -python subpackage (patch by Yanko Kaneti)
- fix summary- add support to snack for multiple selection and border in listbox
  and cursorAtEnd in entry (patch by Shawn Starr)
- fix scrollbar positioning in listbox
- cope with backward system time jumps (#240691)
- free helplines and windows in newtFinished, check for overflow (#239992)
- add release to -devel and -static requires (#238784)- fix cursor positioning when setting entry or checkbox flags
- fix counting of items in checkboxtree
- fix some memory leaks- fix entry scrolling (#234829)
- fix multibyte character handling in entry- add newtSetColor() to allow changing individual colors
- add newtPopWindowNoRefresh() (patch by Forest Bond)
- move static library to -static subpackage, spec cleanup (#226195)
  (patch by Jason Tibbitts)- provide option to change text of buttons (#126768)
- don't add escape key to hot keys by default (#216157)
- fix cursor position in checkboxtree, radio button and checkbox
- don't force monochrome terminals to output colors
- highlight active compact button on monochrome terminals
- update translations from debian- fix memory allocation in snack to be consistent (#212780)- rebuild for python 2.5- fix entry corruption when reading multibyte characters
  and double width character handling
- avoid overflow/crash in scale
- patches from debian
  - fix crash of snack in EntryWindow when prompts is list of tuples
  - put cursor at beginning of text for better accessibility
    in button, scale and textbox
  - add topleft option to whiptail- makefile, configure and spec cleanup
- package whiptail.1 and locale files
- fix warnings- fix screen corruption when half of double width character is overwritten
  (#137957) 
- fix double width character handling in checkboxtree and listbox- rebuild- unfocus when displaying help
- fix help dialog in popcorn.py (#81352)- fix checkboxtree positioning
- make textbox with scrollbar focusable (#83203)
- turn off cursor when entry terminated form (#86074)
- handle listbox and checkboxtree focus better (#186053)
- make default colors more friendly to 8-color terminals (#187545)- fix handling windows larger than screen size (#189981)- bump again for double-long bug on ppc(64)- rebuilt for new gcc4.1 snapshot and glibc changes- Fix a crash in checkboxtree.c where pressing pgup/pgdown
  on a checkboxtree with less items than its height would
  cause segmentation violation. Consult BR 165347.- Apply patch by Bill Nottingham (thanks) to improve scrollbar appearance
  (BR 174771).
- Add -%{release} to snack's Provides: line (just in case).- Provide: snack = %{version} instead of plain "snack", so that
  we don't block upgrades of custom "snack" packages. This should
  not break anything. (Hopefully) fixes BR 171415.- do not build whiptcl, as per 177346 -- so that we avoid dependency on tcl- rebuilt- rebuild because of the new slang-2.0.5- new upstream version (minor fixes for the source tarball
  and build system)- revert bidi patch, objections by Jeremy Katz about
  anaconda breaking
- this version still only exists as a "ghastly" upstream tarball;
  the patches are now cleaned up and will be integrated into
  rhlinux cvs unless some more breakage akin to bidi occurs
- the if1close patch is now part of upstream tarball too- new upstream version- use versioned symbols, patch by Alastair McKinstry, mckinstry at
  debian dot org, thanks
- need pri�x�������������Є�������XJ#XgJjto g���C�����#�����������������C�C�K$ ?Dd����	 �	X���������������	�(�B�H�O3���	
 X�
��2x���
	 
	�
(
8
9
�:
=
?@G(H`I�X�Y�\�]�^�b�dXe]f`lbt|u�v�w(x`y�	���8�@TX6!�!�6
#��$$$g$h$Ccloudlinux-linksafe15.2.el7Utility to configure Links Traversal Protection featureConfiguration utility for Links Traversal Protection featurec
�buildfarm05.corp.cloudlinux.com*�CloudLinuxCloudLinuxGPLCloudLinux Packaging Team <packager@cloudlinux.com>System Environment/Kernelhttp://www.cloudlinux.comlinuxnoarchif [ -f /etc/cloudlinux-edition-solo ] || [ -f /etc/cloudlinux-container ]; then
    exit 0
fi
if [ $1 -eq 1 ]; then
    getent group linksafe &> /dev/null
    if [ $? -ne 0 ]; then
        groupadd -r linksafe
    fi
fi
exit 0/usr/share/cloudlinux-linksafe/scriptlets/rpm_preun.sh $1 /etc/cloudlinux-edition-solo /etc/cloudlinux-container
exit 0if [ -f /etc/cloudlinux-edition-solo ] || [ -f /etc/cloudlinux-container ]; then
    exit 0
fi
if [ $1 -eq 0 ]; then
    getent group linksafe >/dev/null
    if [ $? -eq 0 ]; then
        groupdel linksafe
    fi
    rm -f /etc/sysctl.d/cloudlinux-linksafe.conf
    for option in protected_symlinks_create protected_hardlinks_create protected_symlinks_allow_gid protected_hardlinks_allow_gid; do
        if [ -e "/proc/sys/fs/$option" ]; then
            echo 0 > "/proc/sys/fs/$option"
        fi
    done
fi
exit 0�*OV��0�,A�����A�A�A����A�m�mc
�c
��c
��c
��c
��c
�c
�c
�c
��c
��c
��c
�c
�c
�c771379b2e284249617f39d110d2548d53e7cc909704c243214911237afd7483958b863bf542cc1b6f8bfdfa576f6cfd4f23c279ae3b27d3d58dc5f46e876a91b3ce532a2772e2125aeb17487697e43cc0100d74b0bac3e683b0a615e14eff6badb831585e1b1b117afa1fea4506a7b01532970e9854bd4c26077b6a90e226966b9028b329052a141353bf35ce404a1fe986c35968eddecc1c6811c97f5cac483329a4cf977c1ae65b8ba8a30a0b9c31e386c584be8f8d07f3a79d71b49bb636eb14c6468ca48fae5ad7780305e29b8634c95b9fe07c17a2a200681fa6edb8d7479820d6699193c560d3e66893f473d0043d1940ca7d565b3bc138ec5052ff89a2c4ff1b91db74e67884e0383ec59d6640531b27bf74018413cf89ddb66e257drootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootcloudlinux-linksafe-1-5.2.el7.src.rpm��������������������������������������������������������cloudlinux-linksafe@ 	



/bin/bash/bin/bash/bin/bash/bin/sh/bin/sh/bin/sh/bin/shrpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)shadow-utilsshadow-utilsrpmlib(PayloadIsXz)3.0.4-14.6.0-14.0-15.2-14.11.3c�@b���`�\�`��^�_�^oj@^M#@\o�@Yy�YC�@X�f@X�Y�X,J@W�_@W��@W�^@W��W��W{�@Vɦ�VŲ@VŲ@VŲ@VŲ@V��V�@VA�@V<�@V7P@V2
@alutsiuk <alutsiuk@cloudlinux.com> - 1-5.1Sergey Fokin <sfokin@cloudlinux.com> - 1-4.2Oleksandr Shyshatskyi <oshyshatskyi@cloudlinux.com> - 1-3.2Danylo Kuropiatnyk <dkurop�x�������������Ht�������X�#DgJjiles�r
�~������x0���������������������x0w0��e of places where they're expected- update to 1.6.1
  - drop no-longer-needed patches for CVE-2007-0956,CVE-2007-0957,CVE-2007-1216
  - drop patch for sendto bug in 1.6, fixed in 1.6.1- kadmind.init: don't fail outright if the default principal database
  isn't there if it looks like we might be using the kldap plugin
- kadmind.init: attempt to extract the key for the host-specific kadmin
  service when we try to create the keytab- omit dependent libraries from the krb5-config --libs output, as using
  shared libraries (no more static libraries) makes them unnecessary and
  they're not part of the libkrb5 interface (patch by Rex Dieter, #240220)
  (strips out libkeyutils, libresolv, libdl)- pull in keyutils as a build requirement to get the "KEYRING:" ccache type,
  because we've merged- fix an uninitialized length value which could cause a crash when parsing
  key data coming from a directory server
- correct a typo in the krb5.conf man page ("ldap_server"->"ldap_servers")- move the default acl_file, dict_file, and admin_keytab settings to
  the part of the default/example kdc.conf where they'll actually have
  an effect (#236417)- merge security fixes from RHSA-2007:0095- add patch to correct unauthorized access via krb5-aware telnet
  daemon (#229782, CVE-2007-0956)
- add patch to fix buffer overflow in krb5kdc and kadmind
  (#231528, CVE-2007-0957)
- add patch to fix double-free in kadmind (#231537, CVE-2007-1216)- back out buildrequires: keyutils-libs-devel for now- add buildrequires: on keyutils-libs-devel to enable use of keyring ccaches,
  dragging keyutils-libs in as a dependency- fix bug ID in changelog* Thu Mar 15 2007 Nalin Dahyabhai <nalin@redhat.com> 1.5-21
- add preliminary patch to fix buffer overflow in krb5kdc and kadmind
  (#231528, CVE-2007-0957)
- add preliminary patch to fix double-free in kadmind (#231537, CVE-2007-1216)- add patch to build semi-useful static libraries, but don't apply it unless
  we need them- temporarily back out %post changes, fix for #143289 for security update
- add preliminary patch to correct unauthorized access via krb5-aware telnet- make profile.d scriptlets mode 644 instead of 755 (part of #225974)- clean up quoting of command-line arguments passed to the krsh/krlogin
  wrapper scripts- initial update to 1.6, pre-package-reorg
- move workstation daemons to a new subpackage (#81836, #216356, #217301), and
  make the new subpackage require xinetd (#211885)- make use of install-info more failsafe (Ville Skyttä, #223704)
- preserve timestamps on shell scriptlets at %install-time- move to using pregenerated PDF docs to cure multilib conflicts (#222721)- update backport of the preauth module interface (part of #194654)- apply fixes from Tom Yu for MITKRB5-SA-2006-002 (CVE-2006-6143) (#218456)
- apply fixes from Tom Yu for MITKRB5-SA-2006-003 (CVE-2006-6144) (#218456)- update backport of the preauth module interface- update backport of the preauth module interface
- add proposed patches 4566, 4567
- add proposed edata reporting interface for KDC
- add temporary placeholder for module global context fixes- don't bail from the KDC init script if there's no database, it may be in
  a different location than the default (fenlason)
- remove the [kdc] section from the default krb5.conf -- doesn't seem to have
  been applicable for a while- rename krb5.sh and krb5.csh so that they don't overlap (#210623)
- way-late application of added error info in kadmind.init (#65853)- add backport of in-development preauth module interface (#208643)- provide docs in PDF format instead of as tex source (Enrico Scholz, #209943)- add missing shebang headers to krsh and krlogin wrapper scripts (#209238)- set SS_LIB at configure-time so that libss-using apps get working readline
  support (#197044)- switch to the updated patch for MITKRB-SA-2006-001- apply patch to address MITKRB-SA-2006-001 (CVE-2006-3084)- ensure that the gssapi library's been initialized before walking the
  internal mechanism list in gss_release_oid(), needed if called from
�x��������������c�������X�#�gJj- [s��xo�������S����������������������S�S<k�<emaldona@redhat.com> - 3.15.2-4Elio Maldonado <emaldona@redhat.com> - 3.15.2-3Elio Maldonado <emaldona@redhat.com> - 3.15.2-2Elio Maldonado <emaldona@redhat.com> - 3.15.2-1Elio Maldonado <emaldona@redhat.com> - 3.15.1-4Elio Maldonado <emaldona@redhat.com> - 3.15.1-3Elio Maldonado <emaldona@redhat.com> - 3.15.1-2Elio Maldonado <emaldona@redhat.com> - 3.15.1-2Elio Maldonado <emaldona@redhat.com> - 3.15-6Elio Maldonado <emaldona@redhat.com> - 3.15-5emaldona <emaldona@redhat.com> - 3.15-4emaldona <emaldona@redhat.com> - 3.15-3Elio Maldonado <emaldona@redhat.com> - 3.15-2Elio Maldonado <emaldona@redhat.com> - 3.15-1Elio Maldonado <emaldona@redhat.com> - 3.14.3-13.0Kai Engert <kaie@redhat.com> - 3.14.3-12.0Kai Engert <kaie@redhat.com> - 3.14.3-11Kai Engert <kaie@redhat.com> - 3.14.3-10Kai Engert <kaie@redhat.com> - 3.14.3-9Elio Maldonado <emaldona@redhat.com> - 3.14.3-1Elio Maldonado <emaldona@redhat.com> - 3.14.2-2Elio Maldonado <emaldona@redhat.com> - 3.14.2-1Kai Engert <kaie@redhat.com> - 3.14.1-3Elio Maldonado <emaldona@redhat.com> - 3.14.1-2Elio Maldonado <emaldona@redhat.com> - 3.14.1-1Elio Maldonado <emaldona@redhat.com> - 3.14-12Elio Maldonado <emaldona@redhat.com> - 3.14-11Elio Maldonado <emaldona@redhat.com> - 3.14-10Elio Maldonado <emaldona@redhat.com> - 3.14-9Elio Maldonado <emaldona@redhat.com> - 3.14-8Elio Maldonado <emaldona@redhat.com> - 3.14-7Elio Maldonado <emaldona@redhat.com> - 3.14-6Elio Maldonado <emaldona@redhat.com> - 3.14-5Elio Maldonado <emaldona@redhat.com> - 3.14-4Elio Maldonado <emaldona@redhat.com> - 3.14-3Elio Maldonado <emaldona@redhat.com> - 3.14-2Elio Maldonado <emaldona@redhat.com> - 3.14-1Elio Maldonado <emaldona@redhat.com> - 3.14-0.1.rc.1Kai Engert <kaie@redhat.com> - 3.13.6-1Elio Maldonado <emaldona@redhat.com> - 3.13.5-8Elio Maldonado <emaldona@redhat.com> - 3.13.5-7Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 3.13.5-6Elio Maldonado <emaldona@redhat.com> - 3.13.5-5Elio Maldonado <emaldona@redhat.com> - 3.13.5-4Elio Maldonado <emaldona@redhat.com> - 3.13.5-3Elio Maldonado <emaldona@redhat.com> - 3.13.5-2Elio Maldonado <emaldona@redhat.com> - 3.13.5-1Elio Maldonado <emaldona@redhat.com> - 3.13.4-3Elio Maldonado <emaldona@redhat.com> - 3.13.4-2Elio Maldonado <emaldona@redhat.com> - 3.13.4-1Elio Maldonado <emaldona@redhat.com> - 3.13.3-4Elio Maldonado <emaldona@redhat.com> - 3.13.3-3Elio Maldonado <emaldona@redhat.com> - 3.13.3-2Elio Maldonado <emaldona@redhat.com> - 3.13.3-1Tom Callaway <spot@fedoraproject.org> - 3.13.1-13Elio Maldonado <emaldona@redhat.com> - 3.13.1-12Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 3.13.1-11Elio Maldonado <emaldona@redhat.com> - 3.13.1-11Elio Maldonado <emaldona@redhat.com> - 3.13.1-10elio maldonado <emaldona@redhat.com> - 3.13.1-9Elio Maldonado <emaldona@redhat.com> - 3.13.1-8Elio Maldonado <emaldona@redhat.com> - 3.13.1-7Elio Maldonado <emaldona@redhat.com> - 3.13.1-6Elio Maldonado <emaldona@redhat.com> - 3.13.1-5Elio Maldonado Batiz <emaldona@redhat.com> - 3.13.1-4Elio Maldonado <emaldona@redhat.com> - 3.13.1-2Elio Maldonado <emaldona@redhat.com> - 3.13.1-1Elio Maldonado <emaldona@redhat.com> - 3.13-1Elio Maldonado <emaldona@redhat.com> - 3.13-0.1.rc0.1Elio Maldonado <emaldona@redhat.com> - 3.12.11-3Kai Engert <kaie@redhat.com> - 3.12.11-2Elio Maldonado <emaldona@redhat.com> - 3.12.11-1Elio Maldonado <emaldona@redhat.com> - 3.12.10-6Michael Schwendt <mschwendt@fedoraproject.org> - 3.12.10-5Elio Maldonado <emaldona@redhat.com> - 3.12.10-4Dennis Gilmore <dennis@ausil.us> - 3.12.10-3Elio Maldonado <emaldona@redhat.com> - 3.12.10-2Elio Maldonado <emaldona@redhat.com> - 3.12.10-1Elio Maldonado <emaldona@redhat.com> - 3.12.10-0.1.beta1Elio Maldonado <emaldona@redhat.com> - 3.12.9-15Elio Maldonado <emaldona@redhat.com> - 3.12.9-14Elio Maldonado <emaldona@redhat.com> - 3.12.9-13Elio Maldonado <emaldona@redhat.com> - 3.12.9-12Elio Maldonado <emaldona@redhat.com> - 3.12.9-11Elio Maldonado <emaldona@redhat.com> - 3.12.9-10�x�������������8S�������X#wfJjini)�����;�����f�����������������;�;�;�>�@>��=�z@=�y@=b/@=@<��<O�@<<0�<2�@;���;Uz@;A��;33@;&@:��@:Z�@:Pq@:E�@:3p@:,�:X@:z�9�y�9�
@9v�9l]�9H�@9C@8t��Kamil Dudka <kdudka@redhat.com> - 0.12-0.37.pre6Daniel Mach <dmach@redhat.com> - 0.12-0.36.pre6Daniel Mach <dmach@redhat.com> - 0.12-0.35.pre6Kamil Dudka <kdudka@redhat.com> - 0.12-0.34.pre6Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 0.12-0.33.pre5Kamil Dudka <kdudka@redhat.com> - 0.12-0.32.pre5Kamil Dudka <kdudka@redhat.com> - 0.12-0.31.pre5Kamil Dudka <kdudka@redhat.com> - 0.12-0.30.pre5Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 0.12-0.29.pre5Kamil Dudka <kdudka@redhat.com> - 0.12-0.28.pre5Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 0.12-0.27.pre5Kamil Dudka <kdudka@redhat.com> - 0.12-0.26.pre5Kamil Dudka <kdudka@redhat.com> - 0.12-0.25.pre5Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 0.12-0.24.pre5Kamil Dudka <kdudka@redhat.com> - 0.12-0.23.pre5Kamil Dudka <kdudka@redhat.com> - 0.12-0.22.pre5Kamil Dudka <kdudka@redhat.com> 0.12-0.21.pre5Ondrej Vasik <ovasik@redhat.com> 0.12-0.20.pre5Orion Poplawski <orion@cora.nwra.com> 0.12-0.19.pre5Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 0.12-0.18.pre5Ondrej Vasik <ovasik@redhat.com> 0.12-0.17.pre5Ondrej Vasik <ovasik@redhat.com> 0.12-0.16.pre4Kamil Dudka <kdudka@redhat.com> 0.12-0.15.pre3Ondrej Vasik <ovasik@redhat.com> 0.12-0.14.pre3Kamil Dudka <kdudka@redhat.com> 0.12-0.13.pre3Ondrej Vasik <ovasik@redhat.com> 0.12-0.12.pre3Ondrej Vasik <ovasik@redhat.com> 0.12-0.11.pre3Ondrej Vasik <ovasik@redhat.com> 0.12-0.10.pre2Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 0.12-0.9.pre2Tomas Mraz <tmraz@redhat.com> 0.12-0.8.pre2Ondrej Vasik <ovasik@redhat.com> 0.12-0.7.pre2Kamil Dudka <kdudka@redhat.com> 0.12-0.6.pre2Ondrej Vasik <ovasik@redhat.com> 0.12-0.5.pre2Ondrej Vasik <ovasik@redhat.com> 0.12-0.4.pre1Ondrej Vasik <ovasik@redhat.com> 0.12-0.3.pre1Ondrej Vasik <ovasik@redhat.com> 0.12-0.2.pre1Ondrej Vasik <ovasik@redhat.com> 0.12-0.1.pre1Ondrej Vasik <ovasik@redhat.com> 0.11.4-1Ondrej Vasik <ovasik@redhat.com> 0.11.4-0.4.rc1Ondrej Vasik <ovasik@redhat.com> 0.11.4-0.3.rc0Ondrej Vasik <ovasik@redhat.com> 0.11.4-0.2.rc0Ondrej Vasik <ovasik@redhat.com> 0.11.4-0.1.rc0Ondrej Vasik <ovasik@redhat.com> 0.11.3-7Ondrej Vasik <ovasik@redhat.com> 0.11.3-6Ondrej Vasik <ovasik@redhat.com> 0.11.3-5Ondrej Vasik <ovasik@redhat.com> 0.11.3-4Ondrej Vasik <ovasik@redhat.com> 0.11.3-3Ondrej Vasik <ovasik@redhat.com> 0.11.3-2Ondrej Vasik <ovasik@redhat.com> 0.11.3-1Karel Zak <kzak@redhat.com> 0.11.2-1Karel Zak <kzak@redhat.com> 0.11.1-5Jesse Keating <jkeating@redhat.com> - 0.11.1-4.1Karel Zak <kzak@redhat.com> 0.11.1-4Karel Zak <kzak@redhat.com> 0.11.1-3Karel Zak <kzak@redhat.com> 0.11.1-2Karsten Hopp <karsten@redhat.de> 0.11.0-3Jesse Keating <jkeating@redhat.com> - 0.11.0-2.2Jesse Keating <jkeating@redhat.com> - 0.11.0-2.1Karel Zak <kzak@redhat.com> 0.11.0-2Karel Zak <kzak@redhat.com> 0.11.0-1Jesse Keating <jkeating@redhat.com> 0.10.6-2.1Karel Zak <kzak@redhat.com> 0.10.6-2Karel Zak <kzak@redhat.com> 0.10.6-1Karel Zak <kzak@redhat.com> 0.10.3-3Miloslav Trmac <mitr@redhat.com> - 0.10.3-2Karel Zak <kzak@redhat.com> 0.10.3-1Karel Zak <kzak@redhat.com> 0.10.2-2Karel Zak <kzak@redhat.com> 0.10.2-1Karel Zak <kzak@redhat.com> 0.10.1-1Karel Zak <kzak@redhat.com> 0.9.2-2Karel Zak <kzak@redhat.com> 0.9.2-1Jindrich Novy <jnovy@redhat.com> 0.9.2-0.rc7.4Tim Waugh <twaugh@redhat.com> 0.9.2-0.rc4.3Tim Waugh <twaugh@redhat.com> 0.9.2-0.rc4.2Tim Waugh <twaugh@redhat.com> 0.9.2-0.rc2.2Tim Waugh <twaugh@redhat.com> 0.9.2-0.rc2.1Elliot Lee <sopwith@redhat.com>Tim Waugh <twaugh@redhat.com> 0.9.1-3Tim Waugh <twaugh@redhat.com> 0.9.1-2Tim Waugh <twaugh@redhat.com> 0.9.1-1Elliot Lee <sopwith@redhat.com>Tim Waugh <twaugh@redhat.com> 0.4.3-1Tim Waugh <twaugh@redhat.com> 0.4.2-7.1Tim Waugh <twaugh@redhat.com> 0.4.2-7Nalin Dahyabhai <nalin@redhat.com> 0.4.2-6.2Tim Waugh <twaugh@redhat.com> 0.4.2�x��������������B�������Xl#�gJj[net`������� 

������b����������������
�	�dCOPYRIGHTLICENSEldap.conf.5ldif.5/opt/alt/openldap11/etc//opt/alt/openldap11/etc/openldap//opt/alt/openldap11/lib64//opt/alt/openldap11/libexec//opt/alt/openldap11/share/doc//opt/alt/openldap11/share/doc/alt-openldap11-2.4.46//opt/alt/openldap11/share/licenses//opt/alt/openldap11/share/licenses/alt-openldap11-2.4.46//opt/alt/openldap11/share/man/man5/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1  -m64 -mtune=genericcpioxz2x86_64-redhat-linux-gnu?����Kt������e���QW���F_Y
	�U�b��qX�3	�����[�G�K������?��{@ I
t���໋7�F_Y
	�U�b��q#}�QM�������Xƺ�wz��T�$6bn�kY�s�9���#�bc1e4f04bd430a604e2cbea63821ec0c043f72d3ctZ��ctZ�mp_dh.3SSL_set_tmp_dh_callback.3SSL_set_verify.3SSL_set_verify_depth.3SSL_set_verify_result.3SSL_set_wfd.3SSL_shutdown.3SSL_state_string.3SSL_state_string_long.3SSL_stateless.3SSL_up_ref.3SSL_use_PrivateKey.3SSL_use_PrivateKey_ASN1.3SSL_use_PrivateKey_file.3SSL_use_RSAPrivateKey.3SSL_use_RSAPrivateKey_ASN1.3SSL_use_RSAPrivateKey_file.3SSL_use_cert_and_key.3SSL_use_certificate.3SSL_use_certificate_ASN1.3SSL_use_certificate_chain_file.3SSL_use_certificate_file.3SSL_use_psk_identity_hint.3SSL_verify_cb.3SSL_verify_client_post_handshake.3SSL_version.3SSL_waiting_for_async.3SSL_want.3SSL_want_async.3SSL_want_async_job.3SSL_want_client_hello_cb.3SSL_want_nothing.3SSL_want_read.3SSL_want_write.3SSL_want_x509_lookup.3SSL_write.3SSL_write_early_data.3SSL_write_ex.3SSLv23_client_method.3SSLv23_method.3SSLv23_server_method.3SSLv3_client_method.3SSLv3_method.3SSLv3_server_method.3SXNETID_free.3SXNETID_new.3SXNET_free.3SXNET_new.3TLS_FEATURE_free.3TLS_FEATURE_new.3TLS_client_method.3TLS_method.3TLS_server_method.3TLSv1_1_client_method.3TLSv1_1_method.3TLSv1_1_server_method.3TLSv1_2_client_method.3TLSv1_2_method.3TLSv1_2_server_method.3TLSv1_client_method.3TLSv1_method.3TLSv1_server_method.3TS_ACCURACY_dup.3TS_ACCURACY_free.3TS_ACCURACY_new.3TS_MSG_IMPRINT_dup.3TS_MSG_IMPRINT_free.3TS_MSG_IMPRINT_new.3TS_REQ_dup.3TS_REQ_free.3TS_REQ_new.3TS_RESP_dup.3TS_RESP_free.3TS_RESP_new.3TS_STATUS_INFO_dup.3TS_STATUS_INFO_free.3TS_STATUS_INFO_new.3TS_TST_INFO_dup.3TS_TST_INFO_free.3TS_TST_INFO_new.3UI.3UI_METHOD.3UI_OpenSSL.3UI_STRING.3UI_UTIL_read_pw.3UI_UTIL_read_pw_string.3UI_UTIL_wrap_read_pem_callback.3UI_add_error_string.3UI_add_info_string.3UI_add_input_boolean.3UI_add_input_string.3UI_add_user_data.3UI_add_verify_string.3UI_construct_prompt.3UI_create_method.3UI_ctrl.3UI_destroy_method.3UI_dup_error_string.3UI_dup_info_string.3UI_dup_input_boolean.3UI_dup_input_string.3UI_dup_user_data.3UI_dup_verify_string.3UI_free.3UI_get0_action_string.3UI_get0_output_string.3UI_get0_result.3UI_get0_result_string.3UI_get0_test_string.3UI_get0_user_data.3UI_get_default_method.3UI_get_ex_data.3UI_get_ex_new_index.3UI_get_input_flags.3UI_get_method.3UI_get_result_length.3UI_get_result_maxsize.3UI_get_result_minsize.3UI_get_result_string_length.3UI_get_string_type.3UI_method_get_closer.3UI_method_get_data_destructor.3UI_method_get_data_duplicator.3UI_method_get_ex_data.3UI_method_get_flusher.3UI_method_get_opener.3UI_method_get_prompt_constructor.3UI_method_get_reader.3UI_method_get_writer.3UI_method_set_closer.3UI_method_set_data_duplicator.3UI_method_set_ex_data.3UI_method_set_flusher.3UI_method_set_opener.3UI_method_set_prompt_constructor.3UI_method_set_reader.3UI_method_set_writer.3UI_new.3UI_new_method.3UI_null.3UI_process.3UI_set_default_method.3UI_set_ex_data.3UI_set_method.3UI_set_result.3UI_set_result_ex.3UI_string_types.3USERNOTICE_free.3USERNOTICE_new.3X509V3_EXT_d2i.3X509V3_EXT_i2d.3X509V3_add1_i2d.3X509V3_get_d2i.3X509_ALGOR_cmp.3X509_ALGOR_copy.3X509_ALGOR_dup.3X509_ALGOR_free.3X509_ALGOR_get0.3X509_ALGOR_new.�x�������������(2�������X�#mgJj�(��������:�����}�����������������:3Q�8
�?
|d��+�0�	<�	w��������	��,�2<D	H
LT�
����8@@�I(�8�
9�
:	&
G�H�I�X�Y�\] ^5b�d
Ue
Zf
]l
_�
x
�
�

��
�
�
�g
�h
�Ccpanel-perl-536-datetime-format-strptime1.791.cp108~el7CPAN module - Parse and format strp and strf time patternsCpanel build perl module 'DateTime::Format::Strptime'Parse and format strp and strf time patternsb�e�bh-centos-7.dev.cpanel.net�Iartistic_2cpanel/perlhttps://metacpan.orglinuxnoarch�	:�$�$`��
`��
78278a571de1a33777730b2cd666da21409f350a242de001ee5862907c3860e5379e4e695246972307ff0d1e1d19c33792ee6eb5046e397cef84a1119cd71e4crootrootrootrootcpanel-perl-536-datetime-format-strptime-1.79-1.cp108~el7.src.rpm��������cpanel-perl(DateTime::Format::Strptime)cpanel-perl(DateTime::Format::Strptime::Types)cpanel-perl-536-datetime-format-strptime-typescpanel-perl-datetime-format-strptimecpanel-perl-datetime-format-strptime-typescpanel-perl-536-datetime-format-strptime




cpanel-perl-536cpanel-perl-536-carpcpanel-perl-536-constantcpanel-perl-536-datetimecpanel-perl-536-datetime-localecpanel-perl-536-datetime-locale-basecpanel-perl-536-datetime-locale-fromdatacpanel-perl-536-datetime-timezonecpanel-perl-536-exportercpanel-perl-536-params-validationcompilercpanel-perl-536-parentcpanel-perl-536-speciocpanel-perl-536-specio-declarecpanel-perl-536-specio-exportercpanel-perl-536-specio-library-builtinscpanel-perl-536-specio-library-stringcpanel-perl-536-strictcpanel-perl-536-try-tinycpanel-perl-536-warningsrpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(CompressedFileNames)rpmlib(PayloadIsXz)rpmlib(TildeInVersions)1.001.302.090.334.6.0-14.0-13.0.4-15.2-14.10.0-14.11.1b���b�@`-@_�9�]��@[�s�Y��X��@W��@VD@V<�@S>��Q+R@Todd Rinaldo <toddr@cpan.org> - 1.79-1.cp108Busy Camels <bc@cpanel.net> - 1.77-1.cp108Busy Camels <bc@cpanel.net> - 1.77-1.cp1198Todd Rinaldo <toddr@cpan.org> - 1.77-1.cp1194Todd Rinaldo <toddr@cpanel.net> - 1.76-1.cp1186Todd Rinaldo <toddr@cpan.org> - 1.75-1.cp1178Todd Rinaldo <toddr@cpanel.net> - 1.74-1.cp1170Todd Rinaldo <toddr@cpanel.net> - 1.73-1.cp1162Todd Rinaldo <toddr@cpan.org> - 1.68-1.cp1162Todd Rinaldo <toddr@cpan.org> - 1.60-1.cp1156Todd Rinaldo <toddr@cpan.org> - 1.57-1.cp1156Todd Rinaldo <toddr@cpanel.net> - 1.54-1.cp1146Todd Rinaldo <toddr@cpanel.net> - 1.52-1.cp1136- Update from upstream: DateTime-Format-Strptime 1.79- Bump to 1.cp108 for re-build- Bump to 1.cp1198 for debian re-build- Update from upstream: DateTime-Format-Strptime 1.77- Update from upstream: DateTime-Format-Strptime 1.76- Update from upstream: DateTime-Format-Strptime 1.75- Update from upstream: DateTime-Format-Strptime 1.74- Update from upstream: DateTime-Format-Strptime 1.73- Update from upstream: DateTime-Format-Strptime 1.68- Update from upstream: DateTime-Format-Strptime 1.60- Update from upstream: DateTime-Format-Strptime 1.57- Update from upstream: DateTime-Format-Strptime 1.54- Update from upstream: DateTime-Format-Strptime 1.521.791.791.791.791.791.79-1.cp108~el7Strptime.pmTypes.pm/usr/local/cpanel/3rdparty/perl/536/cpane�x��������������!�������X1+gJjug G������h�1�inte�Y����������������1��H�K��?��d����	)�	[���8�<�C�K�O�	}�������.�.	�.
8.�.	�.

�.<.".

4.
��1l1X1(�)�*�+�,�-�8�{9!�{:��{>�@�
D�G�$.H��.I�.X��Y�(\�.]�L.^�xb�d�e�f�l�t��.u�|.v�4
w� .x��.y��������6�.�>6
�t�����.��g��h��Ckrb5-libs1.15.155.el7_9.tuxcare.els2The non-admin shared libraries used by Kerberos 5Kerberos is a network authentication system. The krb5-libs package
contains the shared libraries needed by Kerberos 5. If you are using
Kerberos, you need to install this package.g��buildfarm08-new.corp.cloudlinux.com!��CentOSTuxCareMITTuxCare Packaging Team <packager@tuxcare.com>System Environment/Librarieshttp://web.mit.edu/kerberos/www/linuxx86_64�N���7`5`�@�h �u;UqT�u
��*'��79CA�A큤A�A�A�A�A�A�A�A����������������A큤��A큤����A큤����������������A�A�A�g��{g��{g��qg��{g��{g��{g��{g���g��{g���g���g���g��|g���g��|g���g��|g���g��|g���g��|g���g��|g���g��|g���g��X��JX��Jg��}g��}g��}g��}g��X��Jg��}g��}g��}g��}g��}g��}g��}g��}g��{g��{g��{353ed27ce12e290946f5b58b339bdeb484139e970527c9decc6f3b02a938d22476f56fc563e5986fee076796e50346580dceaf88676ef361acb514ecb6ec9a80f7363a2a826f87603c393b30f03fe77e5e68fb6f021b9a23d791b80d52a51cf91eec649b329bc2545199b76539bb00ba4d3da042412265cc42bae177cb4fa855c5e492c441dbc480b247f379f108eeac46db6b3f3c9b2ba36231d8326653aadd10e56bc435ad8a241362215e6bc3dbde5cdac75d4060b998d126e8b888ac2118857ba32b6c470797c86835c485ba486a33fa8b91cd9abee9f9e094858966d94e02ad2530a056aefdad26366e7c34de1cecacb689a59b8bfeec433dac67472ff8939eeea5893a863dad43423d64e550efc064bcb799c4ce7f3b8a3bc896aad291f83512c49bc8cbc44ca6b8783e989a03b4051508b30563b3f9d7956eefae915140312ee8413ffa702ea1de7dedfbfcb69c3a8978abdac6ef25624872866ae852db1f1149b17b5d2ffd892d74e602be07224f300da1041a2724770d5d8dfc008fac5ea37381e4ce97d946f13fbebfa635c38975c0fbd780864775b86fb1e66ffe70e9d1f776968b73d240de556f3f43d4b62652aa5ec5bd43ddf7daa760d76a82f83512c49bc8cbc44ca6b8783e989a03b4051508b30563b3f9d7956eefae915101bcc5dfe1808e54313b03bf945d14f468357e40e605187b5ce8ca9f19496a6577df12674577f3a59f39384ab8b417975995c04fc444376a5b653951d779254938df17b9e89d0628fcb53e9f1685ebfee9696029f48d16af80f712d9769c55d90a3338871b1c4f66d601587582d58e46eb5ce5d00fa47496547744e687f355848dca7c90b0e8c96f03735240a86522cba8dbd68c86f015ab349fcbececb762377226e14da89c4946a5d9282f589d9388f31c73527c35d979ffcf0b109946ef9198007e12513d38959688fe05edff93de5a6e18781326a4e115a537ea650195f7959d4094fac852404dcb952428451eee307bfa610dc1183e26d2eb6a44bd1e79libgssapi_krb5.so.2.2libgssrpc.so.4.2libk5crypto.so.3.1libkdb5.so.8.0libkrad.so.0.0libkrb5.so.3.3libkrb5support.so.0.1��x��������������������X�#fJj <zd�=�6X�����^����������������6X5X7X�sabled the autoreporting of kerneloopses (jmoskovc@redhat.com)
- Kerneloops: fix BZ reporting of oopses (vda.linux@googlemail.com)
- GUI: wider report message dialog (jmoskovc@redhat.com)
- moved the gpg key list from abrt.conf to gpg_keys file (jmoskovc@redhat.com)
- Logger: create log file with mode 0600 (vda.linux@googlemail.com)
- GUI: fixed the rating logic, to prevent sending BT with rating < 3 (jmoskovc@redhat.com)
- Report GUI: made more fields copyable - closed rhbz#526209; tweaked wording (vda.linux@googlemail.com)
- GUI: fixed bug caused by failed gk-authorization (jmoskovc@redhat.com)- moved the gpg key list from abrt.conf to gpg_keys file (jmoskovc@redhat.com)
- Logger: create log file with mode 0600 rhbz#559545 (vda.linux@googlemail.com)
- GUI: fixed the rating logic, to prevent sending BT with rating < 3 (jmoskovc@redhat.com)
- Report GUI: made more fields copyable - closed rhbz#526209; tweaked wording (vda.linux@googlemail.com)
- GUI: fixed bug caused by failed gk-authorization (jmoskovc@redhat.com)
- fix bug 559881 (kerneloops not shown in "new" GUI) (vda.linux@googlemail.com)
- GUI ReporterDialog: hide log button (vda.linux@googlemail.com)
- added valgrind and strace to blacklist (jmoskovc@redhat.com)
- SOSreport: do not leave stray files in /tmp (vda.linux@googlemail.com)
- Save the core where it belongs if ulimit -c is > 0 (jmoskovc@redhat.com)
- reenabled gpg check (jmoskovc@redhat.com)
- SOSreport: run it niced (vda.linux@googlemail.com)
- report GUI: rename buttons: Log -> Show log, Send -> Send report (vda.linux@googlemail.com)
- applet: reduce blinking timeout to 3 sec (vda.linux@googlemail.com)
- fix dbus autostart (vda.linux@googlemail.com)
- abrtd: set "Reported" status only if at least one reporter succeeded (vda.linux@googlemail.com)
- SQLite3: disable newline escaping, SQLite does not handle it (vda.linux@googlemail.com)
- SOSreport: make it avoid double runs; add forced regeneration; upd PLUGINS-HOWTO (vda.linux@googlemail.com)
- attribute SEGVs in perl to script's package, like we already do for python (vda.linux@googlemail.com)- enabled sosreport
- fixes in ticketuploader
- GUI: redesign of reporter dialog (jmoskovc@redhat.com)
- Set the prgname to "Automatic Bug Reporting Tool" fixes rhbz#550357 (jmoskovc@redhat.com)
- CCpp analyzer: display __abort_msg in backtrace. closes rhbz#549735 (vda.linux@googlemail.com)
- s/os.exit/sys.exit - closes rhbz#556313 (vda.linux@googlemail.com)
- use repr() to print variable values in python hook rhbz#545070 (jmoskovc@redhat.com)
- gui: add logging infrastructure (vda.linux@googlemail.com)
- Added "Enabled = yes" to all plugin's config files (jmoskovc@redhat.com)
- *: disable plugin loading/unloading through GUI. Document keyring a bit (vda.linux@googlemail.com)
- fix memory leaks in catcut plugin (npajkovs@redhat.com)
- fix memory leaks in bugzilla (npajkovs@redhat.com)
- abrt-hook-python: sanitize input more; log to syslog (vda.linux@googlemail.com)
- Fixed /var/cache/abrt/ permissions (kklic@redhat.com)
- Kerneloops: we require commandline for every crash, save dummy one for oopses (vda.linux@googlemail.com)
- *: remove nss dependencies (vda.linux@googlemail.com)
- CCpp: use our own sha1 implementation (less pain with nss libs) (vda.linux@googlemail.com)
- DebugDump: more consistent logic in setting mode and uid:gid on dump dir (vda.linux@googlemail.com)
- fixes based on security review (vda.linux@googlemail.com)
- SOSreport/TicketUploader: use more restrictive file modes (vda.linux@googlemail.com)
- abrt-hook-python: add input sanitization and directory size guard (vda.linux@googlemail.com)
- RunApp: safer chdir. Overhauled "sparn a child and get its output" in general (vda.linux@googlemail.com)
- DebugDump: use more restrictive modes (vda.linux@googlemail.com)
- SQLite3: check for SQL injection (vda.linux@googlemail.com)
- replace plugin enabling via EnabledPlugins by par-plugin Enabled = yes/no (vda.linux@googlemail.com)
- abrt.spec: move "requires: gdb" to abrt-desktop (vda.linux@googlemail.com)
- ccpp: add a possibi�x���������������������X�#�gJjroot���������������S����������������������SW�S�o <dueno@redhat.com> - 3.28.4-11Daiki Ueno <dueno@redhat.com> - 3.28.4-10Daiki Ueno <dueno@redhat.com> - 3.28.4-9Kai Engert <kaie@redhat.com> - 3.28.4-8Daiki Ueno <dueno@redhat.com> - 3.28.4-7Daiki Ueno <dueno@redhat.com> - 3.28.4-6Daiki Ueno <dueno@redhat.com> - 3.28.4-5Daiki Ueno <dueno@redhat.com> - 3.28.4-4Daiki Ueno <dueno@redhat.com> - 3.28.4-3Daiki Ueno <dueno@redhat.com> - 3.28.4-2Daiki Ueno <dueno@redhat.com> - 3.28.3-5Daiki Ueno <dueno@redhat.com> - 3.28.3-4Daiki Ueno <dueno@redhat.com> - 3.28.3-3Daiki Ueno <dueno@redhat.com> - 3.28.3-2Daiki Ueno <dueno@redhat.com> - 3.28.2-3Daiki Ueno <dueno@redhat.com> - 3.28.2-2Daiki Ueno <dueno@redhat.com> - 3.28.2-1.1Daiki Ueno <dueno@redhat.com> - 3.28.2-1.0Daiki Ueno <dueno@redhat.com> - 3.21.3-1Kai Engert <kaie@redhat.com> - 3.21.0-17Kai Engert <kaie@redhat.com> - 3.21.0-16Kai Engert <kaie@redhat.com> - 3.21.0-15Kai Engert <kaie@redhat.com> - 3.21.0-14Elio Maldonado <emaldona@redhat.com> - 3.21.0-13Elio Maldonado <emaldona@redhat.com> - 3.21.0-12Elio Maldonado <emaldona@redhat.com> - 3.21.0-11Elio Maldonado <emaldona@redhat.com> - 3.21.0-10Kai Engert <kaie@redhat.com> - 3.21.0-9Kai Engert <kaie@redhat.com> - 3.21.0-8Elio Maldonado <emaldona@redhat.com> - 3.21.0-7Kai Engert <kaie@redhat.com> - 3.21.0-6Kai Engert <kaie@redhat.com> - 3.21.0-5Elio Maldonado <emaldona@redhat.com> - 3.21.0-2Elio Maldonado <emaldona@redhat.com> - 3.21.0-1Elio Maldonado <emaldona@redhat.com> - 3.19.1-19Kai Engert <kaie@redhat.com> - 3.19.1-18Elio Maldonado <emaldona@redhat.com> - 3.19.1-17Elio Maldonado <emaldona@redhat.com> - 3.19.1-16Elio Maldonado <emaldona@redhat.com> - 3.19.1-15Elio Maldonado <emaldona@redhat.com> - 3.19.1-14Elio Maldonado <emaldona@redhat.com> - 3.19.1-13Elio Maldonado <emaldona@redhat.com> - 3.19.1-12Elio Maldonado <emaldona@redhat.com> - 3.19.1-11Elio Maldonado <emaldona@redhat.com> - 3.19.1-10Elio Maldonado <emaldona@redhat.com> - 3.19.1-9Elio Maldonado <emaldona@redhat.com> - 3.19.1-8Elio Maldonado <emaldona@redhat.com> - 3.19.1-7Elio Maldonado <emaldona@redhat.com> - 3.19.1-6Kai Engert <kaie@redhat.com> - 3.19.1-5Elio Maldonado <emaldona@redhat.com> - 3.19.1-4Elio Maldonado <emaldona@redhat.com> - 3.19.1-3Elio Maldonado <emaldona@redhat.com> - 3.19.1-2Elio Maldonado <emaldona@redhat.com> - 3.19.1-1Kai Engert <kaie@redhat.com> - 3.18.0-6Kai Engert <kaie@redhat.com> - 3.18.0-5Elio Maldonado <emaldona@redhat.com> - 3.18.0-4Elio Maldonado <emaldona@redhat.com> - 3.18.0-3Elio Maldonado <emaldona@redhat.com> - 3.18.0-2Elio Maldonado <emaldona@redhat.com> - 3.18.0-1Elio Maldonado <emaldona@redhat.com> - 3.16.2.3-5Elio Maldonado <emaldona@redhat.com> - 3.16.2.3-4Elio Maldonado <emaldona@redhat.com> - 3.16.2.3-3Elio Maldonado <emaldona@redhat.com> - 3.16.2.3-2Elio Maldonado <emaldona@redhat.com> - 3.16.2-10Elio Maldonado <emaldona@redhat.com> - 3.16.2-9Elio Maldonado <emaldona@redhat.com> - 3.16.2-4Elio Maldonado <pbrobinson@redhat.com> 3.16.2-3Elio Maldonado <emaldona@redhat.com> - 3.16.2-2Elio Maldonado <emaldona@redhat.com> - 3.16.2-1Elio Maldonado <emaldona@redhat.com> - 3.15.4-6Elio Maldonado <emaldona@redhat.com> - 3.15.4-5Elio Maldonado <emaldona@redhat.com> - 3.15.4-4Elio Maldonado <emaldona@redhat.com> - 3.15.4-3Daniel Mach <dmach@redhat.com> - 3.15.4-2Elio Maldonado <emaldona@redhat.com> - 3.15.3-9Elio Maldonado <emaldona@redhat.com> - 3.15.3-8Elio Maldonado <emaldona@redhat.com> - 3.15.3-7Elio Maldonado <emaldona@redhat.com> - 3.15.3-6Elio Maldonado <emaldona@redhat.com> - 3.15.3-5Elio Maldonado <emaldona@redhat.com> - 3.15.3-4Daniel Mach <dmach@redhat.com> - 3.15.3-3Elio Maldonado <emaldona@redhat.com> - 3.15.3-2Elio Maldonado <emaldona@redhat.com> - 3.15.3-1Elio Maldonado <emaldona@redhat.com> - 3.15.2-10Elio Maldonado <emaldona@redhat.com> - 3.15.2-9Elio Maldonado <emaldona@redhat.com> - 3.15.2-8Elio Maldonado <emaldona@redhat.com> - 3.15.2-7Elio Maldonado <emaldona@redhat.com> - 3.15.2-6Elio Maldonado <emaldona@redhat.com> - 3.15.2-5Elio Maldonado �x������������������X�#zgJjxq	8������'�����O����������������'&�Fl?
�d����	�	Q����������� �	/�G�r�x��	�
��
,Jh����_���(�8�9�:ZGH$I<XDYL\X]p^�b4d�e�f�l�t�u
v
 w
8x
P�
h�
l
�
�6��6
(�TX`gdhhCepel-release714Extra Packages for Enterprise Linux repository configurationThis package contains the Extra Packages for Enterprise Linux (EPEL) repository
GPG key as well as configuration for yum.a3�#buildvm-x86-10.iad2.fedoraproject.orgd�Fedora ProjectFedora ProjectGPLv2Fedora ProjectSystem Environment/Basehttp://download.fedoraproject.org/pub/epellinuxnoarch~�N2Gс�������A큤a3��a3��a3��a3��a3�#a3��028b9accc59bab1d21f2f3f544df5469910581e728a64fd8c411a725a82300c289285531f9986cb02858b9e3aadfd87b004b07acb92a9344b7f3bf9966d9b89d5d41789918c13de835d0d315fce959915ed639878ef4a2d74b980a2f1828aa00953510dd98e6590a2538a3e39dd151cb3ea1189d416edef2d5823eafb64f514b03a55cfbbbfcdfc75fed8aeca5383fef12de4f019d5ff15c58f1e6581465007erootrootrootrootrootrootrootrootrootrootrootrootepel-release-7-14.src.rpm������������������������config(epel-release)epel-release



config(epel-release)redhat-releaserpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)7-1473.0.4-14.6.0-14.0-15.2-1fedora-release4.11.3`ݮ@_�Q�]y@Y�*@YNT@XbW�W�\@WQq@V���Tto@To)@To)@T�@S��S�@R��@Mohan Boddu <mboddu@bhujji.com> - 7-14Kevin Fenzi <kevin@scrye.com> - 7-13Stephen Smoogen <smooge@fedoraproject.org> - 7-12Kevin Fenzi <kevin@scrye.com> - 7-11Kevin Fenzi <kevin@scrye.com> - 7-10Kevin Fenzi <kevin@scrye.com> - 7-9Kevin Fenzi <kevin@scrye.com> - 7-8Kevin Fenzi <kevin@scrye.com> - 7-7Jason L Tibbitts III <tibbs@math.uh.edu> - 7-6Rex Dieter <rdieter@fedoraproject.org> 7-5Rex Dieter <rdieter@fedoraproject.org> 7-4Rex Dieter <rdieter@fedoraproject.org> 7-3Kevin Fenzi <kevin@scrye.com> 7-2Dennis Gilmore <dennis@ausil.us> - 7-1Kevin Fenzi <kevin@scrye.com> 7-0.2Dennis Gilmore <dennis@ausil.us> - 7-0.1- Change the baseurl to point to source/tree for srpms- Add preset for x2gocleansessions. Fixes bug #1141609- Add in &infra and content variables to better understand users of EPEL.- Add Conflicts on fedora-release to prevent people from installing on Fedora systems. Fixes bug #1497702- Change mirrorlist= in repo files to be metalink= (as thats what they are). Fixes bug #1451212- Add preset for drbdlinks package. Fixes bug #1405744- Drop duplicate libstoragemgmt from presets. Fixes bug #1358971- Drop initial-setup from presets. Fixes bug #1342511- Remove macros.epel; let epel-rpm-macros handle it instead.- fix typo in macros.epel- add systemd 90-epel.preset- implement %epel macro- Make repo files config(noreplace). Fixes bug #1135576- enable gpg checking now we are out of beta- Drop unneeded up2date post/postun
- Fixed up description.
- Fixes bugs #1052434 and #1093918- initial epel 7 build. gpg cheking is disabled7-147-14RPM-GPG-KEY-EP�x���������������������X�#�gJjfrom��h�������)�����`����������������))	)� fixes debug info.- Enable Elliptic Curve Cryptography (ECC)- Update to 3.11.1
- Include upstream patch to limit curves- add --noexecstack when compiling assembler on x86_64- bump again for double-long bug on ppc(64)- rebuilt for new gcc4.1 snapshot and glibc changes- rebuild- Update file list for the devel packages- Update to 3.11- Add patch to allow building on ppc*
- Update the pkgconfig file to Require nspr- Initial import into Fedora Core, based on a CVS snapshot of
  the NSS_3_11_RTM tag
- Fix up the pkcs11-devel subpackage to contain the proper headers
- Build with RPM_OPT_FLAGS
- No need to have rpath of /usr/lib in the pc file- Adressed review comments by Wan-Teh Chang, Bob Relyea,
  Christopher Aillon.- Initial build	

 !"#3.90.0-2.el7_9.tuxcare.els43.90.0-2.el7_9.tuxcare.els4certutilcmsutilcrlutilmodutilnss-policy-checkpk12utilsignverssltapatobbtoaderdumplistsuitesocspclntppselfservsigntoolstrsclntsymkeyutiltstclntvalidationvfychainvfyservcertutil.1.gzcmsutil.1.gzcrlutil.1.gzderdump.1.gzmodutil.1.gznss-policy-check.1.gzpk12util.1.gzpp.1.gzsigntool.1.gzsignver.1.gzssltap.1.gzvfychain.1.gzvfyserv.1.gz/usr/bin//usr/lib64/nss/unsupported-tools//usr/share/man/man1/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches   -m64 -mtune=genericcpioxz2x86_64-redhat-linux-gnu	

ELF 64-bit LSB executable, x86-64, version 1 (SYSV), dynamically linked (uses shared libs), for GNU/Linux 2.6.32, BuildID[sha1]=b421d0b2ffd8b3b6628e83853b026b1f3555914d, strippedELF 64-bit LSB executable, x86-64, version 1 (SYSV), dynamically linked (uses shared libs), for GNU/Linux 2.6.32, BuildID[sha1]=9679effbefbf1bc20439363b79926f0aad5c6164, strippedELF 64-bit LSB executable, x86-64, version 1 (SYSV), dynamically linked (uses shared libs), for GNU/Linux 2.6.32, BuildID[sha1]=6d38974ec1d1ffe0d0074f978a50ffcdd4b57c47, strippedELF 64-bit LSB executable, x86-64, version 1 (SYSV), dynamically linked (uses shared libs), for GNU/Linux 2.6.32, BuildID[sha1]=33101f5750e69aeb12d867b58f99b3a4d4613979, strippedELF 64-bit LSB executable, x86-64, version 1 (SYSV), dynamically linked (uses shared libs), for GNU/Linux 2.6.32, BuildID[sha1]=7cd4858792bc86a557c13e35cadf4f258e0af327, strippedELF 64-bit LSB executable, x86-64, version 1 (SYSV), dynamically linked (uses shared libs), for GNU/Linux 2.6.32, BuildID[sha1]=a6f5be11d89f0c5592cfdf5dbfa2f7e310c3cd61, strippedELF 64-bit LSB executable, x86-64, version 1 (SYSV), dynamically linked (uses shared libs), for GNU/Linux 2.6.32, BuildID[sha1]=a6c35eb796938bdb79e4240f084d4fa089a263a4, strippedELF 64-bit LSB executable, x86-64, version 1 (SYSV), dynamically linked (uses shared libs), for GNU/Linux 2.6.32, BuildID[sha1]=3e788a2be5c72d9dcf1374cf48918898f94d106d, strippedELF 64-bit LSB executable, x86-64, version 1 (SYSV), dynamically linked (uses shared libs), for GNU/Linux 2.6.32, BuildID[sha1]=e8af2d0343b3827ca4b202e360e5a93eece8717f, strippedELF 64-bit LSB executable, x86-64, version 1 (SYSV), dynamically linked (uses shared libs), for GNU/Linux 2.6.32, BuildID[sha1]=1713ee0f83540fc3ed99ac88ef2f41160fb155bf, strippedELF 64-bit LSB executable, x86-64, version 1 (SYSV), dynamically linked (uses shared libs), for GNU/Linux 2.6.32, �x���������������������X#�gJjuildP��������������o��������������������fpm sub-package- PHP 5.3.3 released- garbage collector upstream  patches (#580236)- rebuild for icu 4.4- PHP 5.3.2 Released!
- remove mime_magic option (now provided by fileinfo, by emu)
- add patch for http://bugs.php.net/50578
- remove patch for libedit (upstream)
- add runselftest option to allow build without test suite- update to v7 of systzdata patch- fix build with autoconf 2.6x- update to 5.3.1
- remove openssl patch (merged upstream)
- add provides for php-pecl-json
- add prod/devel php.ini in doc- use libedit instead of readline to resolve licensing issues- rebuilt with new openssl- Rebuilt for https://fedoraproject.org/wiki/Fedora_12_Mass_Rebuild- rediff systzdata patch- update to v6 of systzdata patch; various fixes- update to v5 of systzdata patch; parses zone.tab and extracts
  timezone->{country-code,long/lat,comment} mapping table- update to 5.3.0
- remove ncurses, dbase, mhash extensions
- add enchant, sqlite3, intl, phar, fileinfo extensions
- raise sqlite version to 3.6.0 (for sqlite3, build with --enable-load-extension)
- sync with upstream "production" php.ini- update to 5.2.10
- add interbase sub-package- update to 5.2.9- Rebuilt for https://fedoraproject.org/wiki/Fedora_11_Mass_Rebuild- add recode support, -recode subpackage (#106755)
- add -zts subpackage with ZTS-enabled build of httpd SAPI
- adjust php.conf to use -zts SAPI build for worker MPM- fix patch fuzz, renumber patches- drop obsolete configure args
- drop -odbc patch (#483690)- split out sysvshm, sysvsem, sysvmsg, posix into php-process- move wddx to php-xml, build curl shared in -common
- remove BR for expat-devel, bogus configure option- rebuild for new MySQL- libtool 2 workaround for phpize (#476004)
- add missing php_embed.h (#457777)- update to 5.2.8- libtool 2 workaround- update to 5.2.7
- enable pdo_dblib driver in php-mssql- tweak Summary, thanks to Richard Hughes- move gd_README to php-gd
- update to r4 of systzdata patch; introduces a default timezone
  name of "System/Localtime", which uses /etc/localtime (#469532)- enable XPM support in php-gd
- Fix BR for php-gd- enable T1lib support in php-gd- update to 5.2.6
- sync default php.ini with upstream
- drop extension_dir from default php.ini, rely on hard-coded
  default, to make php-common multilib-safe (#455091)
- update to r3 of systzdata patch- split pspell extension out into php-spell (#443857)- Autorebuild for GCC 4.3- ext/date: use system timezone database- rebuild for libc-client bump- Rebuild for openssl bump- update to 5.2.5- correct pcre BR version (#333021)
- restore metaphone fix (#205714)
- add READMEs to php-cli- update to 5.2.4- rebuild for fixed APR- add ldconfig post/postun for -embedded (Hans de Goede)- add php-embedded sub-package- fix build with new glibc
- fix License- define php_extdir in macros.php- obsolete php-dbase- add mcrypt, mhash, tidy, mssql subpackages (Dmitry Butskoy)
- enable dbase extension and package in -common- update to 5.2.3 (thanks to Jeff Sheltren)- fix php-pdo *_arg_force_ref global symbol abuse (#216125)- rebuild against uw-imap-devel- update to 5.2.2
- synch changes from upstream recommended php.ini- enable SASL support in LDAP extension (#205772)- drop mime_magic extension (deprecated by php-pecl-Fileinfo)- fix regression in str_{i,}replace (from upstream)- update to 5.2.1
- add Requires(pre) for httpd
- trim %changelog to versions >= 5.0.0- bump default memory_limit to 32M (#220821)
- mark config files noreplace again (#174251)
- drop trailing dots from Summary fields
- use standard BuildRoot
- drop libtool15 patch (#226294)- add php(api), php(zend-abi) provides (#221302)
- package /usr/share/php and append to default include_path (#225434)- fix filter.h installation path
- fix php-zend-abi version (Remi Collet, #212804)- rebuild again- rebuild for net-snmp soname bump- build json and zip shared, in -common (Remi Collet, #215966)
- obsolete php-json and php-pecl-zip
- build readline extension into /usr/bin/php* (#210585)
- change module subpacka�x�������������p��������X�#�gJjde78������������9�����Q����������������9:�B8h?3�d����	�	<���4�8�?�N�	z�������8�8	8
|8\8T8
�8l8�8��8���(�8�!9X!:!G&�8H'�8I(�8X(�Y(�\)8])�8^-b.d.�e.�f.�l.�t.�8u/�8v0�w1�8x2�8y3h
�3�3�3�5�5�
7��8 8$88\g8`h8dCpython-pycurl7.19.019.el7A Python interface to libcurlPycURL is a Python interface to libcurl. PycURL can be used to fetch
objects identified by a URL from a Python program, similar to the
urllib Python module. PycURL is mature, very fast, and supports a lot
of features.X�~worker1.bsys.centos.org�iCentOSLGPLv2+ or MITCentOS BuildSystem <http://bugs.centos.org>Development/Languageshttp://pycurl.sourceforge.net/linuxx86_64�nXg�fr�t�@
/���T|
e
o	����T!�
��f��x��	���M$��������A큤��������A큤��������A큤��������A큤������������A큤��������������������������������������������������������X�}D���X�}X�}X�}X�}X�~H
�eH
��X�|H
�
HƵHƵ�BF�B1��H��AD���EE�HƵ�B�WByB6�{B軭B軭B6�E��X�}F�=>�<r>�<rD�V�>�v�BJ�X�|>�O�B1�F��B1�B1�B1�B1�ET��HPbETo�B[B�H��yB&�H@��bX�|D�LH��>�<sX�|>�<s>�<sX�}cae69b6d02d210acab811d251eb415684b3d7228fd302af3403ace97fb25444a38e9f9ffa81fa64daadff12d524712f30b7e13e3d0812329d68c4e06d118316c38e9f9ffa81fa64daadff12d524712f30b7e13e3d0812329d68c4e06d118316c6ed48ff3b16e339cf39f914f2e4383865226241b724478a0f04b2278a5ad872b5a017843b28066f193abfe4ffcd9982043b96c436de1cb23bb46c8f5761b8b1ea15655754554d6a822cd6301a70f85a9cf1d53a4a55a1ee6f320adecc56ca149a698573f05a30eaa5fc0c1af2b12f10b92c9b1830fcbf597990e753ec468c7296313be8ea1def88ca1d2d22435b39b65fb4e9a7e8d30c530c955b269224aae4766d2cce39d42907a8c8277f8ae2678df5633f791fa001400d6ee09029fe6bf969b293c46ec9107501118a41ddc9d1a737b327845ff871fb69220179ba56221fd6c58a0a7dcd6222d64bf9dd6dca9b6ebdf5b92318f8b67bb2fd5d58bb07fcebd4f9e113951ce72cb6d4fb7081e33f45a679b65783559034ddea1afa710875613a0d07770bf6d321f2d52cdc3bda6e20f6865d3d4cb1dac9b1a966ea258589373f1e8fbd5b97db24aa5e2963abb0d623de9104b650569579c37090bf4b345b940d042d1dbb5f9d5f8ebba907538f24b7202d09046af17a4b55c2d1dd05deb878e0a804485fcd7dc74701b66e18a2a9a4331790890dc89735a6dcbed815650d85336ee6044b1699588438aec56c94156ab4d5d26b8dab3212b8aac9b1138c758aeef044c1d445b483e79827c2732cf8de1b0c1578041e9f83aa3dd50f892920e0031052fc7c605b8e21664cf8f7ded5057a7da273932b721a08fdf601bb3ce880358c4bed3be49a15158af1ed2f0ec6003bf33884d56b765d8bd2cd5d09655058b3d8ebebd64dcb72f2b635f2ea928fac96dc57ef6693a507bea0b3e0868281141ffc5c146e935f3937b6db45caf2bae7c97fc9beedf16248b5bd62035161b4801ca09884df9b5d4f6fbde0e4e232872a815484d623cde5956e108925c21a0c687e86aa47ee6370dd425ffed3b23540611dcaf0caef11714199fa8d14d3f37bc04b130187c9974c421c443db4950de42526af6b8b238d3f315843a98b711be833a32dfc5c94a0231ae22fca664a763e80e3a3da148a77bc109bf790fc1633ea6006d4c37ba86ab1ea14db6e814027fc0521f1a6a980f9df76c9001cc3724043769b99b87d3f448c83ad882fa35f98874a33fa4b4c4a77fd60a72ade21d492f8a44b49e7709188ae9160ffbc295c066232838919aeb4ff747a0d44344bd23c9a8ff�x��������������������XV#�eJj�����������������I�����
�����������������ID�M�@cpanel.net> - 5.6.16-1S. Kurt Newman <kurt.newman@cpanel.net> - 5.6.15-2Jacob Perkins <jacob.perkins@cpanel.net> - 5.6.15-1Dan Muey <dan@cpanel.net> - 5.6.14-2Jacob Perkins <jacob.perkins@cpanel.net> - 5.6.14-1Trinity Quirk <trinity.quirk@cpanel.net> - 5.6.13-1Kurt Newman <kurt.newman@cpanel.net> - 5.6.12-1Trinity Quirk <trinity.quirk@cpanel.net> - 5.6.6-6Darren Mobley <darren@cpanel.net> 5.6.6-5Darren Mobley <darren@cpanel.net> 5.6.6-4S. Kurt Newman <kurt.newman@cpanel.net> 5.6.6-3Dan Muey <dan@cpanel.net> 5.6.6-2S. Kurt Newman <kurt.newman@cpanel.net> - 5.6.6-1S. Kurt Newman <kurt.newman@cpanel.net> - 5.6.6-0Trinity Quirk <trinity.quirk@cpanel.net> - 5.5.6-14Jan Kaluza <jkaluza@redhat.com> - 5.5.6-13Remi Collet <rcollet@redhat.com> - 5.5.6-12Remi Collet <rcollet@redhat.com> - 5.5.6-11Remi Collet <rcollet@redhat.com> - 5.5.6-10Remi Collet <rcollet@redhat.com> - 5.5.6-9Remi Collet <rcollet@redhat.com> - 5.5.6-8Remi Collet <rcollet@redhat.com> - 5.5.6-7Remi Collet <rcollet@redhat.com> - 5.5.6-6Remi Collet <rcollet@redhat.com> - 5.5.6-5Remi Collet <rcollet@redhat.com> - 5.5.6-4Remi Collet <rcollet@redhat.com> 5.5.6-3Remi Collet <rcollet@redhat.com> 5.5.6-2Remi Collet <rcollet@redhat.com> 5.5.6-0Remi Collet <rcollet@redhat.com> 5.5.5-1Remi Collet <rcollet@redhat.com> 5.5.4-1Remi Collet <rcollet@redhat.com> 5.5.3-1Remi Collet <rcollet@redhat.com> 5.5.1-1Remi Collet <rcollet@redhat.com> 5.4.16-6Remi Collet <rcollet@redhat.com> 5.4.16-5Remi Collet <rcollet@redhat.com> 5.4.16-4Remi Collet <rcollet@redhat.com> - 5.4.16-3Remi Collet <rcollet@redhat.com> 5.4.16-2Remi Collet <rcollet@redhat.com> 5.4.16-1Remi Collet <rcollet@redhat.com> 5.4.14-3Remi Collet <rcollet@redhat.com> 5.4.14-2Remi Collet <rcollet@redhat.com> 5.4.14-1Remi Collet <rcollet@redhat.com> 5.4.13-1Remi Collet <rcollet@redhat.com> 5.4.11-1Remi Collet <rcollet@redhat.com> 5.4.10-1Remi Collet <rcollet@redhat.com> 5.4.9-1Remi Collet <rcollet@redhat.com> 5.4.8-7Remi Collet <rcollet@redhat.com> 5.4.8-6Remi Collet <rcollet@redhat.com> 5.4.8-5Remi Collet <rcollet@redhat.com> 5.4.8-6Remi Collet <rcollet@redhat.com> 5.4.8-4Remi Collet <rcollet@redhat.com> 5.4.8-4Remi Collet <rcollet@redhat.com> 5.4.8-3Joe Orton <jorton@redhat.com> - 5.4.8-2Remi Collet <rcollet@redhat.com> 5.4.8-3Remi Collet <rcollet@redhat.com> 5.4.8-2.1Remi Collet <rcollet@redhat.com> 5.4.8-2Remi Collet <rcollet@redhat.com> 5.4.8-1.2Remi Collet <rcollet@redhat.com> 5.4.8-1Remi Collet <rcollet@redhat.com> 5.4.7-4Remi Collet <rcollet@redhat.com> 5.4.7-3Remi Collet <rcollet@redhat.com> 5.4.7-2Remi Collet <rcollet@redhat.com> 5.4.7-1Remi Collet <remi@fedoraproject.org> 5.4.7-10Remi Collet <remi@fedoraproject.org> 5.4.7-9Remi Collet <rcollet@redhat.com> 5.4.7-8Remi Collet <rcollet@redhat.com> 5.4.7-7Remi Collet <rcollet@redhat.com> 5.4.7-6Remi Collet <rcollet@redhat.com> 5.4.7-5Remi Collet <rcollet@redhat.com> 5.4.7-4Remi Collet <rcollet@redhat.com> 5.4.7-3Remi Collet <remi@fedoraproject.org> 5.4.7-2Remi Collet <remi@fedoraproject.org> 5.4.7-1Remi Collet <remi@fedoraproject.org> 5.4.6-2Remi Collet <remi@fedoraproject.org> 5.4.6-1Remi Collet <remi@fedoraproject.org> 5.4.5-1Remi Collet <remi@fedoraproject.org> 5.4.4-4Remi Collet <remi@fedoraproject.org> 5.4.4-3Remi Collet <remi@fedoraproject.org> 5.4.4-2Remi Collet <remi@fedoraproject.org> 5.4.4-1Remi Collet <remi@fedoraproject.org> 5.4.3-1Remi Collet <remi@fedoraproject.org> 5.4.2-1Remi Collet <remi@fedoraproject.org> 5.4.1-1Joe Orton <jorton@redhat.com> - 5.4.0-6Remi Collet <remi@fedoraproject.org> 5.4.0-5Joe Orton <jorton@redhat.com> - 5.4.0-4Joe Orton <jorton@redhat.com> - 5.4.0-3Joe Orton <jorton@redhat.com> - 5.4.0-2Remi Collet <remi@fedoraproject.org> 5.4.0-1Remi Collet <remi@fedoraproject.org> 5.4.0-0.4.RC8Remi Collet <remi@fedoraproject.org> 5.4.0-0.3.RC7Remi Collet <remi@fedoraproject.org> 5.4.0-0.2.RC6Remi Collet <remi@fedoraproject.org> 5.4.0-0.1.RC6Remi Collet <remi@fedoraproject.org> 5.3.8-4.4Remi Collet <remi@fedoraproject.org> 5.3�x�������������`��������X-#1fJj��������0:8Y�����P����������������8Y7Y9Y�DT_RELACOUNT checks
  - elflint, readelf: add support for DT_GNU_HASH
  - libelf: add elf_gnu_hash
  - elflint, readelf: add support for 64-bit SysV-style hash tables
  - libdwfl: new functions dwfl_module_getsymtab, dwfl_module_getsym.- Update to 0.121
  - libelf: bug fixes for rewriting existing files when using mmap (#187618).
  - make all installed headers usable in C++ code (#193153).
  - eu-readelf: better output format.
  - eu-elflint: fix tests of dynamic section content.
  - libdw, libdwfl: handle files without aranges info.- rebuild to pick up -devel deps- Update to 0.120
  - License changed to GPL, with some exceptions for using
    the libelf, libebl, libdw, and libdwfl library interfaces.
    Red Hat elfutils is an included package of the Open Invention Network.
  - dwarf.h updated for DWARF 3.0 final specification.
  - libelf: Fix corruption in ELF_C_RDWR uses (#187618).
  - libdwfl: New function dwfl_version; fixes for offline.- bump again for double-long bug on ppc(64)- rebuilt for new gcc4.1 snapshot and glibc changes- update to 0.119- rebuilt- update to 0.118
  - elflint: more tests.
  - libdwfl: New function dwfl_module_register_names.
  - libebl: New backend hook for register names.
- Make sure -fexceptions is always in CFLAGS.- update to 0.117
  - libdwfl: New function dwfl_module_return_value_location (#166118)
  - libebl: Backend improvements for several CPUs- update to 0.116
  - libdw fixes, API changes and additions
  - libdwfl fixes (#169672)
  - eu-strip/libelf fix to preserve setuid/setgid permission bits (#167745)- Update requires/conflicts for better biarch update behavior.- update to 0.115
  - New program eu-strings.
  - libdw: New function dwarf_getscopes_die.
  - libelf: speed-ups of non-mmap reading.
  - Implement --enable-gcov option for configure.- update to 0.114
  - new program eu-ranlib
  - libdw: new calls for inlines
  - libdwfl: new calls for offline modules- update to 0.113
  - elflint: relax a bit.  Allow version definitions for defined symbols
    against DSO versions also for symbols in nobits sections.
    Allow .rodata section to have STRINGS and MERGE flag set.
  - strip: add some more compatibility with binutils.
  - libdwfl: bug fixes.
- Separate libdw et al into elfutils-libs subpackage.- update to 0.112
  - elfcmp: some more relaxation.
  - elflint: many more tests, especially regarding to symbol versioning.
  - libelf: Add elfXX_offscn and gelf_offscn.
  - libasm: asm_begin interface changes.
  - libebl: Add three new interfaces to directly access machine, class,
    and data encoding information.- update portability patch- update to 0.111
  - libdwfl library now merged into libdw- update to 0.110- update to 0.109
  - verify that libebl modules are from the same build
  - new eu-elflint checks on copy relocations
  - new program eu-elfcmp
  - new experimental libdwfl library- robustification of eu-strip and eu-readelf- more robustification- robustification- update to 0.108
  - merge strip fixes
  - sort records in dwarf_getsrclines, fix dwarf_getsrc_die searching
  - update elf.h from glibc- fix strip -f byte-swapping bug- update to 0.107
  - readelf: improve DWARF output format
  - elflint: -d option to support checking separate debuginfo files
  - strip: fix ET_REL debuginfo files (#156341)- fix some bugs in new code, reenable make check- disable make check for most arches, for now- update to 0.106- update to 0.104- update to 0.103- update to 0.101.
- use %configure macro to get CFLAGS etc. right- upgrade to 0.99.- upgrade to 0.97.- upgrade to 0.96.- rebuilt with GCC 3.4.x, workaround VLA + alloca mixing
  warning- rebuilt- upgrade to 0.95.- rebuilt- rebuilt- upgrade to 0.94- upgrade to 0.93- full version
- macroized spec file for GPL or OSL builds
- include only libelf under GPL plus wrapper scripts- macroized spec file for GPL or OSL builds- split elfutils-devel into two packages.- include only libelf under GPL plus wrapper scripts- readelf, not readline, in %description (#111214).- update to�x�������������،�������X8#ggJjrez ���������
�,�����m�����������������,����5.4.0RC6
  https://fedoraproject.org/wiki/Features/Php54- fix systemd unit- switch to systemd- Rebuild for new libpng- rebuild with new gmp without compat lib- rebuild with new gmp- revert is_a() to php <= 5.3.6 behavior (from upstream)
  with new option (allow_string) for new behavior- add mysqlnd sub-package
- drop patch4, use --libdir to use /usr/lib*/php/build
- add patch to redirect mysql.sock (in mysqlnd)- update to 5.3.8
  http://www.php.net/ChangeLog-5.php#5.3.8- update to 5.3.7
  http://www.php.net/ChangeLog-5.php#5.3.7
- merge php-zts into php (#698084)- rebuild for net-snmp SONAME bump- enable mhash extension (emulated by hash extension)- rebuild for new MySQL client library- update to 5.3.6
  http://www.php.net/ChangeLog-5.php#5.3.6
- fix php-pdo arch specific requires- disable zip extension per "No Bundled Libraries" policy (#551513)- rebuild for icu 4.6- fix systemd-units requires- add tmpfiles.d configuration for php-fpm
- add Arch specific requires/provides- Rebuilt for https://fedoraproject.org/wiki/Fedora_15_Mass_Rebuild- update to 5.3.5
  http://www.php.net/ChangeLog-5.php#5.3.5
- clean duplicate configure options- rebuild against MySQL 5.5.8
- remove all RPM_SOURCE_DIR- security patch from upstream for #660517- update to 5.3.4
  http://www.php.net/ChangeLog-5.php#5.3.4
- move phpize to php-cli (see #657812)- ghost /var/run/php-fpm (see #656660)
- add filter_setup to not provides extensions as .so- use mysql_config in libdir directly to avoid biarch build failures- rebuild for new net-snmp- add php-fpm sub-package- PHP 5.3.3 released- garbage collector upstream  patches (#580236)- rebuild for icu 4.4- PHP 5.3.2 Released!
- remove mime_magic option (now provided by fileinfo, by emu)
- add patch for http://bugs.php.net/50578
- remove patch for libedit (upstream)
- add runselftest option to allow build without test suite- update to v7 of systzdata patch- fix build with autoconf 2.6x- update to 5.3.1
- remove openssl patch (merged upstream)
- add provides for php-pecl-json
- add prod/devel php.ini in doc- use libedit instead of readline to resolve licensing issues- rebuilt with new openssl- Rebuilt for https://fedoraproject.org/wiki/Fedora_12_Mass_Rebuild- rediff systzdata patch- update to v6 of systzdata patch; various fixes- update to v5 of systzdata patch; parses zone.tab and extracts
  timezone->{country-code,long/lat,comment} mapping table- update to 5.3.0
- remove ncurses, dbase, mhash extensions
- add enchant, sqlite3, intl, phar, fileinfo extensions
- raise sqlite version to 3.6.0 (for sqlite3, build with --enable-load-extension)
- sync with upstream "production" php.ini- update to 5.2.10
- add interbase sub-package- update to 5.2.9- Rebuilt for https://fedoraproject.org/wiki/Fedora_11_Mass_Rebuild- add recode support, -recode subpackage (#106755)
- add -zts subpackage with ZTS-enabled build of httpd SAPI
- adjust php.conf to use -zts SAPI build for worker MPM- fix patch fuzz, renumber patches- drop obsolete configure args
- drop -odbc patch (#483690)- split out sysvshm, sysvsem, sysvmsg, posix into php-process- move wddx to php-xml, build curl shared in -common
- remove BR for expat-devel, bogus configure option- rebuild for new MySQL- libtool 2 workaround for phpize (#476004)
- add missing php_embed.h (#457777)- update to 5.2.8- libtool 2 workaround- update to 5.2.7
- enable pdo_dblib driver in php-mssql- tweak Summary, thanks to Richard Hughes- move gd_README to php-gd
- update to r4 of systzdata patch; introduces a default timezone
  name of "System/Localtime", which uses /etc/localtime (#469532)- enable XPM support in php-gd
- Fix BR for php-gd- enable T1lib support in php-gd- update to 5.2.6
- sync default php.ini with upstream
- drop extension_dir from default php.ini, rely on hard-coded
  default, to make php-common multilib-safe (#455091)
- update to r3 of systzdata patch- split pspell extension out into php-spell (#443857)- Autorebuild for GCC 4.3- ext/date: use system timezone database- rebuild for li�x�������������P|�������X�#tgJjus a���������������E
�����-����������������E
�l��������=�����"�9��p�I�#���\(��r�f8�Ͽ�i�Fpͥ}�Fs�Ȟ_�gWxC�F�Bzb��}1��DZb�y�;�3D7J�.]�>#i��p=�%�O���m��!s �H��i��#x��~�|��v��K�� 5^�,=�t��J������2�Ѹ�  U�#f�{�B��)�ƿ���		':�]]v�!��xY�7��g����"�	��k���D�;Q0�_z�G���0rk���(j������D���,�+
�ق8}�Yv�I[
�e�n@���y{4����%�+�<xX�o��q2u��T*��^%��3pa�ѩ~�TG���v�f�N��>Yk�/�� ����������Q�L�h$��Z�3P_�%N���ԃ�F�����Gͪs�%�9��s4NY.gN�����Ó��zk�i�#�칃�e����Ar`��a��'�w���ҵhVW�?��x�A�P�ֿD��	�h&�{�Yu�o��9�Æ��Ѩ���P����i</�e�2��c�C%�͋��4�H��M��	I�d����MP�#���8�Fr��Ch���@q\K�IW�chE�tu3��0�竅>ĥO O�Y-{��d�
����Nf7453a7312bc3882397be6d5324e6bb6f014c924i�K�3Xi�Fotrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootroot�x��������������k�������X{#�gJj (Wa����������������������i��������������������rebuilt for libdb-5.3.28- fix: CLDAP is broken for IPv6 (#1018688)- fix: typos in manpages- new upstream release
  + compile-in mdb backend- Rebuilt for https://fedoraproject.org/wiki/Fedora_20_Mass_Rebuild- Perl 5.18 rebuild- fix: using slaptest to convert slapd.conf to LDIF format ignores "loglevel 0"- do not needlessly run ldconfig after installing openldap-devel
- fix: LDAPI with GSSAPI does not work if SASL_NOCANON=on (#960222)
- fix: lt_dlopen() with back_perl (#960048)- fix: minor documentation fixes
- set SASL_NOCANON to on by default (#949864)
- remove trailing spaces- drop the evolution patch- new upstream release (#947235)
- fix: slapd.service should ensure that network is up before starting (#946921)
- fix: NSS related resource leak (#929357)- fix: syncrepl push DELETE operation does not recover (#920482)
- run autoreconf every build, drop autoreconf patch (#926280)- enable perl backend (#820547)
- package ppolicy-check-password (#829749)
- add perl specific BuildRequires
- fix bogus dates- new upstream release (#917603)
- fix: slapcat segfaults if cn=config.ldif not present (#872784)
- use systemd-rpm macros in spec file (#850247)- rebuild against new cyrus-sasl- fix update: libldap does not load PEM certificate if certdb is used as TLS_CACERTDIR (#857455)- fix: slapd with rwm overlay segfault following ldapmodify (#865685)- new upstream release:
  + slapd: ACLs, syncrepl
  + backends: locking and memory management in MDB
  + manpages: slapo-refint
- patch update: MozNSS certificate database in SQL format cannot be used (#860317)
- fix: slapd.service should not use /tmp (#859019)- fix: some TLS ciphers cannot be enabled (#852338)
- fix: connection hangs after fallback to second server when certificate hostname verification fails (#852476)
- fix: not all certificates in OpenSSL compatible CA certificate directory format are loaded (#852786)
- fix: MozNSS certificate database in SQL format cannot be used (#857373)
- fix: libldap does not load PEM certificate if certdb is used as TLS_CACERTDIR (#857455)- enhancement: TLS, prefer private keys from authenticated slots
- enhancement: TLS, allow certificate specification including token name
- resolve TLS failures in replication in 389 Directory Server- new upstream release
  + library: double free, SASL handling
  + tools: read SASL_NOCANON from config file
  + slapd: config index renumbering, duplicate error response
  + backends: various fixes in mdb, bdb/hdb, ldap
  + accesslog, syncprov: fix memory leaks in with replication
  + sha2: portability, thread safety, support SSHA256,384,512
  + documentation fixes- fix: slapd refuses to set up TLS with self-signed PEM certificate (#842022)- multilib fix: move libslapi from openldap-servers to openldap package- fix: querying for IPv6 DNS records when IPv6 is disabled on the host (#835013)
- fix: smbk5pwd module computes invalid LM hashes (#841560)- modify the package build process
  + fix autoconfig files to detect Mozilla NSS library using pkg-config
  + remove compiler flags which are not needed currently
  + build server, client and library together
  + avoid stray dependencies by using --as-needed linker flag
  + enable SLAPI interface in slapd- update fix: count constraint broken when using multiple modifications (#795766)
- fix: invalid order of TLS shutdown operations (#808464)
- fix: TLS error messages overwriting in tlsm_verify_cert() (#810462)
- fix: reading pin from file can make all TLS connections hang (#829317)
- CVE-2012-2668: cipher suite selection by name can be ignored (#825875)
- fix: slapd fails to start on reboot (#829272)
- fix: default cipher suite is always selected (#828790)
- fix: less influence between individual TLS contexts:
  - replication with TLS does not work (#795763)
  - possibly others- fix: nss-tools package is required by the base package, not the server subpackage
- fix: MozNSS CA certdir does not work together with PEM CA cert file (#819536)- new upstream release
  + library: IPv6 url detection
  + library: rebinding to faile�x�������������@[�������X;#�gJj390]!`�������@J�����(����������������@JAJ�?-`?(�d����	*�	i���� �:�G�	K�a�u�{��	�
��
 (2<hp��I(�8�J9�J:�JF&�G&�H&�I&�X&�Y&�\']'^'(b'~c(Cd(�e(�f(�l(�z(��(�(�(�*�+
- �-L-P-Tg-Xh-\Cea-php80-php-curl8.0.3010.17.6.cpanelA module for PHP applications that need to interface with curlThe php-curl package delivers a module which will allow PHP
scripts to connect and communicate to many different types of servers
with many different types of protocols. libcurl currently supports the
http, https, ftp, gopher, telnet, dict, file, and ldap
protocols. libcurl also supports HTTPS certificates, HTTP POST, HTTP
PUT, FTP uploading, HTTP form based upload, proxies, cookies, and
user+password authentication.i��hou-1	:�EA4-production / CentOS_7cPanel, Inc.PHPDevelopment/Languageshttp://www.php.net/linuxx86_641	:�����i���i���96c4556fdb8b0b9d315a573aca705daa35a903f3dbd78887a5416365b1e13b8c12cb8094dbc68002a26044ea4f7b3ac302eacfe009efc4b61eb83d55a12dba2erootrootrootrootea-php80-php-8.0.30-10.17.6.cpanel.src.rpm��������ea-php80-php-curlea-php80-php-curl(x86-64)


@@@@@@@@@@@@@@@@@
ea-php80-php-common(x86-64)ea-php80-php-cli(x86-64)ea-libcurlrpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(CompressedFileNames)libbrotlicommon.so.1()(64bit)libbrotlidec.so.1()(64bit)libc.so.6()(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libcrypto-ea.so.1.1()(64bit)libcurl.so.4()(64bit)libdl.so.2()(64bit)libgssapi_krb5.so.2()(64bit)libnghttp2.so.14()(64bit)libpthread.so.0()(64bit)libssh2.so.1()(64bit)libssl-ea.so.1.1()(64bit)libz.so.1()(64bit)rtld(GNU_HASH)rpmlib(PayloadIsXz)8.0.30-10.17.6.cpanel8.0.30-10.17.6.cpanel7.68.0-24.6.0-14.0-13.0.4-15.2-14.11.3i`�h�@g}@g�@f�o@f�K�e�4@ehy@ee�@d��@d��du�@df@dd��dX�@d,@c�w�c��@c���c�E�cs@c[�@c6�@c5��c1�@c��b�b��b�2@b|��bY^@b3"�b\@b�@a�N�aՈ@a�@a�d�a���a�{�a���a�@aqV@an�@a]��aV�@aLl@a'�@a�@`�#@`ݮ@`ٹ�`��`� @`���`B@`@�`3@_���_��_���_�G@_��@_�i�_�#�_��@_��@_���_���_���_�"�_i�@_FN�_
�@Gary Stanley <gary.stanley@webpros.com> - 8.0.30-10Chris Castillo <chris.castillo@webpros.com> - 8.0.30-9Dan Muey <daniel.muey@webpros.com> - 8.0.30-8Julian Brown <julian.brown@cpanel.net> - 8.0.30-7Dan Muey <dan@cpanel.net> - 8.0.30-6Julian Brown <julian.brown@cpanel.net> - 8.0.30-5Travis Holloway <t.holloway@cpanel.net> - 8.0.30-4Tim Mullin <tim@cpanel.net> - 8.0.30-3Julian Brown <julian.brown@cpanel.net> - 8.0.30-2Cory McIntire <cory@cpanel.net> - 8.0.30-1Cory McIntire <cory@cpanel.net> - 8.0.29-1Travis Holloway <t.holloway@cpanel.net> - 8.0.28-6Julian Brown <julian.brown@cpanel.net> - 8.0.28-5Julian Brown <julian.brown@cpanel.net> - 8.0.28-4Brian Mendoza <brian.mendoza@cpanel.net> - 8.0.28-3Julian Brown <julian.brown@cpanel.net> - 8.0.28-2Cory McIntire <cory@cpanel.net> - 8.0.28-1Tim Mullin <tim@cpanel.net> - 8.0.27-2Cory McIntire <cory@cpanel.net> - 8.0.27-1Cory McIntire <cory@cpanel.net> - 8.0.26-1Travis Holloway <t.holloway@cpanel.net> - 8.0.25-2Cory McIntire <cory@cpanel.net> - 8.0.25-1Cory McInti�x��������������J�������X�#gJjoc: ����������������������[���������������������9�m: new systemd macros (#850268)
- php-fpm: add upstream patch for startup issue (#846858)- systemd integration, https://bugs.php.net/63085
- no odbc call during timeout, https://bugs.php.net/63171
- check sqlite3_column_table_name, https://bugs.php.net/63149- most failed tests explained (i386, x86_64)- fix for http://bugs.php.net/63126 (#783967)- patch to ensure we use latest libdb (not libdb4)- really fix rhel tests (use libzip and libdb)- fix test to enable zip extension on RHEL-7- remove session.save_path from php.ini
  move it to apache and php-fpm configuration files- update to 5.4.7
  http://www.php.net/releases/5_4_7.php
- php-fpm: don't daemonize- enable php-fpm on secondary arch (#849490)- update to 5.4.6
- update to v9 of systzdata patch
- backport fix for new libxml- update to 5.4.5- also provide php(language)%{_isa}
- define %{php_version}- drop BR for libevent (#835671)
- provide php(language) to allow version check- add missing provides (core, ereg, filter, standard)- update to 5.4.4 (CVE-2012-2143, CVE-2012-2386)
- use /usr/lib/tmpfiles.d instead of /etc/tmpfiles.d
- use /run/php-fpm instead of /var/run/php-fpm- update to 5.4.3 (CVE-2012-2311, CVE-2012-2329)- update to 5.4.2 (CVE-2012-1823)- update to 5.4.1- rebuild for new icu
- switch (conditionally) to libdb-devel- fix Loadmodule with MPM event (use ZTS if not MPM worker)
- split conf.d/php.conf + conf.modules.d/10-php.conf with httpd 2.4- rebuild for missing automatic provides (#807889)- really use _httpd_mmn- rebuild against httpd 2.4
- use _httpd_mmn, _httpd_apxs macros- update to PHP 5.4.0 finale- update to PHP 5.4.0RC8- update to PHP 5.4.0RC7
- provides env file for php-fpm (#784770)
- add patch to use system libzip (thanks to spot)
- don't provide INSTALL file- all binaries in /usr/bin with zts prefix- update to PHP 5.4.0RC6
  https://fedoraproject.org/wiki/Features/Php54- fix systemd unit- switch to systemd- Rebuild for new libpng- rebuild with new gmp without compat lib- rebuild with new gmp- revert is_a() to php <= 5.3.6 behavior (from upstream)
  with new option (allow_string) for new behavior- add mysqlnd sub-package
- drop patch4, use --libdir to use /usr/lib*/php/build
- add patch to redirect mysql.sock (in mysqlnd)- update to 5.3.8
  http://www.php.net/ChangeLog-5.php#5.3.8- update to 5.3.7
  http://www.php.net/ChangeLog-5.php#5.3.7
- merge php-zts into php (#698084)- rebuild for net-snmp SONAME bump- enable mhash extension (emulated by hash extension)- rebuild for new MySQL client library- update to 5.3.6
  http://www.php.net/ChangeLog-5.php#5.3.6
- fix php-pdo arch specific requires- disable zip extension per "No Bundled Libraries" policy (#551513)- rebuild for icu 4.6- fix systemd-units requires- add tmpfiles.d configuration for php-fpm
- add Arch specific requires/provides- Rebuilt for https://fedoraproject.org/wiki/Fedora_15_Mass_Rebuild- update to 5.3.5
  http://www.php.net/ChangeLog-5.php#5.3.5
- clean duplicate configure options- rebuild against MySQL 5.5.8
- remove all RPM_SOURCE_DIR- security patch from upstream for #660517- update to 5.3.4
  http://www.php.net/ChangeLog-5.php#5.3.4
- move phpize to php-cli (see #657812)- ghost /var/run/php-fpm (see #656660)
- add filter_setup to not provides extensions as .so- use mysql_config in libdir directly to avoid biarch build failures- rebuild for new net-snmp- add php-fpm sub-package- PHP 5.3.3 released- garbage collector upstream  patches (#580236)- rebuild for icu 4.4- PHP 5.3.2 Released!
- remove mime_magic option (now provided by fileinfo, by emu)
- add patch for http://bugs.php.net/50578
- remove patch for libedit (upstream)
- add runselftest option to allow build without test suite- update to v7 of systzdata patch- fix build with autoconf 2.6x- update to 5.3.1
- remove openssl patch (merged upstream)
- add provides for php-pecl-json
- add prod/devel php.ini in doc- use libedit instead of readline to resolve licensing issues- rebuilt with new openssl- Rebuilt for https://fedoraproject.org/wiki�x�������������0:�������Xp#sgJj���������������l�����(�����������������l�mE
�ed-printable-decode filter). (CVE-2024-11233)
- (Configuring a proxy in a stream context might allow for CRLF injection in URIs). (CVE-2024-11234)
- (Integer overflow in the dblib quoter causing OOB writes). (CVE-2024-11236)
- (Integer overflow in the firebird quoter causing OOB writes). (CVE-2024-11236)
- (Leak partial content of the heap through heap buffer over-read). (CVE-2024-8929)
- (OOB access in ldap_escape). (CVE-2024-8932)- ZC-12246: Correct conffiles on Ubuntu- EA-12497: Update ea-php83 from v8.3.12 to v8.3.13- EA-12410: Update ea-php83 from v8.3.11 to v8.3.12
- Fixed bug GHSA-865w-9rf3-2wh5 (Logs from childrens may be altered). (CVE-2024-9026)
- Fixed bug GHSA-9pqp-7h25-4f32 (Erroneous parsing of multipart form data). (CVE-2024-8925)
- Fixed bug GHSA-p99j-rfp4-xqvq (Bypass of CVE-2024-4577, Parameter Injection Vulnerability). (CVE-2024-8926)
- Fixed bug GHSA-94p6-54jq-9mwp (cgi.force_redirect configuration is bypassable due to the environment variable collision). (CVE-2024-8927)- ZC-12149: Update from v8.3.10 to v8.3.11- ZC-12153: make opcache INI a configfile for debs- EA-12305: Update ea-php83 from v8.3.9 to v8.3.10- EA-12276: Update ea-php83 from v8.3.8 to v8.3.9- EA-12193: Update ea-php83 from v8.3.7 to v8.3.8
- Fixed bug GHSA-3qgc-jrrr-25jv (Bypass of CVE-2012-1823, Argument Injection in PHP-CGI). (CVE-2024-4577)
- Fixed bug GHSA-w8qr-v226-r27w (Filter bypass in filter_var FILTER_VALIDATE_URL). (CVE-2024-5458)
- Fixed bug GHSA-9fcc-425m-g385 (Bypass of CVE-2024-1874). (CVE-2024-5585)
- The openssl_private_decrypt function in PHP, when using PKCS1 padding (OPENSSL_PKCS1_PADDING, which is the default), is vulnerable to the Marvin Attack- EA-12145: Update ea-php83 from v8.3.6 to v8.3.7- ZC-11730: Add GD support for AVIF format on Ubuntu 22 and higher- EA-12086: Update ea-php83 from v8.3.4 to v8.3.6
- Fixed bug GHSA-pc52-254m-w9w7 (Command injection via array-ish $command parameter of proc_open). (CVE-2024-1874)
- Fixed bug GHSA-wpj3-hf5j-x4v4 (__Host-/__Secure- cookie bypass due to partial CVE-2022-31629 fix). (CVE-2024-2756)
- Fixed bug GHSA-h746-cjrr-wfmr (password_verify can erroneously return true, opening ATO risk). (CVE-2024-3096)
- Fixed bug GHSA-fjp9-9hwx-59fq (mb_encode_mimeheader runs endlessly for some inputs). (CVE-2024-2757)- ZC-11561: Add GD support for AVIF format on RHEL 8 and newer (RHEL only)- EA-12018: Update ea-php83 from v8.3.3 to v8.3.4- EA-11978: Update ea-php83 from v8.3.2 to v8.3.3- EA-11920: Update ea-php83 from v8.3.1 to v8.3.2- EA-11894: Update ea-php83 from v8.3.0 to v8.3.1- EA-10753: Have snmp module require 'snmp-mibs-downloader' for deb- ZC-11475: Build on CentOS 7- ZC-11183, ZC-11175: Initial Buildhou-1 1776808459	
8.3.30-2.4.6.cpanel8.3.30-2.4.6.cpanel8.3.30-2.4.6.cpanel8.3.30-2.4.6.cpanel8.3.30-2.4.6.cpanel8.3.30-2.4.6.cpanel8.3.30-2.4.6.cpanel8.3.30-2.4.6.cpanelpharphar.pharphpphp-cgiphpizephar.1.gzphar.phar.1.gzphp-cgi.1.gzphp.1.gzphpize.1.gzea-php83ea-php83/opt/cpanel/ea-php83/root/usr/bin//opt/cpanel/ea-php83/root/usr/share/man/man1//usr/bin//usr/local/bin/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1  -m64 -mtune=genericobs://private/EA4-production/CentOS_7/a141a6adbc304f61d5d8acefc4276e18-ea-php83cpioxz2x86_64-redhat-linux-gnu�9��V(��k�U�A=?����@Z��i��#x��~�|=��`�<>iB�-!w�i�f&�븡E��2����CR�l$H�nfa d~�� QF�״v��CG��xC$,7���ӄf���u����`����+B��f��Wz<�mѱ�%Y��:��Pه��Nd���*	���cc<A�WSv'c����asI�֐����8o��!���0�#����|��;�oW�#l�YˊNm?��5CH>{�� �T�P�;��P��W6��d85nwg̒����bz갲�l���m��I{�ڝn��Q98�?�9�5�'�9��<!Y�gKũ+KQ��Ir�&�ڑ�[��tk�d�4,�h����L�1kO�Pe��/N5�.���ϓ���{�㕙f,�w�χuɕ=�G��x��������������)�������X#%fJj - I���������	�������R������������������K1�=+@?& d����	�	U� �$�H�L�W�b���	��������Q@Q	�Q
�Q�Q
�Q
<Q�QQ��Q0P(<8D9L:�GQHLQI�QX�Y�\Q]HQ^85b%cd%�e%�f&l&�&&0&46(j(z6
*��*�*�Q+4g+8h+<Calt-libidn22.3.02.el7Library to support IDNA2008 internationalized domain namesLibidn2 is an implementation of the IDNA2008 specifications in RFC
5890, 5891, 5892, 5893 and TR46 for internationalized domain names
(IDN). It is a standalone library, without any dependency on libidn.h0��buildfarm01-new.corp.cloudlinux.com�CloudLinuxCloudLinux(GPLv2+ or LGPLv3+) and GPLv3+CloudLinux Packaging Team <packager@cloudlinux.com>Unspecifiedhttps://www.gnu.org/software/libidn/#libidn2linuxx86_64��+�~�"NF���&�H���7�����r���4��B�����A큤����A큤������A�A�A큤A�A큤A�A큤A�A큤A�A큤A�A큤A�A큤A�A큤A�A큤A�A큤A�A큤A�A큤A�A큤A�A큤A�A큤A�A큤A�A큤A�A큤A�A큤A�A큤A�A큤A�A큤A�A큤h0��h0��h0��]�8]�
\Pu9h0��\/~}Xbm�XnXbm�h0��h0��h0��h0��h0��h0��h0��h0��h0��h0��h0��h0��h0��h0��h0��h0��h0��h0��h0��h0��h0��h0��h0��h0��h0��h0��h0��h0��h0��h0��h0��h0��h0��h0��h0��h0��h0��h0��h0��h0��h0��h0��h0��h0��h0��h0��h0��h0��h0��h0��h0��h0��h0��h0��h0��h0��h0��h0��h0��h0��h0��h0��h0��h0��h0��h0��h0��h0��h0��h0��7713e94ba049816e4604cccbac934cd6e04a4afe32dfa1f7b31995bce6d226137719304df806ca5cd68c1f1c7e0139e0c11ed14fede560ae192d3c4d1989e83987e71d74400186ed7e4784f3e60dc91f4f4fb2eb0ec14bfe9a7ebf9102efc0e46fcae62497fe593cddef9db50ea32ec8893799cf9f76bf993eed4b17db15553d73483f797a83373fca1b968c11785b98c4fc4803cdc7d3210811ca8b075d6d76da7eabb7bafdf7d3ae5e9f223aa5bdc1eece45ac569dc21b3b037520b446476801d621eef165cf4d3d3dbb737aa0699178d94c6f18cf87e9dde6db3ca7790f468177f97513213526df2cf6184d8ff986c675afb514d4e68a404010521b880643a708a513caa60a881b954e4af56873cd14af1f9e53312f9bf7a8119c47a71204de667845ca3d06ee9f552bf16183cf8c34ad361ce4dea291141ac6fbac98eb879e479a96a9621654a991886823c756266c0bc9727fdc631922875111af0991344f73546393b3f5f133b52f8c4582e93e93e61a5d2787e251443ed67d23128049ab0682d788f8dabfc79fd92a41d959fa877debdd110464ee5eef5af5ff1c0afc1592cebe94201b161ad361e8a1d18b5b79ffda5cb9d7d2cfce87729c47f70c5f8393b5a55810e9042c655e7d92d28519ef88398337f866c867097626f25422a3ee1473b5696d7e1d57035c9e60c46ba9936a9ddb2d3f73110a52f453ddd1e05c46c340f4428095ff1a78bdc99684fe66d5d9d6173c0b529524be425471d9db7f388fa2aa3177af5edb291a081035deb3855457f94f19f0306aeadce2d560c49ebd3248e122898cf084613dc523dec9cc38fdcc6bebbbc7fb3e002010d351e420e88f56bce373cea3a304ac4d0a635205a384f8dbfe3bbc18f7f6fffc0f3ac93f4d7617e2e39cfad70857fc5207e2e738c2bc3fd2c6379cfab9c5ddf414eb3daf72fc8234a197823d9ef5a6d8944396981cc5abe020b016e88f0e5b0f72b70952b4cdc233211ebcbbecd9285cfdbf0a0d71ab67a0e7fd2fd8aa30bd12bdbcca6ae3d24f4fc8bac3e7d0fb154ca1f8f3dbba59c6fc10d494712eb168f3cad7186ecd4c7713�x������������� �������X�#]gJjaros@�����8"������bu�����
����������������bu�8	$?�d��&�,�	8�	w���������	�
�"�(0<	B
HT
(7F��	���(�8�9�:�G�H�I�X�	Y�	\$]0^Mbd�e�f�l�����
��			g	h	 Ccpanel-perl-536-data-dumper-concise2.0231.cp108~el7CPAN module - Less indentation and newlines plus sub deparsingCpanel build perl module 'Data::Dumper::Concise'Less indentation and newlines plus sub deparsingb�bh-centos-7.dev.cpanel.net,Uperlcpanel/perlhttps://metacpan.orglinuxnoarch��	y�$�$�$Y�Y�oY�815e66ad0f4949f8a4dd65e352e19d60ee6eea5181992b2141addeffa39ad2bc2b4cdc4cbf4b350a2fee38cdf103bbf8aa4d231bf9b3e85d2a4234d8596f7f2ae44a2edd0fdd653f29450c3fa9e975d53b06bfab3a0cb23851678769e80036cdbrootrootrootrootrootrootcpanel-perl-536-data-dumper-concise-2.023-1.cp108~el7.src.rpm������������cpanel-perl(Data::Dumper::Concise)cpanel-perl(Data::Dumper::Concise::Sugar)cpanel-perl(Devel::Dwarn)cpanel-perl-536-data-dumper-concise-sugarcpanel-perl-536-devel-dwarncpanel-perl-data-dumper-concisecpanel-perl-data-dumper-concise-sugarcpanel-perl-devel-dwarncpanel-perl-536-data-dumper-concise




cpanel-perl-536cpanel-perl-536-data-dumpercpanel-perl-536-exporterrpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(CompressedFileNames)rpmlib(PayloadIsXz)rpmlib(TildeInVersions)4.6.0-14.0-13.0.4-15.2-14.10.0-14.11.1b�@`-@Y��S>��Q+R@Busy Camels <bc@cpanel.net> - 2.023-1.cp108Busy Camels <bc@cpanel.net> - 2.023-1.cp1198Todd Rinaldo <toddr@cpanel.net> - 2.023-1.cp1170Todd Rinaldo <toddr@cpanel.net> - 2.022-1.cp1146Todd Rinaldo <toddr@cpanel.net> - 2.020-1.cp1136- Bump to 1.cp108 for re-build- Bump to 1.cp1198 for debian re-build- Update from upstream: Data-Dumper-Concise 2.023- Update from upstream: Data-Dumper-Concise 2.022- Update from upstream: Data-Dumper-Concise 2.0202.0232.02302.02302.0232.02302.023-1.cp108~el7Concise.pmSugar.pmDwarn.pm/usr/local/cpanel/3rdparty/perl/536/cpanel-lib/Data/Dumper//usr/local/cpanel/3rdparty/perl/536/cpanel-lib/Data/Dumper/Concise//usr/local/cpanel/3rdparty/perl/536/cpanel-lib/Devel/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches   -m64 -mtune=genericcpioxz2noarch-redhat-linux-gnu?������,��C2�TE5?J28c70bb0cc331568c2e4f50367d5e9d99949f034c�VE.�c�VAPM macro- update to PHP 5.5.3
- improve system libzip patch
- fix typo and add missing entries in php.ini- update to PHP 5.5.1 for php55 SCL- rebuild for new httpd-mmn value- remove ZTS conditional stuf for ligibility
- add mod_php for apache 2.4 (from httpd24 collection)- improve mod_php, pgsql and ldap description
- add missing man pages (phar, php-cgi)
- add provides php(pdo-abi) for consistency with php(api) and php(zend-abi)
- use %__isa_bits instead of %__isa in ABI suffix #985350- add security fix for CVE-2013-4113
- add missing ASL 1.0 license- run tests during build- rebase to 5.4.16
- fix hang in FindTishriMolad(), #965144
- patch for upstream Bug #64915 error_log ignored when daemonize=0
- patch for upstream Bug #64949 Buffer overflow in _pdo_pgsql_error, #969103
- patch for upstream bug #64960 S�x���������������������X�#FgJje maxkXy�������������������������� MITKRB5-SA-2004-004 (CAN-2004-1189)- fix deadlock during file transfer via rsync/krsh
- thanks goes to James Antill for hint- rebuild- fix predictable-tempfile-name bug in krb5-send-pr (CAN-2004-0971, #140036)- silence compiler warning in kprop by using an in-memory ccache with a fixed
  name instead of an on-disk ccache with a name generated by tmpnam()- fix globbing patch port mode (#139075)- fix segfault in telnet due to incorrect checking of gethostbyname_r result
  codes (#129059)- remove rc4-hmac:norealm and rc4-hmac:onlyrealm from the default list of
  supported keytypes in kdc.conf -- they produce exactly the same keys as
  rc4-hmac:normal because rc4 string-to-key ignores salts
- nuke kdcrotate -- there are better ways to balance the load on KDCs, and
  the SELinux policy for it would have been scary-looking
- update to 1.3.5, mainly to include MITKRB5SA 2004-002 and 2004-003- rebuild- rebuild- incorporate revised fixes from Tom Yu for CAN-2004-0642, CAN-2004-0644,
  CAN-2004-0772- rebuild- incorporate fixes from Tom Yu for CAN-2004-0642, CAN-2004-0772
  (MITKRB5-SA-2004-002, #130732)
- incorporate fixes from Tom Yu for CAN-2004-0644 (MITKRB5-SA-2004-003, #130732)- fix indexing error in server sorting patch (#127336)- rebuilt- update to 1.3.4 final- update to 1.3.4 beta1
- remove MITKRB5-SA-2004-001, included in 1.3.4- rebuild- rebuild- apply updated patch from MITKRB5-SA-2004-001 (revision 2004-06-02)- rebuild- apply patch from MITKRB5-SA-2004-001 (#125001)- removed rpath- re-enable large file support, fell out in 1.3-1
- patch rcp to use long long and %lld format specifiers when reporting file
  sizes on large files- update to 1.3.3- update to 1.3.2- rebuild- rebuilt- rebuilt- catch krb4 send_to_kdc cases in kdc preference patch- remove patch to set TERM in klogind which, combined with the upstream fix in
  1.3.1, actually produces the bug now (#114762)- when iterating over lists of interfaces which are "up" from getifaddrs(),
  skip over those which have no address (#113347)- prefer the kdc which last replied to a request when sending requests to kdcs- fix combination of --with-netlib and --enable-dns (#82176)- remove libdefault ticket_lifetime option from the default krb5.conf, it is
  ignored by libkrb5- fix bug in patch to make rlogind start login with a clean environment a la
  netkit rlogin, spotted and fixed by Scott McClung- include profile.d scriptlets in krb5-devel so that krb5-config will be in
  the path if krb5-workstation isn't installed, reported by Kir Kolyshkin- add more etypes (arcfour) to the default enctype list in kdc.conf
- don't apply previous patch, refused upstream- fix 32/64-bit bug storing and retrieving the issue_date in v4 credentials- Don't check for write access on /etc/krb5.conf if SELinux- fixup some int/pointer varargs wackiness- rebuild- update to 1.3.1- pull fix for non-compliant encoding of salt field in etype-info2 preauth
  data from 1.3.1 beta 1, until 1.3.1 is released.- update to 1.3- correctly use stdargs- test update to 1.3 beta 4
- ditch statglue build option
- krb5-devel requires e2fsprogs-devel, which now provides libss and libcom_err- rebuilt- gcc 3.3 doesn't implement varargs.h, include stdarg.h instead- update to 1.2.8- fix double-free of enc_part2 in krb524d- update to latest patch kit for MITKRB5-SA-2003-004- add patch included in MITKRB5-SA-2003-003 (CAN-2003-0028)- add patches from patchkit from MITKRB5-SA-2003-004 (CAN-2003-0138 and
  CAN-2003-0139)- rebuild- fix buffer underrun in unparsing certain principals (CAN-2003-0082)- add patch to document the reject-bad-transited option in kdc.conf- add patch to fix server-side crashes when principals have no
  components (CAN-2003-0072)- add patch from Mark Cox for exploitable bugs in ftp client- rebuilt- use PICFLAGS when building code from the ktany patch- debloat- include .so.* symlinks as well as .so.*.*- always #include <errno.h> to access errno, never do it directly
- enable LFS on a bunch of other 32-bit arches- inc�x���������������������X#/gJj) [1��������`�
�Q����������������������Qٛ�(�12-10Nalin Dahyabhai <nalin@redhat.com> - 1.12-9Nalin Dahyabhai <nalin@redhat.com> - 1.12-8Nalin Dahyabhai <nalin@redhat.com> - 1.12-7Nalin Dahyabhai <nalin@redhat.com> - 1.12-6Nalin Dahyabhai <nalin@redhat.com> - 1.12-5Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> - 1.12-4Nalin Dahyabhai <nalin@redhat.com> - 1.12-3Nalin Dahyabhai <nalin@redhat.com> - 1.12-2Nalin Dahyabhai <nalin@redhat.com> - 1.12-1Nalin Dahyabhai <nalin@redhat.com> - 1.12-beta2.0Nalin Dahyabhai <nalin@redhat.com> - 1.12-beta1.0Nalin Dahyabhai <nalin@redhat.com> - 1.11.4-2Nalin Dahyabhai <nalin@redhat.com> - 1.11.4-1Nalin Dahyabhai <nalin@redhat.com> - 1.11.3-31Nalin Dahyabhai <nalin@redhat.com> - 1.11.3-30Nalin Dahyabhai <nalin@redhat.com> - 1.11.3-29Nalin Dahyabhai <nalin@redhat.com> - 1.11.3-28Nalin Dahyabhai <nalin@redhat.com> - 1.11.3-27Nalin Dahyabhai <nalin@redhat.com> - 1.12-alpha1.0Nalin Dahyabhai <nalin@redhat.com> - 1.11.3-26Nalin Dahyabhai <nalin@redhat.com> - 1.11.3-25Nalin Dahyabhai <nalin@redhat.com> - 1.11.3-24Nalin Dahyabhai <nalin@redhat.com> - 1.11.3-23Nalin Dahyabhai <nalin@redhat.com> - 1.11.3-22Nalin Dahyabhai <nalin@redhat.com> - 1.11.3-21Nalin Dahyabhai <nalin@redhat.com> - 1.11.3-20Nalin Dahyabhai <nalin@redhat.com> - 1.11.3-19Nalin Dahyabhai <nalin@redhat.com> - 1.11.3-18Nalin Dahyabhai <nalin@redhat.com> - 1.11.3-17Nalin Dahyabhai <nalin@redhat.com> - 1.11.3-16Nalin Dahyabhai <nalin@redhat.com> - 1.11.3-15Nalin Dahyabhai <nalin@redhat.com> - 1.11.3-14Nalin Dahyabhai <nalin@redhat.com> - 1.11.3-13Nalin Dahyabhai <nalin@redhat.com> - 1.11.3-12Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 1.11.3-11Nalin Dahyabhai <nalin@redhat.com> 1.11.3-10Nalin Dahyabhai <nalin@redhat.com> 1.11.3-9Nalin Dahyabhai <nalin@redhat.com> 1.11.3-8Nalin Dahyabhai <nalin@redhat.com> 1.11.3-7Nalin Dahyabhai <nalin@redhat.com> 1.11.3-6Nalin Dahyabhai <nalin@redhat.com> 1.11.3-5Nalin Dahyabhai <nalin@redhat.com> 1.11.3-4Nalin Dahyabhai <nalin@redhat.com> 1.11.3-3Nalin Dahyabhai <nalin@redhat.com> 1.11.3-2Nalin Dahyabhai <nalin@redhat.com> 1.11.3-1Nalin Dahyabhai <nalin@redhat.com> 1.11.2-10Nalin Dahyabhai <nalin@redhat.com> 1.11.2-9Nalin Dahyabhai <nalin@redhat.com> 1.11.2-8Nalin Dahyabhai <nalin@redhat.com> 1.11.2-7Nalin Dahyabhai <nalin@redhat.com> 1.11.2-6Nalin Dahyabhai <nalin@redhat.com> 1.11.2-5Nathaniel McCallum <npmccallum@redhat.com> 1.11.2-4Nalin Dahyabhai <nalin@redhat.com> 1.11.2-3Nalin Dahyabhai <nalin@redhat.com> 1.11.2-2Nalin Dahyabhai <nalin@redhat.com> 1.11.2-1Nalin Dahyabhai <nalin@redhat.com> 1.11.1-9Nathaniel McCallum <npmccallum@redhat.com> - 1.11.1-8Nalin Dahyabhai <nalin@redhat.com> 1.11.1-7Nalin Dahyabhai <nalin@redhat.com> 1.11.1-6Nalin Dahyabhai <nalin@redhat.com> 1.11.1-5Nalin Dahyabhai <nalin@redhat.com>Nathaniel McCallum <npmccallum@redhat.com> 1.11.1-4Nalin Dahyabhai <nalin@redhat.com> 1.11.1-3Nalin Dahyabhai <nalin@redhat.com> 1.11.1-2Nalin Dahyabhai <nalin@redhat.com> 1.11.1-1Nalin Dahyabhai <nalin@redhat.com> 1.11-2Nalin Dahyabhai <nalin@redhat.com> 1.11-1Nalin Dahyabhai <nalin@redhat.com> 1.11-0.beta2.0Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 1.11-0.beta1.0Nalin Dahyabhai <nalin@redhat.com> 1.11-0.alpha1.1Nalin Dahyabhai <nalin@redhat.com> 1.11-0.alpha1.0Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 1.10.3-7Nalin Dahyabhai <nalin@redhat.com> 1.10.3-6Nalin Dahyabhai <nalin@redhat.com> 1.10.3-5Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 1.10.3-4Nalin Dahyabhai <nalin@redhat.com> 1.10.3-3Nalin Dahyabhai <nalin@redhat.com> 1.10.3-2Nalin Dahyabhai <nalin@redhat.com> 1.10.3-1Nalin Dahyabhai <nalin@redhat.com> 1.10.2-7Nalin Dahyabhai <nalin@redhat.com> 1.10.2-6Nalin Dahyabhai <nalin@redhat.com> 1.10.2-5Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.10.2-4Nalin Dahyabhai <nalin@redhat.com> 1.10.2-3Nalin Dahyabhai <nalin@redhat.com> 1.10.2-2Nalin Dahyabhai <nalin@redhat.com> 1.10.�x��������������������X�#�gJjtainPi��������������T�����,�����������������T�T�r� Orton <jorton@redhat.com> 5.1.2-3Joe Orton <jorton@redhat.com> 5.1.2-2Joe Orton <jorton@redhat.com> 5.1.1-8Joe Orton <jorton@redhat.com> 5.1.1-7Joe Orton <jorton@redhat.com> 5.1.1-6Jesse Keating <jkeating@redhat.com>Joe Orton <jorton@redhat.com> 5.1.1-5Joe Orton <jorton@redhat.com> 5.1.1-4Joe Orton <jorton@redhat.com> 5.1.1-3Joe Orton <jorton@redhat.com> 5.1.1-2Tomas Mraz <tmraz@redhat.com> 5.0.5-6Joe Orton <jorton@redhat.com> 5.0.5-5Joe Orton <jorton@redhat.com> 5.0.5-4Joe Orton <jorton@redhat.com> 5.0.5-3Joe Orton <jorton@redhat.com> 5.0.4-11Joe Orton <jorton@redhat.com> 5.0.4-10Joe Orton <jorton@redhat.com> 5.0.4-9Joe Orton <jorton@redhat.com> 5.0.4-8Joe Orton <jorton@redhat.com> 5.0.4-7Joe Orton <jorton@redhat.com> 5.0.4-6Joe Orton <jorton@redhat.com> 5.0.4-5Joe Orton <jorton@redhat.com> 5.0.4-4Joe Orton <jorton@redhat.com> 5.0.4-3Joe Orton <jorton@redhat.com> 5.0.4-2Joe Orton <jorton@redhat.com> 5.0.4-1Joe Orton <jorton@redhat.com> 5.0.3-5Joe Orton <jorton@redhat.com> 5.0.3-4Joe Orton <jorton@redhat.com> 5.0.3-3Joe Orton <jorton@redhat.com> 5.0.3-2Joe Orton <jorton@redhat.com> 5.0.3-1Joe Orton <jorton@redhat.com> 5.0.2-8Joe Orton <jorton@redhat.com> 5.0.2-7Joe Orton <jorton@redhat.com> 5.0.2-6Joe Orton <jorton@redhat.com> 5.0.2-5Joe Orton <jorton@redhat.com> 5.0.2-4Joe Orton <jorton@redhat.com> 5.0.1-4Joe Orton <jorton@redhat.com> 5.0.1-3Joe Orton <jorton@redhat.com> 5.0.1-2Joe Orton <jorton@redhat.com> 5.0.1-1Tom Callaway <tcallawa@redhat.com>Tom Callaway <tcallawa@redhat.com>- EA4-136: Fix libxml2 v2.15.0 compatibility- ZC-12167: Correct libxml2 problem- EA-11821: Patch to build with the latest ea-libxml2- ZC-10950: Fix build problems- ZC-10936: Clean up Makefile and remove debug-package-nil- EA-10532: Update litespeed to 8.0.1- ZC-9589: Update DISABLE_BUILD to match OBS- EA-9013: Disable %check section- EA-9625: Update litespeed to 7.9- EA-9390: Fix build with latest ea-brotli (v1.0.9)- EA-9281: Update litespeed from upstream to 7.8- EA-9189: Update litespeed from upstream to 7.7- EA-8928: Updated the required version for ea-libcurl- ZC-6270: Fix circular deps like EA-8854- ZC-6247: Deal with rpm conflicts with php-fpm and other rpms- EA-8762: Update litespeed from upstream to 7.6- ZC-4361: Fix bogus changelog dates- EA-8549: Build php-fpm with pcntl- EA-8576: Update litespeed from upstream to 7.5- EA-8558: Update litespeed from upstream to 7.4.2- EA-8538: Update litespeed from upstream to 7.4- ZC-5036: Add find-latest-version (assumes PHP is checked out next ro ea-tools)- EA-8342: Update litespeed to new upstream update of 7.3- EA-8342: Update litespeed to 7.3- EA-8170: Update litespeed to the latest version (7.2)- Fixed php-fpm installing directories it does not own (EA-7526)- EA-7359: Ensure ea-libxml2 is listed as a requirement for the php-xml package.- ZC-3601: Update litespeed to the latest version (7.1).- EA-7382: Update dependency on ea-openssl to require the latest version with versioned symbols.- ZC-3552: Added versioning to ea-openssl and ea-libcurl requirements.- ZC-3475: Update for ea-openssl shared object- HB-3287: Increase open file limit for php-fpm by default- HB-3263: Ensure securetmp is done before starting FPM- EA-7044: Adjust PHPs to use ea-libxml2- HB-3061: Fix epoll bug.- EA-7008: init openssl for FTP like 7.x does- EA-6812: build PHP against ea-openssl like Apache- EA-4653: Update mail header patch for PHP 5.5- HB-2873: Added network-online.target to "After" in the service file- EA-6819: Patch to support libtidy 5.4.0- EA-4197: make php.ini directives consistent w/ other versions- EA-6574: Make permissions on FPM socket dir more secure- EA-6484: Clarify Summary and Description for DSO- EA-6232: Build -curl with HTTP/2 support- EA-6292: Switch libxml2 to OS provided libraries- EA-6282: Swapped ea-php## symlinks to match EasyApache 3 compatibility- Switch libxml2 to cPanel distributed packages- EA-6063: Add ea-php55 binary symlinks to /usr/bin and /usr/local/bin- Disable dtrace�x��������������������XW#�gJjrl-5x��������������������������������������alin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Prospector <bugzilla@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Bill Nottingham <notting@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Bill Nottingham <notting@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Jeff Johnson <jbj@redhat.com>Cristian Gafton <gafton@redhat.com>Bill Nottingham <notting@redhat.com>Cristian Gafton <gafton@redhat.com>Cristian Gafton <gafton@redhat.com>Preston Brown <pbrown@redhat.com>Bill Nottingham <notting@redhat.com>Preston Brown <pbrown@redhat.com>- Rebuild with alt-krb5 for CentOS8- Rebuild with alt-openssl11 1.1.1- Use OpenSSL-1.0.2+ API for host name verification (#1788572)- Do not fallback to checking CN when no SAN matched (#1740070)- Reference default system-wide CA certificates in manpages (#1611624)- Backport upstream fixes for ITS 7595 - add OpenSSL EC support (#1623497)- Rebuilt for https://fedoraproject.org/wiki/Fedora_29_Mass_Rebuild- Build with LDAP_USE_NON_BLOCKING_TLS (#1594928)
- Remove unused leftover MozNSS Compat. Layer references (cont.) (#1557967)- Perl 5.28 rebuild- Remove unused leftover MozNSS Compat. Layer references (#1557967)- MozNSS Compat. Layer: Make log messages more clear (#1598103)
- MozNSS Compat. Layer: Fix memleaks reported by valgrind (#1595203)- Perl 5.28 rebuild
- MozNSS Compat. Layer: Fix typos, and spelling in the README file header (#1564161)- Rebase to version OpenLDAP 2.4.46 (#1559652)- Utilize system-wide crypto-policies (#1483979)- fix: openldap does not use Fedora build flags
  + makes use of redhat-rpm-config package
- Drop superfluous back-sql linking patch- MozNSS Compat. Layer: fix: libldap tlsmc continues even after it fails to extract CA certificates (#1550110)- TLS: Use system trusted CA store by default (#1270678, #1537259)- Complete change: Disable TLSMC in F29+- Escape macros in %changelog
- Disable TLSMC in F29+
- Remove obsolete Group tag
- Don't call ldconfig in servers subpackage
- Switch to %ldconfig_scriptlets
- Remove unneeded Requires(post): systemd-sysv, chkconfig
- Switch to %systemd_requires
- Change BuildRequires: systemd-units to systemd- Drop TCP wrappers support (#1531487)- MozNSS Compat. Layer fixes (#1400570)
  - fix incorrect parsing of CACertDir (orig. #1533955)
  - fix PIN disclaimer not always shown (orig. #1516409)
  - fix recursive directory deletion (orig. #1516409)
  - Ensure consistency of a PEM dir before usage (orig. #1516409)
    + Warn just before use of a PIN about key file extraction
  - Enable usage of NSS DB with PEM cert/key (orig. #1525485)
    + Fix a possible invalid dereference (covscan)- Rebuilt for switch to lib�x�������������x�������XD#^fJj500c��������8��������������������������������vate wstrlen due to versioned syms, patch from debian
  package of newt
- both of the above needed to be forward-ported- rebuild- rebuild for python 2.4- only do gpmclose if gpmopen succeeed (#118530)- make the python version dynamic (#114419)- rebuilt- rebuilt- rebuilt- rebuild for python 2.3- rebuild- incorporated listbox cursor location patch (#69903)- fixed help line drawing in UTF-8 (#81718)
- calculate the width of text in entries using wstrlen
- always set component width to the new label width in newtLabelSetText
- fixed snack.CListbox to work properly with UTF-8 (#81718)- add symlink to shared lib- cleaned up const qualifiers in interfaces
- added Ctrl-L screen refresh
- fixed segfault in test.c when listbox items are selected
- accessibility: made newt useable with monochrome terms (#60931)
- leave the symbols in the libs (#60400)
- fixed grammar in tutorial (#63496)
- error checking (curcomp exists) for formEvent, newtFormGetCurrent,
  removed fifty button limit (#59027)- fixed wstrlen() it was calculating wcwidth(first wide char in
  string) * strlen(str) instead of the actual width of the whole
  string
- fixed newtRedrawHelpLine() to copy all the bytes from a multibyte
  string- Merge multilib changes- changes for element width calculation for UTF-8
- fix textwrap for UTF-8 in general
- bump soname to avoid shared library collisions with slang- Changed a test to check for 'None' the correct way- don't hardcode linedrawing characters in the scrollbar code- minor tweaks for use with UTF-8 slang- add newtListboxGetItemCount() API call
- include numeric percentage in scale widget appearace
- add support for ESC key using NEWT_KEY_ESCAPE- build for whatever version of python happens to be installed- remove python2 subpackage
- compile package for python 2.2- s/Copyright/License/
- Add slang-devel to build dependencies (#49542)- re-ordered the width key of CheckboxTree.__init__; #52319- right anchor the internal Listbox of CListboxes, so that empty
- scrollable CListboxes do not look like crape.- padded hidden checkboxes on CheckboxTrees- taught CheckboxTrees about width. Whohoo! 2-D!!!- added 'hide_checkbox' and 'unselectable' options to CheckboxTrees- CListBox -> CListbox for API consistency
- fixup replace() method of CListbox- few bugfixes to the CListBox- added python binding for newtListboxClear() for Listbox and CListBox
- let ButtonBars optionally be made of CompactButtons- added CListBox python convenience class- added python binding for CompactButton()- change from using SLsmg_touch_screen to SLsmg_touch_lines to prevent
  excessive flashing due to screen clears when using touch_screen (more
  Japanese handling)- redraw the screen in certain situations when LANG=ja_JP.eucJP to
  prevent corrupting kanji characters (#34362)- Allow python scripts to watch file handles
- Fix 64-bit warnings in snackmodule
- Misc snack.py cleanups
- Add NEWT_FD_EXCEPT to allow watching for fd exceptions
- In newtExitStruct, return the first file descriptor that an event occurred on- don't blow the stack if we push a help line that is longer than the
  curret number of columns
- clip window to screen bounds so that if we get a window that is
  larger than the screen we can still redraw the windows behind it
  when we pop- disable building new-python2 sub package again- gave up on separate CHANGES file
- added newtCheckboxTreeSetCurrent() and snack binding
- don't require python2 anymore- don't build newt-python2 sub package.- use %{_tmppath}
- add python2 subpackage, with such support
- fix use of append in snack.py- bytecompile the snack python module
- move the libnewt.so symlink to the devel package
- include popcorn.py and peanuts.py in the devel package,
  so we have some documentation of the snack module- fixed cursor disappearing in suspend (again)- explicit requirement of devel subpackage on same version of main package
  so that .so file link doesn't break- fixed cursor disappearing in suspend
- moved libnewt.so to main package from -devel- adde�x�������������������X�#gJj���b��������x������������v�����������������B��?��d��
��	�	4�������������	��������	0�
��	P�'@�
,��/��3,�6�6��9x:
:8
;Q
(;�8;�c9=c:L�cGit�Hl4�In��Xo�Yo�\o��]r��^��	b��d�Je�Of�Rl�Tt�l�u�,�v��	w���x���y�\�����������
����$�(���g��h��Cpcre-devel8.3217.el7Development files for pcreDevelopment files (Headers, libraries for dynamic linking, etc) for pcre.Y�Bc1bm.rdu2.centos.org��CentOSBSDCentOS BuildSystem <http://bugs.centos.org>Development/Librarieshttp://www.pcre.org/linuxx86_64Zv��mg�L388��Q��3$�>K	��H�	#��	�	m�������u��Q���U�'�#8;?@�pN�2(�T��L�/x�%z<��-�<E�<�����;�
4�!$"�!$"Q����������j
p����M����������c����
m����1	��F���큤������������������������������A큤A큤����������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������Y�BY�BY�BY�BY�BY�BY�BY�B
Y�B
Y�B
Y�BY�BY�BY�BY�BY�BY�BY�BP��"P���P��oP��mP��mP��mP��mP��mP��mP��mP��mP��mP��nP��nP��nP��nP��nP��nP��nP��nP��nP��nP��nP��nP��nP��nP��nP��nP��nP��nP��nP��nP��nP��nP��nP��nP��nP��nP��mP��nP��nP��nP��nP��nP��nP��nP��oP��oP��oP��oP��mP��oP��mP��oOM�1P��mP��mO�Y�BY�BY�BY�BY�BY�BY�BY�BY�BY�BY�BY�BY�BY�BY�BY�BY�BY�BY�BY�BY�BY�BY�BY�BY�BY�BY�BY�BY�BY�BY�BY�BY�BY�BY�BY�BY�BY�BY�BY�BY�BY�BY�BY�BY�BY�BY�BY�BY�BY�BY�BY�BY�BY�BY�BY�BY�BY�BY�BY�BY�BY�BY�BY�BY�BY�BY�BY�BY�BY�BY�BY�BY�BY�BY�BY�BY�BY�BY�BY�BY�BY�BY�BY�BY�BY�BY�BY�BY�BY�BY�BY�BY�BY�BY�BY�BY�BY�BY�BY�B64295a39805867cd29dd225a27c8ae6f294effb08ebae3b5820d044f4bac29090818881a038fec9bfd77d9b13e69316d87c6de1d8695f4f79014af40354fe0217442638d75522e87497d442425dc51a6d69ef6bed73c8ab266dbb73343039fb6b0abc5ac4e2b132cb6461b53f99a87a71e3f41b45d0a2e613162a8eadbba2a3e165767e52e03797cbbce3e6147e2436459f8b468ffecefedfd8477c157aecfe789912f03f8da84f71c4645385d45e7d6af6e286601285e432249da3b5420b98b1770f2b30c0af2f24543428173cf6e6479e921045efdbd009fd07817b84e04ada035420a973fd484fb862d40056bb4742b27dd470efc9dc348853373bcc9258d83f400860c6a92a382264c878f442e0172077895cf8ff70a532ea31e981c10de8924acb3b1bbe6473d9da1ebcefe59d7�x�������������h��������X�#�gJj��������h��������i�����E�����������������i�i�D�\?��d����	'�	A�|�����������	��������'H'	�'
�'�'g'
'�'c'&T'�
,
�
(�8��9��:D��=��>��?��@��F��G�'H��'I�8'X�`Y�d\�x']�'^��b�bc��d�le�qf�tl�vz�������������
����$�('�Pg�Th�XCcpanel-analytics1.4.593.3.1.cpanelcPanel Analytics includesProvides Template Toolkit files that inject analytics scripts into
cPanel, Webmail, and WHM. Installs Perl module for cPanel update gatherer functions.

Also includes the following analytic tools:

 * gather_update_log_stats - tool that runs daily to gather and
   send update logs. Replaces gather-update-logs.i�<hou-2v5cpanel-plugins-production / CentOS_7_standardcPanel, L.L.C.cPanelpluginlinuxnoarch#!/bin/bash

/usr/local/cpanel/scripts/gather_update_logs_setupcrontab ||:

# CPANEL-40938: fixup cron.d file if it does not end with a newline
if [ -e /etc/cron.d/cpanel-analytics ]; then
    if [ $(tail --bytes=1 /etc/cron.d/cpanel-analytics | perl -e 'print ord(<>);') -ne 10 ]; then
        echo >> /etc/cron.d/cpanel-analytics
    fi
fi

# CPANEL-43416: Remove '/etc/cron.daily/summarize-api1-logs' since the cronjob was
# left in place on upgrades after the script was removed
rm -f /etc/cron.daily/summarize-api1-logs ||:#!/bin/bash

# Package removal, not upgrade
if [[ "$1" == "0" || "$1" == "remove" || "$1" == "purge" ]]; then
    /usr/local/cpanel/scripts/gather_update_logs_setupcrontab off ||:
fi"&���)#''�'�hD�K��qo\���Th�24��
��E���>�C$����A큤����������������������������������������������������������������������i�<i�<i�<i�<i�<i�<i�<i�<i�<i�<i�<i�<i�<i�<i�<i�<i�<i�<i�<i�<i�<i�<i�<i�<i�<i�<i�<i�<i�<i�<i�<i�<i�<i�<i�<i�<i�<i�<i�<6894360eba6971180f7ad1b6029817921324f2f4cf9a289cb00c4bd9de718ae069634d1acde03b57691918b420ae3af5c8fcaa9acb0a69a098fa5dad7e237d311ec68a22e63fe79f4a56758cae3236057a282faed510d8bb55829dd44fec7daeb726230c7f63fe198939eeb40fc50c7b0a15c86b328353268deffb4433dda21bbb843ef44fc4787f98c49ba8670ec136872234269c34b7867250c561344d0948ae5ed18daa801ccfb924733c254cf2eb2ed3597b66eb4276357b9d1072a172b48a9efa0a5c28bff4c60f6f7426accf79f4cc96fc68ac8824f9c6087ece556a5347890f68706b2fe452c846da9174ef8b987100f7f6eb597a9aa2921cdabf434b08b8d63b1a9bec82c57beb37061021ffc13ab550cdaa419bd7ce66e9371d8923cb0c27f00f2ee7f1491ff6b980acf952487a567cf7525d8a2e9afc8aeb764e510fa236f8a2a2f4f11615ee5d5d5d85c3c15b4de184001a4a33ad57fd32f4a54616a027ba9fe8901b50c7d799188abd867030443485bc8eb6f8318ac09e4ad3d4fcc52144b2195ea3d535b8bdc20a5ab6d677b44251f163bfc5aa842fce70f722407348fb9bc0a0d675d002ec08b33ca607c996d08bbdfa35637ce8fe0e943eb6339a17ea22c75d4816678648099a270ece5a2b11964859f1a70651029bbb27c02762dd8768be4b41cb2633d58b4f34df61e812ff697f02466dd89119db60560078244b979380021f7b0da3253976806c63153c3de54cf910c85eeace700c63f71c766b7c8906f7c1e02080c1ca38985089c0c441be4e806da9bf0262a18b4b12fc03bf1d43c1e4ec6c7455ec453b6594965f5ae79ea1b3ee5cdeea096a89e717a214c11c3c4e6da86e1f8594f593db92a2afdd6d0d072e04972e4ddf28a71335315803�x�����0c�������X#�eJj��������`�{����������������������{�w|��444433556666666655537788888877399::::99;;;;;33<<====<3>>????????>>>/////@@AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@BBCCCCCCCCCCCCCCCCCCCCCCCCCCCCBBBBBBBBBBBBBDDDDEEFFFGGGGGGFHIJJimunify-coreimunify-agent-proxyimunify-agent-proxy.confdefence360agent__init__.py__main__.py__pycache____init__.cpython-311.opt-1.pyc__init__.cpython-311.pyc__main__.cpython-311.opt-1.pyc__main__.cpython-311.pyc_version.cpython-311.opt-1.pyc_version.cpython-311.pycdefence360.cpython-311.opt-1.pycdefence360.cpython-311.pycmigrate.cpython-311.opt-1.pycmigrate.cpython-311.pycrouter.cpython-311.opt-1.pycrouter.cpython-311.pycrun.cpython-311.opt-1.pycrun.cpython-311.pycsentry.cpython-311.opt-1.pycsentry.cpython-311.pyc_version.pyapi__init__.py__pycache____init__.cpython-311.opt-1.pyc__init__.cpython-311.pychealth.cpython-311.opt-1.pychealth.cpython-311.pycinactivity.cpython-311.opt-1.pycinactivity.cpython-311.pycintegration_conf.cpython-311.opt-1.pycintegration_conf.cpython-311.pycjwt_issuer.cpython-311.opt-1.pycjwt_issuer.cpython-311.pycnewsfeed.cpython-311.opt-1.pycnewsfeed.cpython-311.pycpam_auth.cpython-311.opt-1.pycpam_auth.cpython-311.pychealth.pyinactivity.pyintegration_conf.pyjwt_issuer.pynewsfeed.pypam_auth.pyserver__init__.py__pycache____init__.cpython-311.opt-1.pyc__init__.cpython-311.pycanalyst_cleanup.cpython-311.opt-1.pycanalyst_cleanup.cpython-311.pyccleanup_revert.cpython-311.opt-1.pyccleanup_revert.cpython-311.pycevents.cpython-311.opt-1.pycevents.cpython-311.pycreputation.cpython-311.opt-1.pycreputation.cpython-311.pycsend_message.cpython-311.opt-1.pycsend_message.cpython-311.pycanalyst_cleanup.pycleanup_revert.pyevents.pyreputation.pysend_message.pyapplication__init__.py__pycache____init__.cpython-311.opt-1.pyc__init__.cpython-311.pycdetermine_hosting_panel.cpython-311.opt-1.pycdetermine_hosting_panel.cpython-311.pycsettings.cpython-311.opt-1.pycsettings.cpython-311.pyctags.cpython-311.opt-1.pyctags.cpython-311.pycdetermine_hosting_panel.pysettings.pytags.pycontracts__init__.py__pycache____init__.cpython-311.opt-1.pyc__init__.cpython-311.pycconfig.cpython-311.opt-1.pycconfig.cpython-311.pycconfig_provider.cpython-311.opt-1.pycconfig_provider.cpython-311.pyceula.cpython-311.opt-1.pyceula.cpython-311.pychook_events.cpython-311.opt-1.pychook_events.cpython-311.pychooks.cpython-311.opt-1.pychooks.cpython-311.pyclicense.cpython-311.opt-1.pyclicense.cpython-311.pycmessages.cpython-311.opt-1.pycmessages.cpython-311.pycmyimunify_id.cpython-311.opt-1.pycmyimunify_id.cpython-311.pycpermissions.cpython-311.opt-1.pycpermissions.cpython-311.pycplugins.cpython-311.opt-1.pycplugins.cpython-311.pycsentry.cpython-311.opt-1.pycsentry.cpython-311.pycconfig.pyconfig_provider.pyeula.pyhook_events.pyhooks.pylicense.pymessages.pymyimunify_id.pypermissions.pyplugins.pysentry.pydefence360.pyfeature_management__init__.py__pycache____init__.cpython-311.opt-1.pyc__init__.cpython-311.pyccheckers.cpython-311.opt-1.pyccheckers.cpython-311.pycconstants.cpython-311.opt-1.pycconstants.cpython-311.pyccontrol.cpython-311.opt-1.pyccontrol.cpython-311.pycexceptions.cpython-311.opt-1.pycexceptions.cpython-311.pychooks.cpython-311.opt-1.pychooks.cpython-311.�x�������������X��������X�#gJjuch 0R������`�
�=�����}�����������������=�=�=�hat.com> - 0.4.3.2-7Thomas Woerner <twoerner@redhat.com> - 0.4.3.2-6Thomas Woerner <twoerner@redhat.com> - 0.4.3.2-5Thomas Woerner <twoerner@redhat.com> - 0.4.3.2-4Thomas Woerner <twoerner@redhat.com> - 0.4.3.2-3Thomas Woerner <twoerner@redhat.com> - 0.4.3.2-2Thomas Woerner <twoerner@redhat.com> - 0.4.3.2-1Thomas Woerner <twoerner@redhat.com> - 0.4.3.1-1Thomas Woerner <twoerner@redhat.com> - 0.4.3-3Thomas Woerner <twoerner@redhat.com> - 0.4.3-2Thomas Woerner <twoerner@redhat.com> - 0.4.3-1Thomas Woerner <twoerner@redhat.com> - 0.4.2-1Thomas Woerner <twoerner@redhat.com> - 0.3.9-14Thomas Woerner <twoerner@redhat.com> - 0.3.9-13Thomas Woerner <twoerner@redhat.com> - 0.3.9-12Thomas Woerner <twoerner@redhat.com> - 0.3.9-11Thomas Woerner <twoerner@redhat.com> - 0.3.9-10Thomas Woerner <twoerner@redhat.com> - 0.3.9-9Thomas Woerner <twoerner@redhat.com> - 0.3.9-8Jiri Popelka <jpopelka@redhat.com> - 0.3.9-7Jiri Popelka <jpopelka@redhat.com> - 0.3.9-6Thomas Woerner <twoerner@redhat.com> - 0.3.9-5Thomas Woerner <twoerner@redhat.com> - 0.3.9-4Thomas Woerner <twoerner@redhat.com> - 0.3.9-3Thomas Woerner <twoerner@redhat.com> - 0.3.9-2Thomas Woerner <twoerner@redhat.com> - 0.3.9-1Daniel Mach <dmach@redhat.com> - 0.3.8-2Jiri Popelka <jpopelka@redhat.com> - 0.3.8-1Jiri Popelka <jpopelka@redhat.com> - 0.3.7-1Jiri Popelka <jpopelka@redhat.com> - 0.3.6.2-1Jiri Popelka <jpopelka@redhat.com> - 0.3.6.1-1Jiri Popelka <jpopelka@redhat.com> - 0.3.6-1Jiri Popelka <jpopelka@redhat.com> - 0.3.5-1Thomas Woerner <twoerner@redhat.com> 0.3.4-1Jiri Popelka <jpopelka@redhat.com>Thomas Woerner <twoerner@redhat.com> 0.3.3-2Thomas Woerner <twoerner@redhat.com> 0.3.3-1Jiri Popelka <jpopelka@redhat.com> - 0.3.2-2Jiri Popelka <jpopelka@redhat.com> - 0.3.2-1Jiri Popelka <jpopelka@redhat.com> - 0.3.1-2Thomas Woerner <twoerner@redhat.com> 0.3.1-1Thomas Woerner <twoerner@redhat.com> 0.3.0-1Jiri Popelka <jpopelka@redhat.com> - 0.2.12-5Jiri Popelka <jpopelka@redhat.com> - 0.2.12-4Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 0.2.12-3Jiri Popelka <jpopelka@redhat.com> - 0.2.12-2Thomas Woerner <twoerner@redhat.com> 0.2.12-1Thomas Woerner <twoerner@redhat.com> 0.2.11-2Thomas Woerner <twoerner@redhat.com> 0.2.11-1Thomas Woerner <twoerner@redhat.com> 0.2.10-1Thomas Woerner <twoerner@redhat.com> 0.2.9-1Thomas Woerner <twoerner@redhat.com> 0.2.8-1Jiri Popelka <jpopelka@redhat.com> 0.2.7-2Thomas Woerner <twoerner@redhat.com> 0.2.7-1Thomas Woerner <twoerner@redhat.com> 0.2.6-1Thomas Woerner <twoerner@redhat.com> 0.2.5-1Thomas Woerner <twoerner@redhat.com> 0.2.4-1Thomas Woerner <twoerner@redhat.com> 0.2.3-1Thomas Woerner <twoerner@redhat.com> 0.2.2-1Thomas Woerner <twoerner@redhat.com>Thomas Woerner <twoerner@redhat.com> 0.2.1-1Thomas Woerner <twoerner@redhat.com> 0.2.0-2Thomas Woerner <twoerner@redhat.com> 0.2.0-1Thomas Woerner <twoerner@redhat.com> 0.1.3-1Thomas Woerner <twoerner@redhat.com> 0.1.2-1Thomas Woerner <twoerner@redhat.com> 0.1.1-1Thomas Woerner <twoerner@redhat.com> 0.1-1- doc: clarify --set-target values "default" vs "reject"- fix(zone): cache rule_str for rich rules- feat(service): add RH-Satellite-6-Capsule- fix: add logrotate policy
- fix: checkIP6: strip leading/trailing square brackets- fix: firewalld not falling back to interface zone- fix: failure to load modules no longer fatal- fix: Revert "ebtables: drop support for broute table"- fix: direct: removeRules() not removing all rules in chain- doc: add --default-config and --system-config- fix: guarantee zone source dispatch is sorted by zone name- backport recent upstream stable fixes
- backport fix --remove-rules deleting all direct rules
- backport fix unable to delete rich rule forward-port
- backport fix forward-port for external zone hijacking internal zone
- backport fix testsuite iptables locking- backport recent upstream stable fixes
- backport fix to enable IP forwarding only if toaddr specified- rebase package to v0.6.3, include recent stable fixes
- use QT4 patch for firewa�x��������������s�������X*#�fJj [fs����������|����������������������|��u5��)- disable emitting profiling in functions marked with a special
  attribute (#1457969)- properly apply the PR70549 patch (#1349067)- promote reloads of a PLUS to RELOAD_OTHER (#1402585)- add -mstack-protector-guard={tls,global}, -mstack-protector-guard-reg=
  and -mstack-protector-guard-offset= options on ppc* (#1415952,
  PR target/78875)- fix up std::rethrow_exception (#1375711, PR libstdc++/62258)
- use _Unwind_GetIPInfo in __gcc_personality_v0 (#1387402, PR libgcc/78064)
- fix vec_vsx_ld/st on ppc64le (#1389801, PR target/72863, PR target/78084)
- fix ICE in gfc_compare_derived_types (#1369183)
- fix EH from C++ thunks (#1427412, PR ipa/68184)
- on ppc64{,le} emit nop after recursive call if the current function
  is replaceable (#1420723, PR target/79439)
- on aarch64 with -frounding-math use fnmul only with -(a*b) and not
  with (-a)*b (#1418446, PR target/66731)
- constrain std::valarray functions and operators (#1416214,
  PR libstdc++/69116)
- fix gimplification of aggregate assignments when lhs is used
  (#1396298, PR middle-end/72747, PR c/78408)
- fix aarch64 TLS with -mcmodel=large (#1389276, PR target/78796)
- fix aarch64 reloading of floating point constants into general purpose
  registers (#1349067, PR target/70549)
- fix DW_AT_decl_line on DW_TAG_enumeration_type for C enumeration
  definitions following forward declarations (#1423460, PR c/79969)- on aarch64 emit scheduling barriers before stack deallocation in
  function epilogues (#1362635, PR target/63293)- include vecintrin.h intrinsic header on s390 (#1182152)- backport OpenMP 4.5 support to libgomp (library only; #1357060,
  PRs libgomp/68579, libgomp/64625)- fix a bug in C++ ref-to-ptr conversion (#1344807)
- fix combiner handling of jumps on aarch64 (#1344672,
  PR rtl-optimization/52714)- ensure the timestamp on printers.py is always the same (#1344291)- backport s390 z13 support (#1182152)
- fix up -fsanitize=address on powerpc64 with 46-bit virtual address space
  (#1312850)
- throw exception on std::random_device::_M_getval() failure (#1262846,
  PR libstdc++/65142, CVE-2015-5276)- fix up libitm HTM fastpath (#1180633)
- on ppc64le default to -mcpu=power8 instead of -mcpu=power7 (#1213268)
- fix up size in .debug_pubnames (#1278872)
- turn powerpc* HTM insns into memory barriers (#1282755, PR target/67281)
- make sure to handle __builtin_alloca_with_align like alloca in
  -fstack-protector* (#1289022, PR tree-optimization/68680)
- improve DW_AT_abstract_origin of DW_TAG_GNU_call_site on s390 with -fPIC
  (#1312436)
- fix up libstdc++ pretty-printers (#1076690, PR libstdc++/53477)
- don't pass explicit --oformat option to ld on powerpc* (#1296211)
- backport Intel Memory Protection Keys ISA support - -mpku (#1304449)- fix up basic_streambuf copy constructor and assignment operator
  (#1243366)- backport aarch64 crc enablement - -mcpu=generic+crc (#1179935)
- rebuild against fixed binutils to fix up systemtap markers on aarch64
  (#1238462)- add --enable-targets=powerpcle-linux on ppc64le (#1237363)- update from the 4.8 branch (#1230103)
  - GCC 4.8.5 release
  - fix -imacros handling (#1004526, PR c/57653)
  - fix up IPA type handling (#1217267, PRs ipa/63551, ipa/64153)
  - add PowerPC analyze swaps optimization pass (#1208103, #1200336)
  - fix PowerPC vsx_extract_<mode>* patterns (#1206341)
  - fix PowerPC -mcrypto handling (#1200335)
  - Power8 unaligned vectorization improvements (#1199221, PR target/65456)
  - PRs ada/47500, ada/63225, bootstrap/64213, c++/56710, c++/58624,
	c++/63415, c++/63455, c++/64251, c++/64297, c++/64487, c++/65721,
	c++/65727, c/52769, c/61553, c/64766, debug/63342, debug/65549,
	fortran/56674, fortran/56867, fortran/57023, fortran/58813,
	fortran/59016, fortran/59024, fortran/59488, fortran/60898,
	fortran/61138, fortran/61407, fortran/63733, fortran/63744,
	fortran/63938, fortran/64244, fortran/64528, fortran/65024,
	gcov-profile/64634, inline-asm/63282, ipa/59626, ipa/63838,
	libfortran/63589, libgfortran/59513, libgfortran/60956, libgomp/61200,
	libstdc++/57440, li�x�������������Hc�������Xj#agJj[130��������{�������D�����P�����������������D]y�D�ory McIntire <cory@cpanel.net> - 5.4.45-73Tim Mullin <tim@cpanel.net> - 5.4.45-72Tim Mullin <tim@cpanel.net> - 5.4.45-71Tim Mullin <tim@cpanel.net> - 5.4.45-70Tim Mullin <tim@cpanel.net> - 5.4.45-69Daniel Muey <dan@cpanel.net> - 5.4.45-68Julian Brown <julian.brown@cpanel.net> - 5.4.45-67Tim Mullin <tim@cpanel.net> - 5.4.45-66Daniel Muey <dan@cpanel.net> - 5.4.45-65Tim Mullin <tim@cpanel.net> - 5.4.45-64Cory McIntire <cory@cpanel.net> - 5.4.45-63Cory McIntire <cory@cpanel.net> - 5.4.45-62Tim Mullin <tim@cpanel.net> - 5.4.45-61Daniel Muey <dan@cpanel.net> - 5.4.45-60Tim Mullin <tim@cpanel.net> - 5.4.45-59Tim Mullin <tim@cpanel.net> - 5.4.45-58Cory McIntire <cory@cpanel.net> - 5.4.45-57Tim Mullin <tim@cpanel.net> - 5.4.45-56Rishwanth Yeddula <rish@cpanel.net> - 5.4.45-55Cory McIntire <cory@cpanel.net> - 5.4.45-54Rishwanth Yeddula <rish@cpanel.net> - 5.4.45-53Cory McIntire <cory@cpanel.net> - 5.4.45-52Daniel Muey <dan@cpanel.net> - 5.4.45-51<darren@cpanel.net> - 5.4.45-50<darren@cpanel.net> - 5.4.45-49<cory@cpanel.net> - 5.4.45-48<julian.brown@cpanel.net> - 5.4.45-47<dan@cpanel.net> - 5.4.45-46<dan@cpanel.net> - 5.4.45-45<cory@cpanel.net> - 5.4.45-44Tim Mullin <tim@cpanel.net> - 5.4.45-43Dan Muey <dan@cpanel.net> - 5.4.45-42Cory McIntire <cory@cpanel.net> - 5.4.45-41Dan Muey <dan@cpanel.net> - 5.4.45-40Dan Muey <dan@cpanel.net> - 5.4.45-39Dan Muey <dan@cpanel.net> - 5.4.45-38Jacob Perkins <jacob.perkins@cpanel.net> - 5.4.45-37Jacob Perkins <jacob.perkins@cpanel.net> - 5.4.45-36Jacob Perkins <jacob.perkins@cpanel.net> - 5.4.45-35Jacob Perkins <jacob.perkins@cpanel.net> - 5.4.45-34Jacob Perkins <jacob.perkins@cpanel.net> - 5.4.45-33Jacob Perkins <jacob.perkins@cpanel.net> - 5.4.45-32Dan Muey <dan@cpanel.net> - 5.4.45-31Cory McIntire <cory@cpanel.net> - 5.4.45-30Cory McIntire <cory@cpanel.net> - 5.4.45-29Dan Muey <dan@cpanel.net> - 5.4.45-28Dan Muey <dan@cpanel.net> - 5.4.45-27Dan Muey <dan@cpanel.net> - 5.4.45-26Matt Dees <matt.dees@cpanel.net> 5.4.45-25Edwin Buck <e.buck@cpanel.net> 5.4.45-24S. Kurt Newman <kurt.newman@cpanel.net> - 5.4.45-23Jacob Perkins <jacob.perkins@cpanel.net> 5.4.45-22Matt Dees <matt@cpanel.net> - 5.4.45-21S. Kurt Newman <kurt.newman@cpanel.net> - 5.4.45-20Darren Mobley <darren@cpanel.net> - 5.4.45-19Julian Brown <julian.brown@cpanel.net> - 5.4.45-18Dan Muey <dan@cpanel.net> - 5.4.45-17S. Kurt Newman <kurt.newman@cpanel.net> - 5.4.45-16Jacob Perkins <jacob.perkins@cpanel.net> 5.4.45-15Jacob Perkins <jacob.perkins@cpanel.net> 5.4.45-14Jacob Perkins <jacob.perkins@cpanel.net> 5.4.45-13S. Kurt Newman <kurt.newman@cpanel.net> - 5.4.45-12S. Kurt Newman <kurt.newman@cpanel.net> - 5.4.45-11S. Kurt Newman <kurt.newman@cpanel.net> - 5.4.45-10Dan Muey <dan@cpanel.net> - 5.4.45-9David Nielson <david.nielson@cpanel.net> - 5.4.45-8S. Kurt Newman <kurt.newman@cpanel.net> - 5.4.45-7Jacob Perkins <jacob.perkins@cpanel.net> - 5.4.45-6S. Kurt Newman <kurt.newman@cpanel.net> - 5.4.45-5Dan Muey <dan@cpanel.net> - 5.4.45-4S. Kurt Newman <kurt.newman@cpanel.net> - 5.4.45-3Dan Muey <dan@cpanel.net> - 5.4.45-2Jacob Perkins <jacob.perkins@cpanel.net> - 5.4.45-1Kurt Newman <kurt.newman@cpanel.net> - 5.4.44-1Trinity Quirk <trinity.quirk@cpanel.net> - 5.4.38-7Darren Mobley <darren@cpanel.net> 5.4.38-6Darren Mobley <darren@cpanel.net> 5.4.38-5Darren Mobley <darren@cpanel.net> 5.4.38-4S. Kurt Newman <kurt.newman@cpanel.net> 5.4.38-3Dan Muey <dan@cpanel.net> 5.4.38-2S. Kurt Newman <kurt.newman@cpanel.net> - 5.4.38-1S. Kurt Newman <kurt.newman@cpanel.net> - 5.4.38-0Jan Kaluza <jkaluza@redhat.com> - 5.4.16-22Remi Collet <rcollet@redhat.com> - 5.4.16-20Remi Collet <rcollet@redhat.com> - 5.4.16-18Remi Collet <rcollet@redhat.com> - 5.4.16-16Remi Collet <rcollet@redhat.com> - 5.4.16-12Remi Collet <rcollet@redhat.com> 5.4.16-10Remi Collet <rcollet@redhat.com> 5.4.16-8Remi Collet <rcollet@redhat.com> - 5.4.16-7Remi Collet <rcollet@redhat.com> 5.4.16-4Remi Collet <rcollet@redhat.com> - 5.4.16-3Remi Collet <rcollet@redhat.com> �x��������������R�������X�#OfJjpR�%�c�����~�����������������c�c�_�I�$ƨ���7v����[�q-ek8H�:m�Y-,�D�>4��.��K���=g9OK�K*���B몧'��&:��w�:�[��]h̘p�ֺY�u�zG��o��)�)���/n+��᠋���r�G�&W却�Ԟ+�1|.�W�;ƐaO�1 �N�(bk�K�-�?|dᾱ>ç%o�7���(��B֠��ٵy��
ex�6�AķJ�W�s����Nٴ��i��B�Y���yR�c%��������A����`��J���E@��X�S�N��j�n�j�s�2ĵ�j��7?�M�j=f��N�~�4�/�:] ����=�=(̇2���o�'@F�5$W
7v�E'�mc���L
8��<3�fjgz0C,�x'T�I��X��f%ww�'"���EX�ީ�b���G<7�{�"n�����$g��#� HQ	tI�P�7;Ny�Yʟnb��Wf����t�M�.��8[�u���d8=g!0��ܜmΒ�(7��T�M�ډ_�I�$ƨ����-�|S7WG�R��C�7��e<P�8�����|�ǜ�3���G��l[�h]VS�n�
��}�紅�y5�Qm@����\S�!��Yfe���Q,g2zA��Z���Eq�����vYP�P��j��Ye��ν��^�h�z1ǐ=`�M�)�p�JYư���|�"�����Xǃ#3T=g����]�x|��L���<:��
0��г�~ wHئJ�'$p�z���mՂn�~E�i�>��l^�
b47�I}k�ò��/)�@���l�B%UG�=ʵĖ[�Hs>2_��g�?F��uY��B��>�1.%@�	��'�����%ؔ�E�Ī,���q&xۊI���$���s[˘��/��߿Jz��
�S��FXb��Q���%0j�g���i�m�'����h�X����DU��p�={A��Uد�S��
�`����5B�Y�k�{�06�2޻KG�n�}��^�\��$,�z�h��N,��L�(n�B�@N2075b0d4a7ed4f59c7c8d763b8e527b14fce082fbL����bL��iconfig(rpcbind)86Yconfig(abrt-addon-xorg)Xtconfig(abrt-retrace-client)uxWconfig(abrt-addon-vmcore)U1config(abrt-addon-kerneloops)Siconfig(abrt-dbus)Riconfig(abrt)Qi#config(libreport-plugin-rhtsupport)iPe config(libreport-plugin-ureport)aL�config(kernel)(gnF�config(usb_modeswitch))hEconfi@(�0@(�21
l'libbfd-2.27-44.base.el7_9.1.so()(64bit)libc.so.6(GLIBC_2.14)(64bit) HRblibc.so.6(GLIBC_2.13)(64bit)10��{�+Flibc.so.6(GLIBC_2.12)(64bit)�'1:<Rdoq|�������
���*>
FXz�
��	����������1
49GHRl
{libc.so.6(GLIBC_2.11)(64bit)�D���i�	��+1HQR�libc.so.6(GLIBC_2.10)(64bit)libc.so.6()(64bit)������	���>��(DE	ORl���libbz2.so.1()(64bit)��	*%libboost_thread-mt.so.1.53.0()(64bit)}�4%libboost_system-mt.so.1.53.0()(64bit)�\(libboost_date_time-mt.so.1.53.0()(64bit)� C	Dq	r libblkid.so.1(BLKID_2.23)(64bit)oH libblkid.so.1(BLKID_2.21)(64bit)bH libblkid.so.1(BLKID_2.20)(64bit)i 
H
R libblkid.so.1(BLKID_2.18)(64bit)����CD
�	��*HNRqr
# libblkid.so.1(BLKID_2.17)(64bit)���CD���*HNRqr* libblkid.so.1(BLKID_2.15)(64bit)8��
��*H
3libblkid.so.1(BLKID_1.0)(64bit)����	CD���*H	NRqr9libblkid.so.1()(64bit) �*H?libblkid�libbind9.so.160()(64bit)�
%#libbfd-2.27-41.base.el7.so()(64bit)*��libauparse.so.0()(64bit)V#libaugeas.so.0(AUGEAS_0.8.0)(64bit)��x�������������8B�������XS#�gJj��������P`������������j��������������������d connections
  + server: various fixes in mdb backend
  + server: various fixes in replication
  + server: various fixes in overlays and minor backends
  + documentation fixes
- remove patches which were merged upstream- rebuild due to libdb rebase- fix: Re-binding to a failed connection can segfault (#784989)- new upstream release
  + server: fixes in mdb backend
  + server: fixes in manual pages
  + server: fixes in syncprov, syncrepl, and pcache
- removed patches which were merged upstream- fix: missing options in manual pages of client tools (#796232)
- fix: SASL_NOCANON option missing in ldap.conf manual page (#732915)- fix: ldap_result does not succeed for sssd (#771484)
- Jan Synáček <jsynacek@redhat.com>:
  + fix: count constraint broken when using multiple modifications (#795766)- fix update: provide ldif2ldbm, not ldib2ldbm (#437104)
- Jan Synáček <jsynacek@redhat.com>:
  + unify systemctl binary paths throughout the specfile and make them usrmove compliant
  + make path to chkconfig binary usrmove compliant- new upstream release
  + MozNSS fixes
  + connection handling fixes
  + server: buxfixes in mdb backend
  + server: buxfixes in overlays (syncrepl, meta, monitor, perl, sql, dds, rwm)
- openldap-servers now provide ldib2ldbm (#437104)
- certificates management improvements
  + create empty Mozilla NSS certificate database during installation
  + enable builtin Root CA in generated database (#789088)
  + generate server certificate using Mozilla NSS tools instead of OpenSSL tools
  + fix: correct path to check-config.sh in service file (Jan Synáček <jsynacek@redhat.com>)
- temporarily disable certificates checking in check-config.sh script
- fix: check-config.sh get stuck when executing command as a ldap user- fix: replication (syncrepl) with TLS causes segfault (#783431)
- fix: slapd segfaults when PEM certificate is used and key is not set (#772890)- Rebuilt for https://fedoraproject.org/wiki/Fedora_17_Mass_Rebuild- new upstream release
  + server: support for delta-syncrepl in multi master replication
  + server: add experimental backend - MDB
  + server: dynamic configuration for passwd, perl, shell, sock, and sql backends
  + server: support passwords in APR1
  + library: support for Wahl (draft)
  + a lot of bugfixes
- remove patches which were merged upstream
- compile backends as modules (except BDB, HDB, and monitor)
- reload systemd daemon after installation- package cleanup:
  + hardened build: switch from LDFLAGS to RPM macros
  + remove old provides and obsoletes
  + add new slapd maintainance scripts
  + drop defattr macros, clean up permissions in specfile
  + fix rpmlint warnings: macros in comments/changelog
  + fix rpmlint warnings: non UTF-8 documentation
  + rename environment file to be more consistent (ldap -> slapd)
- replace sysv initscript with systemd service file (#
- new format of environment file due to switch to systemd
  (automatic conversion is performed)
- patch OpenLDAP to skip empty command line arguments
  (arguments expansion in systemd works different than in shell)
- CVE-2011-4079: one-byte buffer overflow in slapd (#749324)- rebuild: openldap does not work after libdb rebase (#743824)
- regression fix: openldap built without tcp_wrappers (#743213)- new feature update: honor priority/weight with ldap_domain2hostlist (#733078)- fix: SSL_ForceHandshake function is not thread safe (#701678)
- fix: allow unsetting of tls_* syncrepl options (#734187)- security hardening: library needs partial RELRO support added (#733071)
- fix: NSS_Init* functions are not thread safe (#731112)
- fix: incorrect behavior of allow/try options of VerifyCert and TLS_REQCERT (#725819)
- fix: memleak - free the return of tlsm_find_and_verify_cert_key (#725818)
- fix: conversion of constraint overlay settings to cn=config is incorrect (#733067)
- fix: DDS overlay tolerance parametr doesn't function and breakes default TTL (#733069)
- manpage fix: errors in manual page slapo-unique (#733070)
- fix: matching wildcard hostnames in certificate Subject fix��������������1������el/w�����������������`1���������������������5������ H���	�����������������0������� �[nZf�@�����������������/������@Providename@x����������������/������@�
8���������������P/�������



�����������4������ X���	x����������������.������x�~�[U��8�����������������-������8Groupen@�����������������-������@�@���������������H-��������������������81������ `���	p
����������������,������p
�o�+3� @�����������������+������@Requirenamelete@x���������������x+������@�	8���������������8+�������	��������������/������^ p���	`�����������������)������` �[nZf��r@�����������������)������@Providenamename@x���������������X)������@�8���������������)�����������������8,������� ���	P�����������������'������P!��p/#s�3�@����������������x'������@Conflictnameren@x���������������H'������@�8���������������'������������������*������ ���	@�����������������%������@"���x? ��@�����������������@Obsoletename @x���������������(%������@letex8����������������$������x����+������ ��(�	0�����������������#������0#��a9��!@�����������������@Triggername��!@x���������������#������@gernh8����������������"������hhy��������P)������  y�y	trans_virtio: enable VQs early (@������p-�������
@�����������������`!�������X.#TgJjpz
�<������������]��������������������olas van Oudtshoorn <vanoudt@gmail.com> - 1.2.2-1Parag Nemade <paragn AT fedoraproject DOT org> - 1.2.0-4Kalev Lember <kalevlember@gmail.com> - 1.2.0-3Parag Nemade <paragn AT fedoraproject DOT org> - 1.2.0-2Nicholas van Oudtshoorn <vanoudt@gmail.com> - 1.2.0-1Caolán McNamara <caolanm@redhat.com> - 1.1.1-4Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.1.1-3Peter Robinson <pbrobinson@fedoraproject.org> - 1.1.1-2Nicholas van Oudtshoorn <vanoudt@gmail.com> - 1.1.1-1Nicholas van Oudtshoorn <vanoudt@gmail.com> - 1.1.0-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.0.3-2Nicholas van Oudtshoorn <vanoudt@gmail.com> - 1.0.3-1Nicholas van Oudtshoorn <vanoudt@gmail.com> - 1.0.2-3Nicholas van Oudtshoorn <vanoudt@gmail.com> - 1.0.2-2Nicholas van Oudtshoorn <vanoudt@gmail.com> - 1.0.2-1Nicholas van Oudtshoorn <vanoudt@gmail.com> - 1.0.1-2Nicholas van Oudtshoorn <vanoudt@gmail.com> - 1.0.1-1- Resolves: rhbz#1472290
  CVE-2017-7771 CVE-2017-7772 CVE-2017-7773 CVE-2017-7774
  CVE-2017-7775 CVE-2017-7776 CVE-2017-7777 CVE-2017-7778- Related: rhbz#1309053 CVE-2016-1521 CVE-2016-1522 CVE-2016-1523 CVE-2016-1526- Resolves: rhbz#1309053 CVE-2016-1521 CVE-2016-1522 CVE-2016-1523 CVE-2016-1526- Rebuilt for https://fedoraproject.org/wiki/Fedora_24_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_23_Mass_Rebuild- Rebuilt for Fedora 23 Change
  https://fedoraproject.org/wiki/Changes/Harden_all_packages_with_position-independent_code- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_22_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_Mass_Rebuild- New upstream release- Move *.so.major symlink to main package.- Rebuilt for https://fedoraproject.org/wiki/Fedora_20_Mass_Rebuild- clarify licenses- use minimum texlive buildrequires, Than Ngo, rhbz#975843- New upstream release- Drop refman.pdf as its same as manual.html
- patch install path for cmake files as they are arch dependent- Move manual.html to -devel subpackage- revert the wrongly committed f18 spec to f19
- spec file cleanup
- thanks to jnovy for finding me minimum texlive BR
- partial multilib fix for manual.html- New upstream release- expand license field to cover tri-licenced GrUtfTextSrc test- Rebuilt for https://fedoraproject.org/wiki/Fedora_18_Mass_Rebuild- Fix FTBFS on ARM- New upstream release- New upstream release- Rebuilt for https://fedoraproject.org/wiki/Fedora_17_Mass_Rebuild- New upstream release- Obsolete silgraphite- Removed dependency on silgraphite-devel
- Stopped building comparerenderer - the only thing that depended on silgraphite- Rebase to new release
- SPEC Cleanup
- Documentation is now properly installed- Added some necessary requires- Initial build of graphite2/sbin/ldconfig/sbin/ldconfigsilgraphite	�1.3.10-1.el7_31.3.10-1.el7_32.3.1-5gr2fonttestlibgraphite2.so.3libgraphite2.so.3.0.1graphite2-1.3.10ChangeLogREADME.mdgraphite2-1.3.10COPYINGLICENSE/usr/bin//usr/lib64//usr/share/doc//usr/share/doc/graphite2-1.3.10//usr/share/licenses//usr/share/licenses/graphite2-1.3.10/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches   -m64 -mtune=genericcpioxz2x86_64-redhat-linux-gnuELF 64-bit LSB executable, x86-64, version 1 (SYSV), dynamically linked (uses shared libs), for GNU/Linux 2.6.32, BuildID[sha1]=9d28f975e0115186e852291d8cf4fbe4763bb4c7, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=e0de299f3f8b3628d77069fbe3a9d6261f0fd54d, strippeddirectoryASCII textUTF-8 Unicode textRRRRRR	RRR
RRPRRRRRR?���0�H�Yq��$ƨ���R���x���������������������X�#�fJj������������(!�����q�����������������.mopwmake.1.gzpwscore.1.gzpwquality.conf.5.gzpam_pwquality.8.gz/etc/security//usr/bin//usr/lib64//usr/lib64/security//usr/share/doc//usr/share/doc/libpwquality-1.2.3//usr/share/locale/ar/LC_MESSAGES//usr/share/locale/as/LC_MESSAGES//usr/share/locale/bg/LC_MESSAGES//usr/share/locale/bn_IN/LC_MESSAGES//usr/share/locale/ca/LC_MESSAGES//usr/share/locale/cs/LC_MESSAGES//usr/share/locale/da/LC_MESSAGES//usr/share/locale/de/LC_MESSAGES//usr/share/locale/es/LC_MESSAGES//usr/share/locale/eu/LC_MESSAGES//usr/share/locale/fi/LC_MESSAGES//usr/share/locale/fr/LC_MESSAGES//usr/share/locale/gu/LC_MESSAGES//usr/share/locale/he/LC_MESSAGES//usr/share/locale/hi/LC_MESSAGES//usr/share/locale/hu/LC_MESSAGES//usr/share/locale/it/LC_MESSAGES//usr/share/locale/ja/LC_MESSAGES//usr/share/locale/kk/LC_MESSAGES//usr/share/locale/km/LC_MESSAGES//usr/share/locale/kn/LC_MESSAGES//usr/share/locale/ko/LC_MESSAGES//usr/share/locale/ml/LC_MESSAGES//usr/share/locale/mr/LC_MESSAGES//usr/share/locale/mr_IN/LC_MESSAGES//usr/share/locale/ms/LC_MESSAGES//usr/share/locale/nb/LC_MESSAGES//usr/share/locale/nl/LC_MESSAGES//usr/share/locale/or/LC_MESSAGES//usr/share/locale/pa/LC_MESSAGES//usr/share/locale/pl/LC_MESSAGES//usr/share/locale/pt/LC_MESSAGES//usr/share/locale/pt_BR/LC_MESSAGES//usr/share/locale/ru/LC_MESSAGES//usr/share/locale/si/LC_MESSAGES//usr/share/locale/sk/LC_MESSAGES//usr/share/locale/sr/LC_MESSAGES//usr/share/locale/sr@latin/LC_MESSAGES//usr/share/locale/sv/LC_MESSAGES//usr/share/locale/ta/LC_MESSAGES//usr/share/locale/te/LC_MESSAGES//usr/share/locale/tr/LC_MESSAGES//usr/share/locale/uk/LC_MESSAGES//usr/share/locale/vi/LC_MESSAGES//usr/share/locale/zh_CN/LC_MESSAGES//usr/share/locale/zh_TW/LC_MESSAGES//usr/share/locale/zu/LC_MESSAGES//usr/share/man/man1//usr/share/man/man5//usr/share/man/man8/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches   -m64 -mtune=genericcpioxz2x86_64-redhat-linux-gnuASCII textELF 64-bit LSB executable, x86-64, version 1 (SYSV), dynamically linked (uses shared libs), for GNU/Linux 2.6.32, BuildID[sha1]=dddc2d6a1598c6f62cda78657c864e22f47a3ade, strippedELF 64-bit LSB executable, x86-64, version 1 (SYSV), dynamically linked (uses shared libs), for GNU/Linux 2.6.32, BuildID[sha1]=50a683a511e6fbe34cc90eb4c1c8e71b9dcdc236, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=c0a633923df18ad485b90215206a83cbfa257392, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=a971920013ca4aaaaa51890e6deb4d97bb0f9229, strippeddirectoryUTF-8 Unicode texttroff or preprocessor input, ASCII text (gzip compressed data, from Unix, max compression)
RRR	RRR
RRRR	RRRR
RRPPRRR	RRR
RRRR
RR	RRRR
RRR?���`L��Z�c�$ƨ����K�?�dp/���Q����3��qyx��Z����o���3�3,�C�/�������3��DnQpZ���x�������������P�������X3#�eJj��������������������p�����~����������������p�6�1dbcba8ba1243d8ddcaeec6f82250a21eb43ad8b0e4e2189eb041bfdc49200a71dbcba8ba1243d8ddcaeec6f82250a21eb43ad8b0e4e2189eb041169b60825f7726cfc8170ebc8e980ae0258721348d76079cfbf0191075d83969169b60825f7726cfc8170ebc8e980ae0258721348d76079cfbf0191075d83969b05c533b50676f0c3b7f3aa34350a4169d7efb6a43f1b5da7c7d37e27c3dc768e3b0c44298fc1c149afbf4c8996fb92427ae41e4649b934ca495991b7852b8551b9cb07d76c1bbdc2f59564e80e621a2577f8a06e8c49e30dc2a75440ca91c841b9cb07d76c1bbdc2f59564e80e621a2577f8a06e8c49e30dc2a75440ca91c84729f28102fc48ffcc108fac9fcf17ecf88b6d109307d6daa9ec121cae9e87d96f779f0a9e59a2316cb009de7fd887b2dd2e7297e00d29fb921636a55a6f1b647f779f0a9e59a2316cb009de7fd887b2dd2e7297e00d29fb921636a55a6f1b647b4aa9278a7e284a3f487495d24c950b35dc8ecd07cbc43c4a104061babedbc9ab4aa9278a7e284a3f487495d24c950b35dc8ecd07cbc43c4a104061babedbc9ab533909d39ae97339173100224535bcfbcfba0de7628c4682b32790773de5d74b533909d39ae97339173100224535bcfbcfba0de7628c4682b32790773de5d74ed045a7ace2ec201ae445eed58c12316c79bb69265f92600d821cdae3612b8dfed045a7ace2ec201ae445eed58c12316c79bb69265f92600d821cdae3612b8df41c37f8a91dba3897947f705c9d2e3a46163373c29fb7edb9573e3ca6417ee8a41c37f8a91dba3897947f705c9d2e3a46163373c29fb7edb9573e3ca6417ee8af8e91d5e620d2ddf483175bb2db0c8f4f592fc87f0691d3d5ce268cfd52a45db6b61db53d42262e80cbc9e954a986d32b68b22fee307a07fe446d6d6d363e046776484ddc8c9ec2f7ebfb0e42889b955dcdabefb9abc604cffebb53e44ffd1312c02f08727ad874eea083c97c4529cf2c3e40ecd3cb9fd89204a3ff5e3937963b4c5d6f6ac9fc127dcb53ae332227b34321294b15b8377fc0ff39fb21b2a6799da45f13754ab7a238225d4d88c44e8e26b3edb21853c6b7066f2b120143e5a6983a015fbb8cde633a0afb7a72f921b64c2119bce27306cc7f6db43f88000de4bf266ca44460d3756225e03a22a6f150af898b7b0861d2781af2b4e0e7092161b0ffdefad91c762fdc5a8c637f54d1af4c33f54a6d4602d2882b56edb611fdc1a15d1cf04d544f8e135055450b693484ec804649034d6bc2077aae3da55cde01bec4733d2c9bdc9b27e6b9431fb545d54ec7fb880ee8348997aaa1492bab5faa2e50dbb2d85bf4cb8f218456a93332cd33387bb968c92544054fe5d9578a0c88046ea8be24fcca19a0cf426d3f96c142050675964e0f03a63759cd3fc2131092046ea8be24fcca19a0cf426d3f96c142050675964e0f03a63759cd3fc21310920acf7219c6e0a072a46ad0c52cea899e09aad1716369cb1f1c2ed64e1b5c2ef35acf7219c6e0a072a46ad0c52cea899e09aad1716369cb1f1c2ed64e1b5c2ef35f36df5f140f937d8478fe7004849fab95e7bba9a36948a47e4e714077eda5ddae3b0c44298fc1c149afbf4c8996fb92427ae41e4649b934ca495991b7852b8550f3d3eb5c728aecb25d479932c7be69dd309035214c815645c03d3128fe3bbd40f3d3eb5c728aecb25d479932c7be69dd309035214c815645c03d3128fe3bbd4ace2028d042b7a489ae2c7924133dcc179dec82fcdabdf49fd8ddf8889bdc78cace2028d042b7a489ae2c7924133dcc179dec82fcdabdf49fd8ddf8889bdc78cc813ed8aa502a163bc37f548a81470958b87318c1bd094a9c8c267b4bd9613f6c813ed8aa502a163bc37f548a81470958b87318c1bd094a9c8c267b4bd9613f61fe49c56f38a1458692582a0d638ced5318864b658ceab71269157907854a3899db2619e853438de320697dc77e810376d87c2d47864b7ffc2c3813139a120a3e3b0c44298fc1c149afbf4c8996fb92427ae41e4649b934ca495991b7852b85583bce5b626d1cfbd9d40dc118b1f4caa8aafa21049cd0a54c8b0298b373e276383bce5b626d1cfbd9d40dc118b1f4caa8aafa21049cd0a54c8b0298b373e2763974f642a8a37a74189c3959a114b9a02446e95dbd01fb7fee30153521f48b251974f642a8a37a74189c3959a114b9a02446e95dbd01fb7fee30153521f48b251103c0dbfca476ff7cddd0854c303ce25904aa134ea0424e472ddc8d0e7fa4a03103c0dbfca476ff7cddd0854c303ce25904aa134ea0424e472ddc8d0e7fa4a03a8e7f510b3c37030928892968ac474e2ec9f318eb22d0f642564ec8673d732e3a8e7f510b3c37030928892968ac474e2ec9f318eb22d0f642564ec8673d732e3f3fbb9b20b1fd2aa7ab0b174e964fcecb60947a15858e3cb79b003a216a15f9af3fbb9b20b1fd2aa7ab0b174e964fcecb60947a15858e3cb79b003a216a15f9a843b2aeac10e22a48fc792b8d237753306e878cc4f6fbfdaf331cc54f4106ce7843b2aeac10e22a48fc792b8d237753306e878cc4f6fbfdaf331cc54f4106ce7915ec8359307895eaec5e3f28cb67a2589704f02a7939dc7f4c766da0062c2ca915ec8359307895eaec5e3f28cb67a2589704f02a7939dc7f4c766da0062c2cab92bd5feec06608750c88162a9438c3b4d7b8f61e7a7825d13118176899e2628b92bd5feec06608750c88162a9438c3b4d7b8f61e7a7825d13118176899e2628ce734fb7414a7f27dd66b77e01e8b0e9b46be2d1�x��������������������XO#�fJj�������`�6�����q����������������66~ate/Holidays//usr/local/cpanel/3rdparty/php/81/lib/php/Date/Holidays/Driver//usr/local/cpanel/3rdparty/php/81/lib/php/data//usr/local/cpanel/3rdparty/php/81/lib/php/data/Date_Holidays_UNO//usr/local/cpanel/3rdparty/php/81/lib/php/data/Date_Holidays_UNO/lang//usr/local/cpanel/3rdparty/php/81/lib/php/data/Date_Holidays_UNO/lang/UNO//usr/share/doc//usr/share/doc/cpanel-php81-date-holidays-uno-0.1.3/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches   -m64 -mtune=genericcpioxz2noarch-redhat-linux-gnuXML document textdirectoryC++ source, ASCII textUTF-8 Unicode text, with very long lines, with no line terminatorsASCII text, with very long lines, with no line terminatorsempty?���@24��j�44��$�K'
�1693d559fd8ef53ee3d1b8f3ab7e940ce9540930d6A=�td6A;AR: database abstraction layerPEAR MDB2 is a merge of the PEAR DB and Metabase php database abstraction
layers.

It provides a common API for all supported RDBMS. The main difference to
most
other DB abstraction packages is that MDB2 goes much further to ensure
portability. MDB2 provides most of its many features optionally that
can be used to construct portable SQL statements:
* Object-Oriented API
* A DSN (data source name) or array format for specifying database servers
* Datatype abstraction and on demand datatype conversion
* Various optional fetch modes to fix portability issues
* Portable error codes
* Sequential and non sequential row fetching as well as bulk fetching
* Ability to make buffered and unbuffered queries
* Ordered array and associative array for the fetched rows
* Prepare/execute (bind) named and unnamed placeholder emulation
* Sequence/autoincrement emulation
* Replace emulation
* Limited sub select emulation
* Row limit emulation
* Transactions/savepoint support
* Large Object support
* Index/Unique Key/Primary Key support
* Pattern matching abstraction
* Module framework to load advanced functionality on demand
* Ability to read the information schema
* RDBMS management methods (creating, dropping, altering)
* Reverse engineering schemas from an existing database
* SQL function call abstraction
* Full integration into the PEAR Framework
* PHPDoc API documentationa�e4bh-centos-7.dev.cpanel.netfBSD-2-ClauseDevelopment/Librarieshttp://pear.php.net/package/MDB2linuxnoarchecho /usr/local/cpanel/3rdparty/php/74/lib/pear/MDB2.xml >> /var/cpanel/.pending_pear_registrations# Only remove PEAR registry entry if this is a plain uninstall. For upgrades, leave it in place.
if [ x$1 = x0 ]; then echo pear.php.net/MDB2 >> /var/cpanel/.pending_pear_deregistrations ; fi�V#�M�~5
�E�f/ zG����>M$�s��A큤��A�A큤A큤A큤A큤A큤������A�A큤A�A�A큤����������A큤����F:0�a�e4a�e4a�e4a�e3a�e4a�e4a�e4a�e4a�e4a�e4a�e4a�e4a�e4a�e4a�e4a�e4a�e4a�e4a�e4a�e4a�e4a�e4a�e4a�e4a�e4a�e4a�e4a�e4a�e4a�e4a�e4a�e4a�e4bf8c47a83c8b895ca50bf111e642221ff4a5ea2e7250d2af21688ad5d6d0eddc33a98eadbd29387536e5f3e25b4c03c480bd55e539d6f1d0780bce40fa71f4e1af782fd0eca9b25a13209624b121cd09d341909c18446904b224103d05e5fb2ca70f055e1267f058f912a54ed9c808b98be124c44e67901f762d9aa10960c9c6e95f5344c78e703c6ef0ffb03b47686f06d0a05e1467068bbd593241f4ce8301be5bdf801495470cd7c6ef98e87c0fd37d817c5d1b1a14ab354040659283ae17db673aa82cbf509b32586b2cf4e391e9a525d21ff13fdd44ccfc1bb8c586c3d525ecaa5f3dfcc5cf516fde63a00b0fa2e0bf6117cb9143507c469d35286e2906a686cfdef3fd479e63fb3e6ac664221fd40b20dc109d9168a7ef42fdb26998d4fb1aaa3791a01c66fe671a6c8699cfff39309baf3aa7b0bedcd9ac1bb7aaeccf651b0eaa2090048ad612de7098a66�x�������������@�������X�#�gJj�����
 �����������	�����������������F��E�?�d����	�	9�������������	���4�:D�	�
�#
�<�	J	p	�
L

�
�
(�8�9:
F
�G
�HhI�X�Y\0]�^b�cyd�e�f�l�t�uXv�
w|x�yTz�����
0�\`|g�h�Cea-brotli1.0.92.2.4.cpanelBrotli compression formatBrotli is a generic-purpose lossless compression algorithm that compresses data using a combination of a
modern variant of the LZ77 algorithm, Huffman coding and 2nd order context modeling, with a compression
 ratio comparable to the best currently available general-purpose compression methods. It is similar in
 speed with deflate but offers more dense compression.f�H�hou-1�uEA4-production / CentOS_7cPanel, Inc.LGPLv2+ and GPLv2+System Environment/Librarieshttps://github.com/google/brotlilinuxx86_64:9h7�C�)�
7�-�+���7+�>��0KKA�A��A�A큤������A큤�����큤�����큤������A큤������f�H�f�H�f�H�f�H�f�H�_G�g_G�g_G�g_G�gf�H�f�H�f�H�f�H�f�H�f�H�f�H�f�H�f�H�f�H�f�H�f�H�f�H�f�H�f�H�f�H�f�H�f�H�2264a5d0775d6af246f8adf877092283420710ac898e1423b388111aae8ae30fa9665d09f77df18f8a1f4c948610474ebd8758ff3f3a0714842af0a12d263ee6dfc6f8e43b30e2e88c5cc9d1a4842aa967aa399e2ccd4eea3fb134a9902168122cffc986439dfac586589f538db721155229ac615dfad16300dd70aff7b718f696c9330e790aa6fe53f4cdd328d0a4b98e361b82913baa3219db73aadb11272c52833993c09c2912c4b9bdb96d534cd581659d90083e118026304b6385c935e3bdf6ed1adf6c11b2d8e5bbcdb05c06de2a7e8aa861fe343fd9f5245cc1dd936a880ede28732ff81fcabb653beab8966372f2b71524f50568a373f25e661a7314967d3ae6b10add5f2379c90df7c073333967244900c50cbb42df1733f07d687fe131961f67ebaa21b0a447285f7e76b63086487ab6bd9f0827eb1a2b656b9ce01777338fe2c02ea2b57eac8c064d1b32723fa3e39ba49bb8bcad098dae871d3352f8d7f5dceba2bb6c931f901a52d4768ab3693db9e2dde255dff3902de044624df87ce0ab8b83bfb40e09812403f0c791b6833a3faca0e896be57440baa256b9f7c88435af9e30f2f3f8c9520246b58371a8e053c9b63ca5644e9e079afcd18libbrotlicommon.so.1libbrotlicommon.so.1.0.9libbrotlidec.so.1libbrotlidec.so.1.0.9libbrotlienc.so.1libbrotlienc.so.1.0.9/opt/cpanel/ea-brotli/librootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootea-brotli-1.0.9-2.2.4.cpanel.src.rpm������������������������������������������������������������������������������������������������������������ea-brotliea-brotli(x86-64)libbrotlicommon.so.1()(64bit)libbrotlidec.so.1()(64bit)libbrotlienc.so.1()(64bit)@@@@@@@@


@
libbrotlicommon.so.1()(64bit)libbrotlidec.so.1()(64bit)libbrotlienc.so.1()(64bit)libc.so.6()(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libm.so.6()(64bit)libm.so.6(GLIBC_2.2.5)(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(Payl�x���������������������XF#�fJj�������������	������u��������������������> - 0.17-8Ding-Yi Chen <dchen at redhat dot com> - 0.17-7Ding-Yi Chen <dchen at redhat dot com> - 0.17-6Jens Petersen <petersen@redhat.com> - 0.17-5Jens Petersen <petersen@redhat.com> - 0.17-4Jens Petersen <petersen@redhat.com> - 0.17-3Jens Petersen <petersen@redhat.com> - 0.17-2Jens Petersen <petersen@redhat.com> - 0.17-1Jens Petersen <petersen@redhat.com> - 0.16.1-12Nils Philippsen <nphilipp@redhat.com> - 0.16.1-11Jens Petersen <petersen@redhat.com> - 0.16.1-10Jens Petersen <petersen@redhat.com>Jens Petersen <petersen@redhat.com> - 0.16.1-9Jens Petersen <petersen@redhat.com> - 0.16.1-8Jens Petersen <petersen@redhat.com> - 0.16.1-7Jens Petersen <petersen@redhat.com> - 0.16.1-6Karsten Hopp <karsten@redhat.com> 0.16.1-5Jens Petersen <petersen@redhat.com> - 0.16.1-4Jens Petersen <petersen@redhat.com> - 0.16.1-3Jens Petersen <petersen@redhat.com> - 0.16.1-1Jens Petersen <petersen@redhat.com> - 0.16-2Jens Petersen <petersen@redhat.com> - 0.16-1Jens Petersen <petersen@redhat.com> - 0.15-1Jens Petersen <petersen@redhat.com> - 0.14.6-3Jens Petersen <petersen@redhat.com> - 0.14.6-2Jens Petersen <petersen@redhat.com> - 0.14.6-1Thomas Fitzsimmons <fitzsim@redhat.com> - 0.14.5-4Jesse Keating <jkeating@redhat.com> - 0.14.5-3.1Karsten Hopp <karsten@redhat.de> 0.14.5-3Jesse Keating <jkeating@redhat.com> - 0.14.5-2.2.2Jesse Keating <jkeating@redhat.com> - 0.14.5-2.2.1Jesse Keating <jkeating@redhat.com> 0.14.5-2.2Jesse Keating <jkeating@redhat.com>Jindrich Novy <jnovy@redhat.com> 0.14.5-2Leon Ho <llch@redhat.com>Leon Ho <llch@redhat.com>Jakub Jelinek <jakub@redhat.com>Leon Ho <llch@redhat.com>Leon Ho <llch@redhat.com>Leon Ho <llch@redhat.com>Leon Ho <llch@redhat.com>Leon Ho <llch@redhat.com>Elliot Lee <sopwith@redhat.com>Leon Ho <llch@redhat.com>Leon Ho <llch@redhat.com>Leon Ho <llch@redhat.com>Leon Ho <llch@redhat.com>Elliot Lee <sopwith@redhat.com>Elliot Lee <sopwith@redhat.com>Leon Ho <llch@redhat.com>Leon Ho <llch@redhat.com>Elliot Lee <sopwith@redhat.com>Leon Ho <llch@redhat.com>Tim Powers <timp@redhat.com>Leon Ho <llch@redhat.com> 0.11.4-6Leon Ho <llch@redhat.com> 0.11.4-5Tim Powers <timp@redhat.com> 0.11.4-4Trond Eivind Glomsrød <teg@redhat.com> 0.11.4-3Nalin Dahyabhai <nalin@redhat.com> 0.11.4-2Trond Eivind Glomsrød <teg@redhat.com> 0.11.4-1Tim Powers <timp@redhat.com>Tim Powers <timp@redhat.com>Trond Eivind Glomsrød <teg@redhat.com> 0.11.2-1Trond Eivind Glomsrød <teg@redhat.com> 0.11.1-2Trond Eivind Glomsrød <teg@redhat.com> 0.11.1-1Florian La Roche <Florian.LaRoche@redhat.de>Tim Powers <timp@redhat.com>Trond Eivind Glomsrød <teg@redhat.com> 0.10.40-3Trond Eivind Glomsrød <teg@redhat.com> 0.10.40-2Trond Eivind Glomsrød <teg@redhat.com> 0.10.40-1Trond Eivind Glomsrød <teg@redhat.com> 0.10.38-7Trond Eivind Glomsrød <teg@redhat.com> 0.10.38-6Trond Eivind Glomsrød <teg@redhat.com>Trond Eivind Glomsrød <teg@redhat.com>Trond Eivind Glomsrød <teg@redhat.com>Trond Eivind Glomsrød <teg@redhat.com>Florian La Roche <Florian.LaRoche@redhat.de>Nalin Dahyabhai <nalin@redhat.com>Trond Eivind Glomsrød <teg@redhat.com>Trond Eivind Glomsrød <teg@redhat.com>Yukihiro Nakai <ynakai@redhat.com>Yukihiro Nakai <ynakai@redhat.com>Matt Wilson <msw@redhat.com>Trond Eivind Glomsrød <teg@redhat.com>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Trond Eivind Glomsrød <teg@redhat.com>Trond Eivind Glomsrød <teg@redhat.com>Prospector <bugzilla@redhat.com>Trond Eivind Glomsrød <teg@redhat.com>Preston Brown <pbrown@redhat.com>Bill Nottingham <notting@redhat.com>Cristian Gafton <gafton@redhat.com>Cristian Gafton <gafton@redhat.com>Cristian Gafton <gafton@redhat.com>Cristian Gafton <gafton@redhat.com>Cristian Gafton <gafton@redhat.com>Cristian Gafton <gafton@redhat.com>Cristian Gafton <gafton@redhat.com>Cristian Gafton <gafton@redhat.com>Cristian Gafton <gafton@redhat.com> Cristian Gafton <gafton@redhat.com>Cristian Gafton <gafton@redhat.com>Jeff Johnson <jbj@redhat.com>Cristian Gafton <gafto�x�������������0��������X#�gJj����p��������T�����6�����������������TqA�T�rton <jorton@redhat.com> - 5.3.6-4Remi Collet <Fedora@famillecollet.com> 5.3.6-3Remi Collet <Fedora@famillecollet.com> 5.3.6-2Remi Collet <Fedora@famillecollet.com> 5.3.6-1Joe Orton <jorton@redhat.com> - 5.3.5-6Caolán McNamara <caolanm@redhat.com> 5.3.5-5Remi Collet <Fedora@famillecollet.com> 5.3.5-4Remi Collet <Fedora@famillecollet.com> 5.3.5-3Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 5.3.5-2Remi Collet <Fedora@famillecollet.com> 5.3.5-1Remi Collet <rpms@famillecollet.com> 5.3.4-2Remi Collet <rpms@famillecollet.com> 5.3.4-1.1Remi Collet <Fedora@famillecollet.com> 5.3.4-1Remi Collet <Fedora@famillecollet.com> 5.3.3-5Joe Orton <jorton@redhat.com> - 5.3.3-4Joe Orton <jorton@redhat.com> - 5.3.3-3Remi Collet <Fedora@famillecollet.com> 5.3.3-2Remi Collet <Fedora@famillecollet.com> 5.3.3-1Remi Collet <Fedora@famillecollet.com> 5.3.2-3Caolán McNamara <caolanm@redhat.com> 5.3.2-2Remi Collet <Fedora@famillecollet.com> 5.3.2-1Joe Orton <jorton@redhat.com> - 5.3.1-3Joe Orton <jorton@redhat.com> - 5.3.1-2Remi Collet <Fedora@famillecollet.com> 5.3.1-1Tom "spot" Callaway <tcallawa@redhat.com> - 5.3.0-7Tomas Mraz <tmraz@redhat.com> - 5.3.0-6Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 5.3.0-5Joe Orton <jorton@redhat.com> 5.3.0-4Joe Orton <jorton@redhat.com> 5.3.0-3Joe Orton <jorton@redhat.com> 5.3.0-2Remi Collet <Fedora@famillecollet.com> 5.3.0-1Remi Collet <Fedora@famillecollet.com> 5.2.10-1Remi Collet <Fedora@FamilleCollet.com> - 5.2.9-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 5.2.8-10Joe Orton <jorton@redhat.com> 5.2.8-9Joe Orton <jorton@redhat.com> 5.2.8-8Joe Orton <jorton@redhat.com> 5.2.8-7Joe Orton <jorton@redhat.com> 5.2.8-5Joe Orton <jorton@redhat.com> 5.2.8-4Joe Orton <jorton@redhat.com> 5.2.8-3Remi Collet <Fedora@FamilleCollet.com> 5.2.8-2Remi Collet <Fedora@FamilleCollet.com> 5.2.8-1Remi Collet <Fedora@FamilleCollet.com> 5.2.7-1.1Remi Collet <Fedora@FamilleCollet.com> 5.2.7-1Joe Orton <jorton@redhat.com> 5.2.6-7Joe Orton <jorton@redhat.com> 5.2.6-6Remi Collet <Fedora@FamilleCollet.com> 5.2.6-5Remi Collet <Fedora@FamilleCollet.com> 5.2.6-4Joe Orton <jorton@redhat.com> 5.2.6-3Joe Orton <jorton@redhat.com> 5.2.5-7Fedora Release Engineering <rel-eng@fedoraproject.org> - 5.2.5-6Joe Orton <jorton@redhat.com> 5.2.5-5Joe Orton <jorton@redhat.com> 5.2.5-4Release Engineering <rel-eng at fedoraproject dot org> - 5.2.5-3Joe Orton <jorton@redhat.com> 5.2.5-2Joe Orton <jorton@redhat.com> 5.2.4-3Joe Orton <jorton@redhat.com> 5.2.4-2Joe Orton <jorton@redhat.com> 5.2.3-9Joe Orton <jorton@redhat.com> 5.2.3-8Hans de Goede <j.w.r.degoede@hhs.nl> 5.2.3-7Joe Orton <jorton@redhat.com> 5.2.3-6Joe Orton <jorton@redhat.com> 5.2.3-5Joe Orton <jorton@redhat.com> 5.2.3-4Joe Orton <jorton@redhat.com> 5.2.3-3Joe Orton <jorton@redhat.com> 5.2.3-2Joe Orton <jorton@redhat.com> 5.2.2-4Joe Orton <jorton@redhat.com> 5.2.2-3Joe Orton <jorton@redhat.com> 5.2.2-2Joe Orton <jorton@redhat.com> 5.2.1-5Joe Orton <jorton@redhat.com> 5.2.1-4Joe Orton <jorton@redhat.com> 5.2.1-3Joe Orton <jorton@redhat.com> 5.2.1-2Joe Orton <jorton@redhat.com> 5.2.0-10Joe Orton <jorton@redhat.com> 5.2.0-9Joe Orton <jorton@redhat.com> 5.2.0-8Joe Orton <jorton@redhat.com> 5.2.0-7Joe Orton <jorton@redhat.com> 5.2.0-6Joe Orton <jorton@redhat.com> 5.2.0-5Joe Orton <jorton@redhat.com> 5.2.0-4Joe Orton <jorton@redhat.com> 5.2.0-3Joseph Orton <jorton@redhat.com> 5.1.6-4Joe Orton <jorton@redhat.com> 5.1.6-3Joe Orton <jorton@redhat.com> 5.1.6-2Jesse Keating <jkeating@redhat.com> - 5.1.4-8.1Joe Orton <jorton@redhat.com> 5.1.4-8Joe Orton <jorton@redhat.com> 5.1.4-7Joe Orton <jorton@redhat.com> 5.1.4-6Radek Vokal <rvokal@redhat.com> 5.1.4-5.1Joe Orton <jorton@redhat.com> 5.1.4-5Joe Orton <jorton@redhat.com> 5.1.4-3Joe Orton <jorton@redhat.com> 5.1.3-3Joe Orton <jorton@redhat.com> 5.1.2-5Jesse Keating <jkeating@redhat.com> - 5.1.2-4.3Jesse Keating <jkeating@redhat.com> - 5.1.2-4.1Joe Orton <jorton@redhat.com> 5.1.2-4Joe�x����������������������X�#fJj������������X������4}�����\����������������4}�E�?'`?"�d����	+�	o�������������	��������	
�
������<=(�8�H9�H:�HF �G �H �I �X �Y �\!]!^!(b!~c"Cd"�e"�f"�l"�z"��"�"�"�$�%
' �'L'P'Tg'Xh'\Cea-php73-php-exif7.3.3314.19.13.cpanelA module for PHP applications that need to work with image metadataThe php-exif package delivers a module which will allow PHP scripts to
work with image meta data. For example, you may use exif functions to
read meta data of pictures taken from digital cameras by working with
information stored in the headers of the JPEG and TIFF images.i��hou-1�AEA4-production / CentOS_7cPanel, Inc.PHPDevelopment/Languageshttp://www.php.net/linuxx86_641�����i��Pi��Caa450c5aa707a649c9f63626feff9dbf9e94f5dbc7399ceae093493b786630c33e0b03318de0654d6a3ace660c77ecaa77415d2e6784a167d2f967b6ee411aacrootrootrootrootea-php73-php-7.3.33-14.19.13.cpanel.src.rpm��������ea-php73-php-exifea-php73-php-exif(x86-64)


@@@@@
ea-php73-php-commonea-php73-php-clirpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(CompressedFileNames)libc.so.6()(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.4)(64bit)rtld(GNU_HASH)rpmlib(PayloadIsXz)7.3.33-14.19.13.cpanel7.3.33-14.19.13.cpanel4.6.0-14.0-13.0.4-15.2-14.11.3h�R@g�@f�)@f�@e�4@e\��dd��d[�@d,@cl�b\@a�q@a��a�@@a�@aw�a]��aLl@a'�@`ݮ@`ٹ�`���`B@`�_���_�0@_Í@_�F@_���_�]@_u�_R,@_P�_+�_�@_�^�)@^�n@^��@^�x�^�2�^�H�^|�@^s^�^[��^Nt�^=Q@^)��]�f@]��]��]�|@]��@]���]z3@]nU�]B�@]5�@]#0@];�]�\�@\�s@\��\��@\���\��\��\�M�\��\~d�\\�Chris Castillo <chris.castillo@webpros.com> - 7.3.33-14Julian Brown <julian.brown@cpanel.net> - 7.3.33-13Julian Brown <julian.brown@cpanel.net> - 7.3.33-12Dan Muey <dan@cpanel.net> - 7.3.33-11Travis Holloway <t.holloway@cpanel.net> - 7.3.33-10Tim Mullin <tim@cpanel.net> - 7.3.33-9Brian Mendoza <brian.mendoza@cpanel.net> - 7.3.33-8Brian Mendoza <brian.mendoza@cpanel.net> - 7.3.33-7Julian Brown <julian.brown@cpanel.net> - 7.3.33-6Travis Holloway <t.holloway@cpanel.net> - 7.3.33-5Travis Holloway <t.holloway@cpanel.net> - 7.3.33-4Julian Brown <julian.brown@cpanel.net> - 7.3.33-3Julian Brown <julian.brown@cpanel.net> - 7.3.33-2Cory McIntire <cory@cpanel.net> - 7.3.33-1Dan Muey <dan@cpanel.net> - 7.3.32-2Cory McIntire <cory@cpanel.net> - 7.3.32-1Julian Brown <julian.brown@cpanel.net> - 7.3.31-2Cory McIntire <cory@cpanel.net> - 7.3.31-1Cory McIntire <cory@cpanel.net> - 7.3.30-1Cory McIntire <cory@cpanel.net> - 7.3.29-1Travis Holloway <t.holloway@cpanel.net> - 7.3.28-2Cory McIntire <cory@cpanel.net> - 7.3.28-1Cory McIntire <cory@cpanel.net> - 7.3.27-2Cory McIntire <cory@cpanel.net> - 7.3.27-1Cory McIntire <cory@cpanel.net> - 7.3.26-1Julian Brown <julian.brown@cpanel.net> - 7.3.25-2Cory McIntire <cory@cpanel.net> - 7.3.25-1Cory McIntire <cory@cpanel.net> - 7.3.24-1Daniel Muey <dan@cpanel.net> - 7.3.23-3Tim Mullin <tim@cpanel.net> - 7.3.23-2Cory McIntire <cory@cpanel.net> - 7.3.23-1Tim Mullin <tim@cpanel.net> - 7.3.22-2Cory McIntire <cory@cpanel.net> - 7.3.22-1Cory McIntire <cory@cpanel.net> - 7.3.21-1Tim Mullin <tim@cpanel.net> - 7.3.20-2Cory�x������������� ��������X|#YfJj������������������������������������������254e1e12dbb84db3914124a8c163b5bb132e17720f1b0db53d22b09ac404ef5455bcf3b1c0ad6b68077a0cd29500cf43c2a77bdcb5bbd596ffa3786be5f4b8fe672cb31a66620364293e2a3f02cabf1f0ba7b08b8fe0549b46f45fc90a225bdf1d46276c1aa1ab8d1682b95eefa1165a84d7a771f1cfbf7864c2d027e8197440d0fa2e3fb604c70e4541ba5ee2e5ca1ac3885c746e2678cdca9a8838653b38127869c8ea9fb6eb72578ace6b9f12918135bc23798283f6e59c00bd53e7e8659bfcb1d78c18dd25adf31ba6ebc8ee21e70ccabdad9fa7d34330f4e88054cf37ca386f9f298bbbfa14653dc6c6f2ae2697503050367de4d6442f79b462fa92a987582a396058326e3604b689b2801d5791086aea8371892036264353e9af5eadcf2f4f76c25487f25484624e045ed4f907e55750f1b1fb17cd414915e27f25ee5a9483f5e24006210c4a8e660ba8d7500aa95d5a143548ba8679479991b222014664dd9202fbaa81bac1314164c27e81f6f43f9f001486bd494f4849a73d60325baf5f89c9f723c79b9e27092df115f41781441d5c99f8bfaeb27936a557d8d6edb95b29b655ea8fe04a59760de0a23d8d83c40a793d40e6227e63e6110efa9f80670761886327dfec1442a19b2b3a7cfe95157502807083ea8f73cb6b23c65cb71f560a48ec2eb99ca8a07064a4b7375617554b387b27f54626941f5dd0928c42910635d395af94654203f14c6fa2c2ee49f05d9e66ef83eab166e4cff5d4dec538ae204355e475d92443d547b7ae7de397b4171d54e94853c6b6eba47a908b6d7cf75daf9f1c47a23a423ae9b2d6a286cd2858e7fd5eb970c48bfb0d085b7cb9fe8460ef3a27dc6faba94d08b8c6e201a608aa9bd1af4d8ef28f3b2d8b2bc6dbfa9e85618d35c0f4b13a782359af40ed03d578c9499843163934ca25cd2ac28313e784b42b129123a1505f5e58d17e1c75678255bef344d92dd28a3ec221f552cd149e7398b5d129532d5d0854f4ed63f4e3842272c4d0e4e864938b271b8f93a63e5650377533bd8a83afa422cb92a14fd0f8861c7730830b7e55d1e7e9e23b488f804735715e3d7101534aefc50e487370e880fe5218311a8261f40dd8b0d2ed3798ff54f8f77eb654e986e6c2f7563af8fdbc7a485b844b2f0a43ab68394ebaf081df3fd51da04acdcb3e2da2fb6c658d9bfa6ef92e0622a6e15a904a2c18b2b90ba6362c3ade41afcab2199f3a8e77263b1d1a69b9062339d04e52bec6d58a9d7619c1eed82c1ff866898d2e5a76e37c7d75f78e854499c6b0279e29b6eacef9d615a928acfb45f9dd53d73432ee431ebf38b8058830cece8359d78dd4637b2a72dda47ef851639fbf0acaf6e09206334d3b2c29c9b0d385156dfcb34f34b33722f0aee0d7b9dcf73c3efb239bb0a9ffb5df2dc49b8e733539663e4c6847e590b64f82c306d1e217d2acdbf017d3fbd529de1a2f13887ec9d55eacefce05d572784ede8c08b7b4ba95f52cfcfc3ae23a138349373ee41ee07ec91ab91e9466ffa99c75077099959f631a91fad479fc39323c24e453ccc1d24444b3f77cb38b920054907d84b74f6e6b9ee041a3f3868844ff8e0682d9a93b9b2f9eb4f88d3d254b1dc2c1db7c81f251a1bf1955eb151ad1ec36ae12fe6b17e9b6cd9fca221e31e94e86c74e039a94ae57dca19214634e009042606402dea9810e364ced05e681f25017d971dbf7c1974e8eb8e3fd14ca6a24b27b38c845bc6848ac90e0f45c610ebd1f359c68bc309233c4ede914e22173553268b04df2a404f7ccc5cfd7afade261d68d7b64bd82b245616c402193a4188e101c830900e7c4fdcadbfcea7dc20ee5941cd2de053d5553714139ca2f648c28b72e3601783bcb312bb3652a22fce5e607cc0cabeaa11c1cb63512e8ce5d820220e5c4a587c9c33f4eb411831f884257ede05153d56e7c210920b9beb7e8f7ffa4f44d0e8412d02b9a13e6d74be2a840e30447246d1bc13ee9095034853a940b188d490079d5767db775d24658fff4e63acd8bc554ac0324890a566831e1405e3e8d4cd52b455681832cb231cf095d58cb4ad8d40649e50aa789cc89b9b73866a3c53ae7fa41e7c963b1a38e2472ac12014c025ebc97c8917b3ab22caaf6418d92f6d20a4a8a42184a29e4c111ca4a3517ac2640031f751bf335e4b4136fa5ae421adaf02fc20d0a25172bc132eee210d225f72d5dff92e80946a1b80c6882455621ae667501414316515bc22a4d35e501151ed265d9fa78de8f5e15306e0f8603465dac8e61abb8499d2a01b031f0d443bb273f423504d7b027b8a83f720ff5a3b8c01896f4378ade2c2270f1b739b5b8318febfda326e4a2cc6c90c9bc46af0de72a61f149a76b95974769ebfcfd257c89e46d17b0d7ae21d290fdc1d94b56c065486f67901cc776d5692a796f18c74547144f43bc64fda9e1f42a158dc8852a7dc96921b6bcdf9bc7cb9c68511ccdc746094cd6d53cdec6b32f15a91bc6aa2c8219c46libnewt.so.0.52.15rootrootrootrootrootrootro�x����������������������Xk#2gJj����������GM�����/����������������GM�HM�>Nalin Dahyabhai <nalin@redhat.com> 1.6-2Nalin Dahyabhai <nalin@redhat.com> 1.5-23Nalin Dahyabhai <nalin@redhat.com> 1.5-22Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> - 1.5-20Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 1.6-1Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> - 1.5-18Nalin Dahyabhai <nalin@redhat.com> - 1.5-17Nalin Dahyabhai <nalin@redhat.com> - 1.5-16Nalin Dahyabhai <nalin@redhat.com> - 1.5-14Nalin Dahyabhai <nalin@redhat.com> - 1.5-12Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> - 1.5-11Nalin Dahyabhai <nalin@redhat.com> - 1.5-10Nalin Dahyabhai <nalin@redhat.com> - 1.5-9.pal_18695Nalin Dahyabhai <nalin@redhat.com> - 1.5-9Nalin Dahyabhai <nalin@redhat.com> - 1.5-8Nalin Dahyabhai <nalin@redhat.com> - 1.5-7Nalin Dahyabhai <nalin@redhat.com> - 1.5-6Nalin Dahyabhai <nalin@redhat.com> - 1.5-5Nalin Dahyabhai <nalin@redhat.com> - 1.5-4Nalin Dahyabhai <nalin@redhat.com> - 1.5-3Nalin Dahyabhai <nalin@redhat.com> - 1.5-2Nalin Dahyabhai <nalin@redhat.com> - 1.5-1.2Jesse Keating <jkeating@redhat.com> - 1.5-1.1Nalin Dahyabhai <nalin@redhat.com> 1.5-1Nalin Dahyabhai <nalin@redhat.com> 1.5-0Nalin Dahyabhai <nalin@redhat.com> 1.4.3-9Nalin Dahyabhai <nalin@redhat.com> 1.4.3-8Nalin Dahyabhai <nalin@redhat.com> 1.4.3-7Nalin Dahyabhai <nalin@redhat.com> 1.4.3-6Stepan Kasal <skasal@redhat.com> 1.4.3-5Jesse Keating <jkeating@redhat.com> 1.4.3-4.1Nalin Dahyabhai <nalin@redhat.com> 1.4.3-4Nalin Dahyabhai <nalin@redhat.com> 1.4.3-3Matthias Clasen <mclasen@redhat.com> 1.4.3-2Jesse Keating <jkeating@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 1.4.3-1Nalin Dahyabhai <nalin@redhat.com> 1.4.2-4Nalin Dahyabhai <nalin@redhat.com> 1.4.2-3Nalin Dahyabhai <nalin@redhat.com> 1.4.2-2Nalin Dahyabhai <nalin@redhat.com> 1.4.2-1Nalin Dahyabhai <nalin@redhat.com> 1.4.1-6Nalin Dahyabhai <nalin@redhat.com> 1.4.1-5Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 1.4.1-4Nalin Dahyabhai <nalin@redhat.com> 1.4.1-3Martin Stransky <stransky@redhat.com> 1.4.1-2Nalin Dahyabhai <nalin@redhat.com> 1.4.1-1Nalin Dahyabhai <nalin@redhat.com> 1.4-3Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 1.4-2Nalin Dahyabhai <nalin@redhat.com> 1.4-1Nalin Dahyabhai <nalin@redhat.com> 1.3.6-3Nalin Dahyabhai <nalin@redhat.com> 1.3.6-2Nalin Dahyabhai <nalin@redhat.com> 1.3.6-1Nalin Dahyabhai <nalin@redhat.com> 1.3.5-8Martin Stransky <stransky@redhat.com> 1.3.5-7Nalin Dahyabhai <nalin@redhat.com> 1.3.5-6Nalin Dahyabhai <nalin@redhat.com> 1.3.5-3Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 1.3.5-2Nalin Dahyabhai <nalin@redhat.com> 1.3.5-1Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 1.3.4-7Nalin Dahyabhai <nalin@redhat.com> 1.3.4-6Nalin Dahyabhai <nalin@redhat.com> 1.3.4-5Nalin Dahyabhai <nalin@redhat.com> 1.3.4-4Nalin Dahyabhai <nalin@redhat.com> 1.3.4-3Nalin Dahyabhai <nalin@redhat.com> 1.3.4-2Elliot Lee <sopwith@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 1.3.4-0.1Nalin Dahyabhai <nalin@redhat.com> 1.3.4-0Nalin Dahyabhai <nalin@redhat.com> 1.3.3-8Nalin Dahyabhai <nalin@redhat.com> 1.3.3-7Nalin Dahyabhai <nalin@redhat.com> 1.3.3-6Nalin Dahyabhai <nalin@redhat.com> 1.3.3-5Nalin Dahyabhai <nalin@redhat.com> 1.3.3-4Thomas Woerner <twoerner@redhat.com> 1.3.3-3Nalin Dahyabhai <nalin@redhat.com> 1.3.3-2Nalin Dahyabhai <nalin@redhat.com> 1.3.3-1Nalin Dahyabhai <nalin@redhat.com> 1.3.2-1Nalin Dahyabhai <nalin@redhat.com> 1.3.1-12Elliot Lee <sopwith@redhat.com> 1.3.1-11.1Elliot Lee <sopwith@redhat.com> 1.3.1-11Nalin Dahyabhai <nalin@redhat.com> 1.3.1-10Nalin Dahyabhai <nalin@redhat.com> 1.3.1-9Nalin Dahyabhai <nalin@redhat.com> 1.3.1-8Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 1.3.1-7Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 1.3.1-6Nalin Dahyabhai <nalin@redhat.com> 1.3.1-5Nalin Dahyabhai <nalin@red�x�������������|�������X:#�gJj������������������F������.����������������F��G��oadFilesHavePrefix)rtld(GNU_HASH)rpmlib(PayloadIsXz)3.0.4-14.6.0-14.0-15.2-14.11.3dkY@_��^�2�Z�&�Z��@Zs@Julian Brown <julian.brown@cpanel.net> - 1.0.9-2Tim Mullin <tim@cpanel.net> - 1.0.9-1Julian Brown <julian.brown@cpanel.net> - 1.0.2-4Rishwanth Yeddula <rish@cpanel.net> - 1.0.2-3Dan Muey <dan@cpanel.net> - 1.0.2-2Dan Muey <dan@cpanel.net> - 1.0.2-1- ZC-10933: Correct brotli dependency- EA-9380: Updated from upstream to 1.0.9- ZC-6809: Build on CentOS 8- ZC-3552: Ensure lib64 symlink is configured.- EA-7223: fix typo in URL- EA-7154: Initial brotli library for EA4hou-1 1727875265	

���1.0.9-2.2.4.cpanel1.0.9-2.2.4.cpanelea-brotlibinbrotliincludebrotlidecode.hencode.hport.htypes.hliblibbrotlicommon-static.alibbrotlicommon.solibbrotlicommon.so.1libbrotlicommon.so.1.0.9libbrotlidec-static.alibbrotlidec.solibbrotlidec.so.1libbrotlidec.so.1.0.9libbrotlienc-static.alibbrotlienc.solibbrotlienc.so.1libbrotlienc.so.1.0.9pkgconfiglibbrotlicommon.pclibbrotlidec.pclibbrotlienc.pclib64/opt/cpanel//opt/cpanel/ea-brotli//opt/cpanel/ea-brotli/bin//opt/cpanel/ea-brotli/include//opt/cpanel/ea-brotli/include/brotli//opt/cpanel/ea-brotli/lib//opt/cpanel/ea-brotli/lib/pkgconfig/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches   -m64 -mtune=genericobs://private/EA4-production/CentOS_7/344321ad0946597c78bfed42b1dac75e-ea-brotlicpioxz2x86_64-redhat-linux-gnu			directoryELF 64-bit LSB executable, x86-64, version 1 (SYSV), dynamically linked (uses shared libs), for GNU/Linux 2.6.32, BuildID[sha1]=cad94880e8e38b943619c9be6780d3061da8630f, not strippedC source, ASCII textASCII textcurrent ar archiveELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=b8c4d73cae9ed92a3f301ec5e902aa435a9182aa, not strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=460bb9c6b8eadf1690838773251a45273a66004a, not strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=65070b28367938f8d4535841c6cc64253bbd4620, not strippedpkgconfig file
RRRRRRRPRRRRRPRRRRRRRPRRRRRRR��p	��5�VF���?���P�@�f�H�#x��~�|���l�vz0����Q�N��k?NVN2��c<*
�⼽$P��B}+���M5ͱ�_�SJ�26��-��@Gw��V�1<��@�ρ*5w�_�K��^=�w�/�Af����,����{��x��>$�ޚA���Q�5_S�4K��q:�kĂ4=0�ϴR�K3/` 2�=��ֻ3��ϳ��^�=�W�ů�B�E�*�|�zV��
�.����>������Dx��Q8��p"_���s]b��
/�=H�7~�
�?���6�K$!�5����=�e�w0̢��*WȆ�1:���a4?�Aػ1C��m*�_Rۅ�ӯA�"�^�0%���;*~ڛ�bG)6�����&�����C�%���)�_þ�n�ܔ��Nzz�98+��뉦+�U�3�؀??���E3-B�8	ɶ��G�������Í�&
3���C�y���P�6��hys���Raj��6�x��o��-�M�F����� WU2�pC�����E��6��tI�7����;\t�J%{N͉f�H�#x��~�|��7QSo��fx�vKf]6x��n���B�֚7ս�%��.0?��π
/u�wɼE����F�Ep\{d+�jƧL��H��mV�
� ��
�,
ѓG��F|�'Z�����K���ɭ	����U4dS>�6����"A��}L��䆄�z�4�D
�[&�ф�q&�RgV����Vļ���3�*St���m8P����h���t܉�P����ʌsxG��ǹ�8ˆ�UT��Jf$��b:���z`�������J�M��7d�9�N�3�&g��s6g�����;W��>�D���ʮFڵT�EsJ�&}=��܎u�x��������������k�������XN#�fJj �������(�	4e�����\����������������4e3e5e� with -Wl,-z,relro,-z,now options
- fix typo in ntpq man page (#664525)- Rebuilt for https://fedoraproject.org/wiki/Fedora_15_Mass_Rebuild- update to 4.2.6p3- update to 4.2.6p3-RC10
- fix system peer unmarking when unreachable
- fix broadcastdelay option
- fix automatic broadcast delay calibration
- fix ntp-keygen -V crash
- avoid unnecessary timeout in ntpdate
- drop nano patch
- convert ChangeLog to UTF-8- allow -u and -p options to be used twice (#639101)- Rebuilt for gcc bug 634757- remove systemctl dependency for now
- suppress chkconfig output in %post (#629285)
- generate ntp_decode(5) man page (#632300)- fix default ntpdate sysconfig options (#445229)- update ntpdate service (#627395)- add support for systemd (#617328)
- retry few times in ntpdate init script before giving up (#445229)
- add fourth pool server to default ntp.conf and use iburst- update to 4.2.6p2
- add COPYRIGHT to ntpdate subpackage- update ntpstat to use current system variable names (#588067)
- print synchronization distance instead of dispersion in ntpstat
- clarify ntpd -q description- update to 4.2.6p1- update to 4.2.6p1-RC5
- support NTPSERVERARGS variable in dhclient script (#558110)
- don't use deprecated egrep (#548182)
- don't verify ntp.conf (#481151)
- compile with PPS API support
- include new sntp- update to 4.2.4p8 (#545557, CVE-2009-3563)- add ntp-wait man page (#526161)
- fix init scripts (#527987)- generate tickadj man page (#526161)
- fix precision calculation on fast CPUs- rebuilt with new openssl- Rebuilt for https://fedoraproject.org/wiki/Fedora_12_Mass_Rebuild- handle system time jumps better
- don't wake up every second for refclocks without timer
- don't crash in ntpstat when unknown clock type is received (#505564)
- make ntpstat process first packet in multipacket response
- switch to editline
- set pool.ntp.org vendor zone in spec (#512711)
- compile with -fno-strict-aliasing- fix frequency calculation when starting with no drift file
- reduce phase adjustments beyond Allan intercept in daemon PLL- update to 4.2.4p7 (CVE-2009-1252)
- improve PLL response when kernel discipline is disabled
- don't log STA_MODE changes
- enable nanokernel support
- allow minpoll 3
- increase memlock limit
- move html documentation to -doc subpackage (#492444)- don't restart ntpd in dhclient script with every renewal
- fix buffer overflow in ntpq (#490617)
- check status in condrestart (#481261)
- don't crash when compiled with HAVE_TIMER_CREATE (#486217)- Rebuilt for https://fedoraproject.org/wiki/Fedora_11_Mass_Rebuild- rebuild for new openssl- update to 4.2.4p6 (CVE-2009-0021)
- include dhclient script (David Cantrell)
- convert COPYRIGHT to UTF-8- retry failed name resolution few times before giving up (#460561)
- don't write drift file upon exit
- run ntpq with full path in ntp-wait script- update to 4.2.4p5
- add support for fast interface updates- reload resolv.conf after temporary failure in name resolution (#456743)
- use clock_gettime
- make subpackages for perl scripts and ntpdate (#452097, #456116)- don't use /etc/sysconfig/clock in ntpdate init script- fix building IPv6 support with new glibc-headers (#436713)
- avoid unaligned memory access (#435301)
- fix receiving broadcasts on 255.255.255.255- reset kernel frequency when -x option is used
- create separate init script for ntpdate
- add note about paths and exit codes to ntpd man page- Autorebuild for GCC 4.3- rebuild for openssl bump- update to 4.2.4p4
- fix default NTP version for outgoing packets in ntpdate man page
  (#245408)
- replace BSD with advertising code in ntpdc and ntpq- require perl (#274771)
- don't fail when starting with no interfaces (#300371)- avoid use of uninitialized floating-point values in clock_select
- update license tag (Tom "spot" Callaway)
- drop sntp, MSNTP license is non-free- allow loopback to share non-loopback address (#249226)
- require readline >= 5.2-3 (#250917)- Rebuild for RH #249435- ignore tentative addresses (#246297)
- improve init script (#247003)
- fix sleep patc�x�������������[�������X�#4gJjP���������	O�����a����������������	OHM���in@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nsdahya1@eos.ncsu.edu>Nalin Dahyabhai <nsdahya1@eos.ncsu.edu>Nalin Dahyabhai <nsdahya1@eos.ncsu.edu>Nalin Dahyabhai <nsdahya1@eos.ncsu.edu>Nalin Dahyabhai <nsdahya1@eos.ncsu.edu>Nalin Dahyabhai <nsdahya1@eos.ncsu.edu>Nalin Dahyabhai <nsdahya1@eos.ncsu.edu>Nalin Dahyabhai <nsdahya1@eos.ncsu.edu>- CVE-2024-3596: implement support for Message-Authenticator in libkrad- CVE-2024-37370: prevent modification of Extra Count field in GSS krb5 wrap
  token to avoid appearing truncated to application
- CVE-2024-37371: fix invalid memory reads during GSS message token handling- Fix integer overflows in PAC parsing (CVE-2022-42898)
- Resolves: rhbz#2140961- Try harder to avoid password change replay errors
- Resolves: #2063163- Backport usage of SHA-256 instead of SHA-1 for PKINIT CMS digest
- Resolves: #2066319- Fix KDC null deref on TGS inner body null server (CVE-2021-37750)
- Resolves: #1997599- Disable smoke tests on s390x and remove sleep
- Resolves: #1782492- Fix LDAP policy enforcement of pw_expiration
- Resolves: #1782492- Fix LDAP policy enforcement of pw_expiration
- Resolves: #1782492- Do expiration warnings for all init_creds APIs
- Resolves: #1733289- Add pkinit_cert_match support
- Resolves: #1656126- Install kerberos(7)
- Resolves: #1704726- Address some optimized-out memset() calls
- Resolves: #1663506- Correct kpasswd_server description in krb5.conf(5)
- Resolves: #1498347- Log when non-root ksu authorization fails
- Resolves: #1270927- Update man pages to reference kerberos(7)
- Resolves: #1704726- Prefer TCP to UDP for password changes
- Resolves: #1637349- Remove incorrect KDC assertion
- Resolves: #1673017- Add FILE prefix to pkinit_anchors field
- Resolves: #1661338- Bring back builtin crypto (openssl broke too many FIPS setups)
- Resolves: #1645711- Clean up MEMORY ccache behavior to match upstream more closely
- Resolves: #1605756- Fix bugs with concurrent use of MEMORY ccaches
- Resolves: #1605756- In FIPS mode, add plaintext fallback for RC4 usages and taint
- Resolves: #1570600- Use SHA-256 instead of MD5 for audit ticket IDs
- Resolves: #1570600- Include preauth name in trace output if possible
- Update cert generation scripts to work on modern openssl
- Fix per-request preauth scoping
- Add test case for PKINIT DH renegotiation
- Echo KDC cookies in preauth tryagain
- Fall back to other preauth mechanisms after failures
- Resolves: #1540130- Add German translation
- Resolves: #1497301- Add default pkinit_anchors value to krb5.conf
- Resolves: #1508081- Process profile includedir in sorted order
- Also, ignore dotfiles in included directories
- Resolves: #1539824- Exit with status 0 from kadmind
- Resolves: #1373909- Continue after KRB5_CC_END in KCM cache iteration
- Resolves: #1563166- Merge duplicate subsections in profile library
- Resolves: #1519625- Fix service dependencies on network state
- Resolves: #1525232- Explicitly use openssl rather than builtin crypto
- Resolves: #1570600- Fix flaws in LDAP DN checking (CVE-2018-5729, CVE-2018-5730)
- Resolves: #1562684
- Resolves: #1562679- Fix segfault in finish_dispatch()
- Resolves: #1568970- Unparse SANs with NO_REALM
- Resolves: #1482457- Fix hex conversion of PKINIT certid strings
- Resolves: #1538491- Limit ticket lifetime to 2^31-1 seconds
- Resolves: #1554723- Expose context errors in pkinit_server_plugin_init
- Resolves: #1460089- Drop certauth test changes that prevented runnig it
- Resolves: #1498767- Drop irrelevant DIR trigger logic
- Resolves: #1431198- Fix CVE-2017-7562 (certauth eku bypass)
- Resolves: #1498767- Fix CVE-2017-11368 (s4u2 request assertion failures)
- Resolves: #1498768- Force-add /etc/krb5.conf.d so we can guarantee it exists
- Resolves: #14�x�������������xJ�������X##MgJj�����.�������`������������������������������	8P?�d���!�	-�	`���������	�������	

Q
TX]b����(�8�9:�G�H�I�X�Y�\�]�^�b-d�e�f�l����
�<@DgHhLCcpanel-perl-536-text-glob0.111.cp108~el7CPAN module - match globbing patterns against textCpanel build perl module 'Text::Glob'match globbing patterns against textb�bh-centos-7.dev.cpanel.netXperlcpanel/perlhttps://metacpan.orglinuxnoarchX�$X�7
39edabab69b3a5438b39682149581dbc36c98932821eb160e9dc13760aed4c12rootrootcpanel-perl-536-text-glob-0.11-1.cp108~el7.src.rpm����cpanel-perl(Text::Glob)cpanel-perl-text-globcpanel-perl-536-text-glob




cpanel-perl-536cpanel-perl-536-constantcpanel-perl-536-exporterrpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(CompressedFileNames)rpmlib(PayloadIsXz)rpmlib(TildeInVersions)4.6.0-14.0-13.0.4-15.2-14.10.0-14.11.1b�@`-@X��@X)�@Q+R@Busy Camels <bc@cpanel.net> - 0.11-1.cp108Busy Camels <bc@cpanel.net> - 0.11-1.cp1198Todd Rinaldo <toddr@cpanel.net> - 0.11-1.cp1162Nicolas Rochelemagne <rochelemagne@cpanel.net> - 0.10-1.cp1162Todd Rinaldo <toddr@cpanel.net> - 0.09-1.cp1136- Bump to 1.cp108 for re-build- Bump to 1.cp1198 for debian re-build- Update from upstream: Text-Glob 0.11- Update from upstream: Text-Glob 0.10- Update from upstream: Text-Glob 0.090.110.110.11-1.cp108~el7Glob.pm/usr/local/cpanel/3rdparty/perl/536/cpanel-lib/Text/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches   -m64 -mtune=genericcpioxz2noarch-redhat-linux-gnu?����Y>�^���,�Q941b74dd04064d54387d575816c9ff2cf57166e1c�VA�c�VAG�y��c�#x��~�|��79ʖ��ԝ���_e�DtŠ�Ά1��q�aP���P渢�,�}�]���{,^H�Q6��U�{j�9��@�#����MҜ�rp����2�4I�L6“S���A釖9	��E��K�b��d唳�6��5����1�3�f$�B��R6����0�p���<h�x :l��GE����D
� "�%�ж��r�XH�:�qI�h�Z��i�#$>S�x�}�(�U�H���Ջ��G�ذz��ڮ�W�Xc�@O3�ºnf��,Mp���d1�b�t�+E׵���jE���f(��gx�b�D�c(]iW"���9<�	@���e~�٥�X�}�Ь�p<�W�,�7
X��*u���ݎ�? �ˬ&D^�f
�	J�+��K��@:>�8��0:��K�u眀?�'����T�	���o!��_���-\�9]�DԘ���Y�	bҒ���"ڼV�E"@�
��s�����}�<>��O�C�r���#݅j8y��Z�>da0eddd8efc30e490f7a7c339cb3bb4a0b779ff9c�����c���aswell (Jiri Olsa) [1169436]
- [tools] perf/x86: Add INST_RETIRED.ALL workarounds (Jiri Olsa) [1169436]
- [tools] perf/x86/intel: Add Broadwell core support (Jiri Olsa) [1169436]
- [tools] perf/x86/intel: Document all Haswell models (Jiri Olsa) [1169436]
- [tools] perf/x86/intel: Remove incorrect model number from Haswell perf (Jiri Olsa) [1169436]
- [tools] Revert: perf: Do not allow optimized switch for non-cloned events (Jiri Olsa) [1169436]
- [tools] perf: Fix child event initial state setup (Jiri Olsa) [1169436]
- [tools] perf: Do not POLLHUP event if it has children (Jiri Olsa) [1169436]
- [tools] perf: Do not check PERF_EVENT_STATE_EXIT on syscall read path (Jiri Olsa) [1169436]
- [tools] perf/x86: Fix section mismatch in split uncore driver (Jiri Olsa) [1169436]
- [tools] perf/x86/intel: Mark initialization code as such (Jiri Olsa) [1169436]
- [tools] perf/core: Replace rcu_assign_pointer() with RCU_INIT_POINTER() (Jiri Olsa�x��������������9�������X
#�gJj�����k�:k�����R����������������:k;k�s�t"
-     # Certificate "XRamp Global CA Root"
-     # Certificate "Go Daddy Class 2 CA"
-     # Certificate "Starfield Class 2 CA"
- removed certificates:
-     # Certificate "Baltimore CyberTrust Root"
- added certificates:
-     # Certificate "TrustAsia SMIME ECC Root CA"
-     # Certificate "TrustAsia SMIME RSA Root CA"
-     # Certificate "TrustAsia TLS ECC Root CA"
-     # Certificate "TrustAsia TLS RSA Root CA"
-     # Certificate "SwissSign RSA SMIME Root CA 2022 - 1"
-     # Certificate "SwissSign RSA TLS Root CA 2022 - 1"
-     # Certificate "OISTE Client Root ECC G1"
-     # Certificate "OISTE Client Root RSA G1"
-     # Certificate "OISTE Server Root ECC G1"
-     # Certificate " OISTE Server Root RSA G1"- update to CKBI 2.74 from NSS 3.110
- updated certificates:
-     # Certificate "Entrust.net Premium 2048 Secure Server CA"
-     # Certificate "Entrust Root Certification Authority"
-     # Certificate "AffirmTrust Commercial"
-     # Certificate "AffirmTrust Networking"
-     # Certificate "AffirmTrust Premium"
-     # Certificate "AffirmTrust Premium ECC"
-     # Certificate "Entrust Root Certification Authority - G2"
-     # Certificate "Entrust Root Certification Authority - EC1"
-     # Certificate "Entrust Root Certification Authority - G4"
-     # Certificate "Security Communication ECC RootCA1"
-     # Certificate "BJCA Global Root CA1"
-     # Certificate "BJCA Global Root CA2"
- added certificates:
-     # Certificate "D-TRUST BR Root CA 2 2023"
-     # Certificate "D-TRUST EV Root CA 2 2023"- update to CKBI 2.70 from NSS 3.104
- updated certificates:
-     # Certificate "GLOBALTRUST 2020"
-     # Certificate "certSIGN ROOT CA"
-     # Certificate "ACCVRAIZ1"
-     # Certificate "OISTE WISeKey Global Root GC CA"
- removed certificates:
-     # Certificate "Security Communication Root CA"
-     # Certificate "Camerfirma Chambers of Commerce Root"
-     # Certificate "Chambers of Commerce Root - 2008"
-     # Certificate "Global Chambersign Root - 2008"
-     # Certificate "E-Tugra Global Root CA RSA v3"
-     # Certificate "E-Tugra Global Root CA ECC v3"
- added certificates:
-     # Certificate "D-Trust SBR Root CA 1 2022"
-     # Certificate "D-Trust SBR Root CA 2 2022"
-     # Certificate "Telekom Security SMIME ECC Root 2021"
-     # Certificate "Telekom Security TLS ECC Root 2020"
-     # Certificate "Telekom Security SMIME RSA Root 2023"
-     # Certificate "Telekom Security TLS RSA Root 2023"
-     # Certificate "FIRMAPROFESIONAL CA ROOT-A WEB"
-     # Certificate "TWCA CYBER Root CA"
-     # Certificate "TWCA Global Root CA G2"
-     # Certificate "SecureSign Root CA12"
-     # Certificate "SecureSign Root CA14"
-     # Certificate "SecureSign Root CA15"- Update to CKBI 2.64 from NSS 3.95
- Removed:
-     # Certificate "E-Tugra Certification Authority"
-     # Certificate "Hongkong Post Root CA 1"
-     # Certificate "Symantec Class 1 Public Primary Certification Authority - G6"
-     # Certificate "Symantec Class 2 Public Primary Certification Authority - G6"
-     # Certificate "TrustCor ECA-1"
-     # Certificate "TrustCor RootCert CA-1"
-     # Certificate "TrustCor RootCert CA-2"
-     # Certificate "Verisign Class 1 Public Primary Certification Authority - G3"
-     # Certificate "Verisign Class 2 Public Primary Certification Authority - G3"
- Added:
-     # Certificate "Atos TrustedRoot Root CA ECC G2 2020"
-     # Certificate "Atos TrustedRoot Root CA ECC TLS 2021"
-     # Certificate "Atos TrustedRoot Root CA RSA G2 2020"
-     # Certificate "Atos TrustedRoot Root CA RSA TLS 2021"
-     # Certificate "CommScope Public Trust ECC Root-01"
-     # Certificate "CommScope Public Trust ECC Root-02"
-     # Certificate "CommScope Public Trust RSA Root-01"
-     # Certificate "CommScope Public Trust RSA Root-02"
-     # Certificate "LAWtrust Root CA2 (4096)"
-     # Certificate "Sectigo Public Email Protection Root E46"
-     # Certificate "Sectigo Public Email Protection Root R46"
-     # Certificate "Sectigo Public Server Authentication Root E46"
-     # Certi�x�������������h)�������X/#�gJj����X/XC������?K�����W����������������?K�s@K�her than PRF,
  backported fix from NSS 3.25 (upstream bug 1179338).- Fix reuse of session cache entry
- Resolves: Bug 1241172 - Certificate verification fails with multiple https urls- Fix a flaw in %check for nss not building on arm
- Resolves: Bug 1200856- Cleanup: Remove unnecessary %posttrans script from nss.spec
- Resolves: Bug 1174201- Merge fixes from the rhel-7.2 branch
- Fix a bogus %changelog entry
- Resolves: Bug 1297941- Rebuild to require the latest nss-util build and nss-softokn build.- Update the minimum nss-softokn build required at runtime.- Delete duplicates from one table- Fix missing support for sha384/dsa in certificate_request- Merge fixes from the rhel-7.2 branch
- Fix the SigAlgs sent in certificate_request
- Ensure all ssl.sh tests are executed
- Update sslauth test patch to run additional tests- Fix sha384 support and testing patches- Rebase to NSS-3.21- Prevent TLS 1.2 Transcript Collision attacks against MD5 in key exchange protocol
- Fix a mockbuild reported bad %if condition when using the __isa_bits macro instead of list of 64-bit architectures
- Change the test to %if 0%{__isa_bits} == 64 as required for building the srpm which is noarch
- Resolves: Bug 1289884- Rebuild against updated NSPR- Change the required_softokn_build_version back to -13
- Ensure we use nss-softokn-3.16.2.3-13.el7_1- Fix check for public key size of DSA certificates
- Use size of prime P not the size of dsa.publicValue- Reorder the cipher suites and enable two more by default- Update the required_softokn_build_version to -14
- Add references to bugs filed upstream for new patches
- Merge ocsp stapling and sslauth sni tests patches into one- Reorder the cipher suites and enable two more by default
- Fix some of the ssauth sni and ocsp stapling tests- Support TLS > 1.0 by support while still allowing to connect to SSL3 only servers
- Enable ECDSA cipher suites by default, a subset of the ones requested- Support TLS > 1.0 by support while still allowing to connect to SSL3 only servers- Fix to correctly report integrity mechanism for TLS_RSA_WITH_AES_256_GCM_SHA384- Fix checks to skip ssl2/export cipher suites tests to not skip needed tests
- Fix libssl ssl2/export disabling patch to handle NULL cipher cases
- Enable additional cipher suites by default- Add links to filed upstream bugs to better track patches in spec file- Package listsuites as part of the unsupported tools- Bump the release tag- Incremental patches to fix SSL/TLS test suite execution,
  fix the earlier SHA384 patch, and inform clients to use SHA384 with
  certificate_verify if required by NSS.- Add support for sha384 tls cipher suites
- Add support for server-side hde key exchange
- Add support for DSS+SHA256 ciphersuites- Reenable a patch that had been mistakenly disabled- Build against nss-softokn-3.16.2.3-9- Rebase to nss-3.19.1
- Resolves: Bug 1228913 - Rebase to nss-3.19.1 for CVE-2015-4000 [RHEL-7.1]- Backport mozbz#1155922 to support SHA512 signatures with TLS 1.2- Update to CKBI 2.4 from NSS 3.18.1 (the only change in NSS 3.18.1)- Update and reeneable nss-646045.patch on account of the rebase
- Resolves: Bug 1200898 - Rebase nss to 3.18 for Firefox 38 ESR [RHEL7.1]- Fix shell syntax error on nss/tests/all.sh
- Resolves: Bug 1200898 - Rebase nss to 3.18 for Firefox 38 ESR [RHEL7.1]- Replace expired PayPal test certificate that breaks the build
- Resolves: Bug 1200898 - Rebase nss to 3.18 for Firefox 38 ESR [RHEL7.1]- Resolves: Bug 1200898 - Rebase nss to 3.18 for Firefox 38 ESR [RHEL7.1]- Reverse the sense of a test in patch to fix pk12util segfault
- Resolves: Bug 1174527 - Segfault in pk12util when using -l option with certain .p12 files- Fix race condition
- Resolves: Bug 1094468 - 389-ds-base server reported crash in stan_GetCERTCertificate
- under the replication replay failure condition- Resolves: Bug 1174527 - Segfault in pk12util when using -l option with certain .p12 files- Restore patch for certutil man page
- supply missing options descriptions
- Resolves: Bug 1158161 �x���������������������X #�gJj�����%�������>����������������������>�>6x��ؖka�`��@�=�0rf"��S%h1v�v�(��%~U�����撞�}n#���aݬk��Rµ�����^N�!�C�Zs�v�G\#"@3��_6Z���t����T�E
��Ѫ�Cy�#�r�P�U�U�v�I��h�>�P&�_�2��3�g�1W�w���O3!*.��*�8�h_6���|S�g	R�п�m�=ad��M(��,[�"e�Xc��]dl��A���q�146943e173fa70c40d46cc0aff788e7f26d18ebabL���hbL��.2.93-5Jakub Jelinek <jakub@redhat.com> 2.2.93-4Jakub Jelinek <jakub@redhat.com> 2.2.93-3Jakub Jelinek <jakub@redhat.com> 2.2.93-2Jakub Jelinek <jakub@redhat.com> 2.2.93-1Jakub Jelinek <jakub@redhat.com> 2.2.92-2Jakub Jelinek <jakub@redhat.com> 2.2.92-1Jakub Jelinek <jakub@redhat.com> 2.2.91-1Jakub Jelinek <jakub@redhat.com> 2.2.90-27Jakub Jelinek <jakub@redhat.com> 2.2.90-26Jakub Jelinek <jakub@redhat.com> 2.2.90-25Jakub Jelinek <jakub@redhat.com> 2.2.90-24Jakub Jelinek <jakub@redhat.com> 2.2.90-23Jakub Jelinek <jakub@redhat.com> 2.2.90-22Jakub Jelinek <jakub@redhat.com> 2.2.90-21Jakub Jelinek <jakub@redhat.com> 2.2.90-20Jakub Jelinek <jakub@redhat.com> 2.2.90-19Jakub Jelinek <jakub@redhat.com> 2.2.90-18Jakub Jelinek <jakub@redhat.com> 2.2.90-17Jakub Jelinek <jakub@redhat.com> 2.2.90-16Jakub Jelinek <jakub@redhat.com> 2.2.90-15Bill Nottingham <notting@redhat.com> 2.2.90-14Jakub Jelinek <jakub@redhat.com> 2.2.90-13Jakub Jelinek <jakub@redhat.com> 2.2.90-12Jakub Jelinek <jakub@redhat.com> 2.2.90-11Jakub Jelinek <jakub@redhat.com> 2.2.90-10Jakub Jelinek <jakub@redhat.com> 2.2.5-35Jakub Jelinek <jakub@redhat.com> 2.2.5-34Jakub Jelinek <jakub@redhat.com> 2.2.5-33Jakub Jelinek <jakub@redhat.com> 2.2.5-32Jakub Jelinek <jakub@redhat.com> 2.2.5-31Jakub Jelinek <jakub@redhat.com> 2.2.5-30Jakub Jelinek <jakub@redhat.com> 2.2.5-29Jakub Jelinek <jakub@redhat.com> 2.2.5-28Jakub Jelinek <jakub@redhat.com> 2.2.5-27Jakub Jelinek <jakub@redhat.com> 2.2.5-26Jakub Jelinek <jakub@redhat.com> 2.2.5-25Jakub Jelinek <jakub@redhat.com> 2.2.90-8Jakub Jelinek <jakub@redhat.com> 2.2.90-7Jakub Jelinek <jakub@redhat.com> 2.2.90-6Jakub Jelinek <jakub@redhat.com> 2.2.90-5Jakub Jelinek <jakub@redhat.com> 2.2.90-4Jakub Jelinek <jakub@redhat.com> 2.2.90-3Jakub Jelinek <jakub@redhat.com> 2.2.90-2Jakub Jelinek <jakub@redhat.com> 2.2.90-1Jakub Jelinek <jakub@redhat.com> 2.2.4-19Jakub Jelinek <jakub@redhat.com> 2.2.4-18Jakub Jelinek <jakub@redhat.com> 2.2.4-17Jakub Jelinek <jakub@redhat.com> 2.2.4-16Jakub Jelinek <jakub@redhat.com> 2.2.4-15Jakub Jelinek <jakub@redhat.com> 2.2.4-14Jakub Jelinek <jakub@redhat.com> 2.2.4-13Jakub Jelinek <jakub@redhat.com> 2.2.4-12Jakub Jelinek <jakub@redhat.com> 2.2.4-11Jakub Jelinek <jakub@redhat.com> 2.2.4-10Jakub Jelinek <jakub@redhat.com> 2.2.4-9Jakub Jelinek <jakub@redhat.com> 2.2.4-8Jakub Jelinek <jakub@redhat.com> 2.2.4-7Jakub Jelinek <jakub@redhat.com> 2.2.4-6Jakub Jelinek <jakub@redhat.com> 2.2.4-5Jakub Jelinek <jakub@redhat.com> 2.2.4-4Jakub Jelinek <jakub@redhat.com> 2.2.4-3Jakub Jelinek <jakub@redhat.com>Jakub Jelinek <jakub@redhat.com>Jakub Jelinek <jakub@redhat.com>Jakub Jelinek <jakub@redhat.com>Jakub Jelinek <jakub@redhat.com>Jakub Jelinek <jakub@redhat.com>Jakub Jelinek <jakub@redhat.com>Jakub Jelinek <jakub@redhat.com>Jakub Jelinek <jakub@redhat.com>Jakub Jelinek <jakub@redhat.com>Jakub Jelinek <jakub@redhat.com>Jakub Jelinek <jakub@redhat.com>Jakub Jelinek <jakub@redhat.com>Jakub Jelinek <jakub@redhat.com>Jakub Jelinek <jakub@redhat.com>Jakub Jelinek <jakub@redhat.com>Jakub Jelinek <jakub@redhat.com>Jakub Jelinek <jakub@redhat.com>Jakub Jelinek <jakub@redhat.com>Jakub Jelinek <jakub@redhat.com>Jakub Jelinek <jakub@redhat.com>Jakub Jelinek <jakub@redhat.com>Jakub Jelinek <jakub@redhat.com>Jakub Jelinek <jakub@redhat.com>Jakub Jelinek <jakub@redhat.com>Jakub Jelinek <jakub@redhat.com>Jakub Jelinek <jakub@redhat.com>Jakub Jelinek <jakub@redhat.com>Jakub Jelinek <jakub@redhat.com>Preston Brown <pbrown@redhat.com>Jakub Jelinek <jakub@redhat.com>Jakub Jelinek <jakub@redhat.com>Jakub Jelinek <jakub@redhat.com>Jakub Jelinek <jakub@redhat.com>Jakub Jelinek <jakub@redhat.com>Jakub Jelinek <jaku�x�������������X�������X6#�fJj��������?�����r����������������dA����aV7G͢ ���#�R���g�����q@��~�)QQ�Z��:[ �8a��O��?�S��@��t�8�\s��T�س���ԇ_ͥ'�Т�igz@x�֋q�����yxm���e��֒`���ID�J�Z�DI�T7�{F�+�$�	���m�&��u]!�7�̡��.
�xTS�UX+z�ura&*LU�D��@�Ά�
!��uy%�,T\��dk� F��P~�G:��`.��1"U=z��|,���[�ʃ�d
-I?V�&�+���Ů��:'�t�>!��?��[�3%�!6�B�P��6p(c��G{A�H�-�����DMMxw����+鋦��	��W���5����DŦ��3p[
��~����=>}�AS^���;�	ˆ��S����^�Җ�|�I��~��A�`��jB��%ca�
i�=�76������Z�c�$ƨ�������B���EL�LQy�#\�nd�I��
�ʤKu!�1�ˍwa+��o��T��tvML;�y/�I�/a�F=Č)���!�8�Zr$�!ok�T^[�uUg3`�"�
qE�aB}���6tX�
�"�u�}N/3L&�ͳ����y74w��l�H�:��i�v�`�2^vCƿoD�j�3-�Ƃ"�����:{�_�f����AdH���V��-��m[�Ne9qz��d�Se_�d�����Y;ON�/�7��kEf�R@��Z������\q!���s�����g&틾�����H,��Ix�e�rS��Z�i^�z�:PŅjm������`�q��e�JIo76&�~��&�o�$1�OJ��\\NJ
��@���������.�v�̽l�{X�-���	�D#R�✾��ư~l�*�T_,��$������-$\)U��tH����H��w�cl>���;��_��j���N0��K�yhA���0���+NZ(����G�e�CY[zîd15fead8663430a95ace634cae64c9948fcb7442bL��9|bL��ano@redhat.com> - 2.6.25-5Tom "spot" Callaway <tcallawa@redhat.com> - 2.6.25-4Marcela Maslanova <mmaslano@redhat.com> - 2.6.25-3Marcela Maslanova <mmaslano@redhat.com> - 2.6.25-2Marcela Maslanova <mmaslano@redhat.com> - 2.6.25-1Marcela Maslanova <mmaslano@redhat.com> - 2.6.23-4Marcela Maslanova <mmaslano@redhat.com> - 2.6.23-3Marcela Maslanova <mmaslano@redhat.com> - 2.6.23-2Marcela Maslanova <mmaslano@redhat.com> - 2.6.23-1Marcela Maslanova <mmaslano@redhat.com> - 2.6.22-5Marcela Maslanova <mmaslano@redhat.com> - 2.6.22-3Jeremy Katz <katzj@redhat.com> - 2.6.22-2Radek Vokál <rvokal@redhat.com> - 2.6.22-1Radek Vokál <rvokal@redhat.com> - 2.6.20-2Radek Vokál <rvokal@redhat.com> - 2.6.20-1Radek Vokál <rvokal@redhat.com> - 2.6.19-1Radek Vokál <rvokal@redhat.com> - 2.6.18-5Radek Vokál <rvokal@� "PatternGrammar2.7.5.final.0.picklet.c�8PatternGrammar.txtal@�2 Percolator.pyoVok�1rPercolator.pyc18-�0a
Percolator.py�/.PathBrowser.pyo <�.dPathBrowser.pyc6�- PathBrowser.pym> �,RParenMatch.pyoal@�+ ParenMatch.pycKea�*i
ParenMatch.pydf�Phonetic.ply.de3Phoneti2.plla�'�PhoenixddlPhoenici.pl -d�uPhnx.pln 8�
Phnom_Penhs_Ad�ePhli.pl- dcPhaistos.pln dbe
PhagsPa.pl.6.d�d�Phag.plaid%3Pf.pl��Z
Petersburgx�GPerthMK
Perldoc.pmtinMPerldoc-GdQPerlWord.pln dPePerlSpac.pl7.d>PerlIO::via::QuotedPrint.3pm.gzomd=1PerlIO::via.3pm.gztild<oPerlIO::scalar.3pm.gzd;sPerlIO::mmap.3pm.gzPad:ePerlIO::encoding.3pm.gz3.Pd�M
PerlIO.podd.	PerlIO.pmd9 
PerlIO.3pm.gzdHd�dPerlIOd�ePerlDeci.plred
dJPerltd~MPeek.so
dPeek.pmt_d}RPeek2d$dsaPe.pld#dPd.pld"2Pc.pl_Path.pm�dH PatWSdFmPatSyn-1Ov
ParseWords.pmLRParseLink.pmO�J�nParis�&�
Paramaribo�%�Pangnirtung�$�Panama�W�PalmerisB��PalauA�	Pago_Pagod�3Pacific-NewH�%c���\�2�PacifictedaaPUA.pl<pm��PT2.gz PT154.so��PT154.gz_�PT.gz�_ePS_ASIC_aclLowPri.pst�^ePS_ASIC_aclHighPri.pst 3.�x����� ��������������X#.fJj�����r	5Y�����]����������������5Y4Y6Y�uild 2013-12-27- Show tests/test-suite.log in build.log when make check fails.- Update to 0.157.
- Remove elfutils-0.156-abi_cfi-ppc-s390-arm.patch.
- Remove elfutils-0.156-et_dyn-kernels.patch.- Add elfutils-0.156-abi_cfi-ppc-s390-arm.patch.
  Sets up initial CFI return register, CFA location expression and
  register rules for PPC, S390 and ARM (dwarf_cfi_addrframe support).- Add elfutils-0.156-et_dyn-kernels.patch.
  Fixes an issue on ppc64 with systemtap kernel address placement.- Make check can now also be ran in parallel.- Update the %configure command for compatibility with fc20 Koji.- Update to 0.156.
  - #890447 - Add __bss_start and __TMC_END__ to elflint.
  - #909481 - Only try opening files with installed compression libraries.
  - #914908 - Add __bss_start__ to elflint.
  - #853757 - Updated Polish translation.
  - #985438 - Incorrect prototype of __libdwfl_find_elf_build_id.
  - Drop upstreamed elfutils-0.155-binutils-pr-ld-13621.patch.
  - Drop upstreamed elfutils-0.155-mem-align.patch.
  - Drop upstreamed elfutils-0.155-sizeof-pointer-memaccess.patch.- bump release and rebuild to fix dependencies on PPC- Add ARM variant to elfutils-0.155-binutils-pr-ld-13621.patch rhbz#914908.
- rhel >= 5 has xz-devel- Replace elfutils-0.155-binutils-pr-ld-13621.patch with upstream fix.- Backport sizeof-pointer-memaccess upstream fixes.- #891553 - unaligned memory access issues.- Update to 0.155.
  - #844270 - eu-nm invalid %N$ use detected.
  - #847454 - Ukrainian translation update.
  - Removed local ar 64-bit symbol patch, dwz support patch and xlatetom fix.- Add support for archives with 64-bit symbol tables (#843019)- Add dwz support- Add upstream xlatetom fix (#835877)- disable unstrip-n check for now (835877)- Update to 0.154
  - elflint doesn't recognize SHF_INFO_LINK on relocation sections (#807823)
  - Update license to GPLv3+ and (GPLv2+ or LGPLv3+)
  - Remove elfutils-0.153-dwfl_segment_report_module.patch
- Add elfutils-0.154-binutils-pr-ld-13621.patch- Fix for eu-unstrip emits garbage for librt.so.1 (#805447)- Update to 0.153
  - New --disable-werror for portability.
  - Support for .zdebug sections (#679777)
  - type_units and DW_AT_GNU_odr_signature support (#679815)
  - low level support DW_OP_GNU_entry_value and DW_TAG_GNU_call_site (#688090)
  - FTBFS on rawhide with gcc 4.7 (#783506)
    - Remove gcc-4.7 patch- Fixes for gcc-4.7 based on upstream commit 32899a (#783506).- Rebuilt for https://fedoraproject.org/wiki/Fedora_17_Mass_Rebuild- Update to 0.152
  - Various build and warning nits fixed for newest GCC and Autoconf.
  - libdwfl: Yet another prelink-related fix for another regression. (#674465)
  - eu-elfcmp: New flag --ignore-build-id to ignore differing build ID bits.
  - eu-elfcmp: New flag -l/--verbose to print all differences.- Rebuilt for https://fedoraproject.org/wiki/Fedora_15_Mass_Rebuild- Update to 0.151
  - libdwfl: Fix for more prelink cases with separate debug file.
  - eu-strip: New flag --strip-sections to remove section headers entirely.- libdwfl: Remove bogus assert. (#658268)- Update to 0.150
  - libdw: Fix for handling huge .debug_aranges section. (#638432)
  - libdwfl: Fix for handling prelinked DSO with separate debug file. (#652857)
  - findtextrel: Fix diagnostics to work with usual section ordering.- Rebuilt for gcc bug 634757- Update to 0.149
  - libdw: Decode new DW_OP_GNU_implicit_pointer operation;
           new function dwarf_getlocation_implicit_pointer.
  - libdwfl: New function dwfl_dwarf_line.
  - eu-addr2line: New flag -F/--flags to print more DWARF line info details.
  - eu-readelf: better .debug_loc processing (#627729)
  - eu-strings: Fix non-mmap file reading. (#609468)
  - eu-strip: -g recognizes .gdb_index as a debugging section. (#631997)- Update to 0.148
  - libdw: Accept DWARF 4 format: new functions dwarf_next_unit,
           dwarf_offdie_types.
           New functions dwarf_lineisa, dwarf_linediscriminator,
           dwarf_lineop_index.
  - libdwfl: Fixes in core-file handling, support cores fr�x�������������H������Xr#'gJj����xs�������������|P���������������������|P}P��Julian Brown <julian.brown@cpanel.net> - 8.0.14-3Julian Brown <julian.brown@cpanel.net> - 8.0.14-2Cory McIntire <cory@cpanel.net> - 8.0.14-1Cory McIntire <cory@cpanel.net> - 8.0.13-1Dan Muey <dan@cpanel.net> - 8.0.12-2Cory McIntire <cory@cpanel.net> - 8.0.12-1Tim Mullin <tim@cpanel.net> - 8.0.11-4Julian Brown <julian.brown@cpanel.net> - 8.0.11-3Cory McIntire <cory@cpanel.net> - 8.0.11-2Cory McIntire <cory@cpanel.net> - 8.0.11-1Travis Holloway <t.holloway@cpanel.net> - 8.0.10-1Cory McIntire <cory@cpanel.net> - 8.0.9-1Julian Brown <julian.brown@webpros.com> - 8.0.8-2Travis Holloway <t.holloway@cpanel.net> - 8.0.8-1Travis Holloway <t.holloway@cpanel.net> - 8.0.7-2Cory McIntire <cory@cpanel.net> - 8.0.7-1Cory McIntire <cory@cpanel.net> - 8.0.6-1Cory McIntire <cory@cpanel.net> - 8.0.5-1Cory McIntire <cory@cpanel.net> - 8.0.3-2Cory McIntire <cory@cpanel.net> - 8.0.3-1Cory McIntire <cory@cpanel.net> - 8.0.2-1Tim Mullin <tim@cpanel.net> - 8.0.1-1Daniel Muey <dan@cpanel.net> - 8.0.0-2Daniel Muey <dan@cpanel.net> - 8.0.0-1Julian Brown <julian.brown@cpanel.net> - 8.0.0rc4-5Daniel Muey <dan@cpanel.net> - 8.0.0rc4-4Daniel Muey <dan@cpanel.net> - 8.0.0rc4-3Daniel Muey <dan@cpanel.net> - 8.0.0rc4-2Daniel Muey <dan@cpanel.net> - 8.0.0rc4-1Daniel Muey <dan@cpanel.net> - 8.0.0rc3-5Tim Mullin <tim@cpanel.net> - 8.0.0rc3-3Daniel Muey <dan@cpanel.net> - 8.0.0rc3-2Daniel Muey <dan@cpanel.net> - 8.0.0rc3-1Daniel Muey <dan@cpanel.net> - 8.0.0beta4-2Daniel Muey <dan@cpanel.net> - 8.0.0beta4-1Julian Brown <julian.brown@cpanel.net> - 8.0.0alpha3-2Julian Brown <julian.brown@cpanel.net> - 8.0.0alpha3-1- EA4-230: Use system libxml2 in PHP 8.0- EA4-136: Fix libxml2 v2.15.0 compatibility- ZC-12495: Do gcc like newer PHPs so that the libicu update won’t break the build- ZC-12246: Correct conffiles for Ubuntu- ZC-12153: make opcache INI a configfile for debs- ZC-12114: Apply fix for libxml2- EA-10753: Have snmp module require 'snmp-mibs-downloader' for deb- EA-11821: Patch to build with the latest ea-libxml2- ZC-11419: Correct Ubuntu Build issues- EA-11590: Update ea-php80 from v8.0.29 to v8.0.30
	- Libxml:
		Fixed bug GHSA-3qrf-m4j2-pcrr (Security issue with external entity loading in XML without enabling it). (CVE-2023-3823)
	- Phar:
		Fixed bug GHSA-jqcx-ccgc-xwhv (Buffer mismanagement in phar_dir_read()). (CVE-2023-3824)- EA-11475: Update ea-php80 from v8.0.28 to v8.0.29
    - Fixed bug GHSA-76gg-c692-v2mw
        (Missing error check and insufficient random bytes in HTTP Digest authentication for SOAP).- EA-11447: Increase default php memory_limit for new installs from 32M to 128M- ZC-10931: Link statically with libc-client- ZC-10950: Fix build problems- ZC-10936: Clean up Makefile and remove debug-package-nil- ZC-10873: Simplify the libidn deps, for building on Ubunut 20 and 22- EA-11227: Update ea-php80 from v8.0.27 to v8.0.28
- Fixed bug #81744 (Password_verify() always return true with some hash). (CVE-2023-0567)
- Fixed bug #81746 (1-byte array overrun in common path resolve code). (CVE-2023-0568)
- Fixed bug GHSA-54hq-v5wp-fqgv (DOS vulnerability when parsing multipart request body). (CVE-2023-0662)- EA-11075: Correct default value description for log_errors in php.ini- EA-11137: Update ea-php80 from v8.0.26 to v8.0.27
- PDO::quote() may return unquoted string). (CVE-2022-31631)- EA-11074: Update ea-php80 from v8.0.25 to v8.0.26- EA-11039: Ensure php.ini is marked as a config file on debian based systems- EA-11020: Update ea-php80 from v8.0.24 to v8.0.25
- GD: OOB read due to insufficient input validation in imageloadfont(). (CVE-2022-31630)
- Hash: buffer overflow in hash_update() on long parameter. (CVE-2022-37454)- EA-10961: Update ea-php80 from v8.0.23 to v8.0.24- ZC-10009: Add changes so that it builds on AlmaLinux 9- ZC-10260: Link deb against libcurl 4 explicitly- EA-10915: Update ea-php80 from v8.0.22 to v8.0.23- EA-10864: Update ea-php80 from v8.0.21 to v8.0.22- EA-10820: Update ea-php80 from v8.0.20 to v8.0.21- EA-10760: Update ea-php80 from �x���������������������X#�gJj�������������������������x������������������R.W�87b3234077f16a456672300ed4723fb9837fc3b317685ea4ae7d216a44a1dab20269b16e6db394ca35e52b6d0ab182abdacfedb724a621beaefd6a8d51f1347922fb85ab35d2d1ee234f45fef310003c7cc39d70225d07e18895dade026cffbb7323793a66ed41f3564b5b7e9048c826346ea2e2e1d99f860d3b9bfd6191df73ced3a3bfb56baf872b8675a2da7f54707338f9f6fb839005a8573050385e1dfc7a9be4532196e509089de75faf632a19c9d3f2ae6faa02ba224aba400c4f6ee346588b506f2a27ee405c4arootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootnss-3.90.0-2.el7_9.tuxcare.els4.src.rpm��������������������������������������������������������������������������������������������������������������������������������������������nss-toolsnss-tools(x86-64)@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@


@
libc.so.6()(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.3)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libdl.so.2()(64bit)libnspr4.so()(64bit)libnss3.so()(64bit)libnss3.so(NSS_3.10)(64bit)libnss3.so(NSS_3.11)(64bit)libnss3.so(NSS_3.11.7)(64bit)libnss3.so(NSS_3.12)(64bit)libnss3.so(NSS_3.12.1)(64bit)libnss3.so(NSS_3.12.3)(64bit)libnss3.so(NSS_3.12.6)(64bit)libnss3.so(NSS_3.12.9)(64bit)libnss3.so(NSS_3.13)(64bit)libnss3.so(NSS_3.14)(64bit)libnss3.so(NSS_3.14.1)(64bit)libnss3.so(NSS_3.15)(64bit)libnss3.so(NSS_3.16.1)(64bit)libnss3.so(NSS_3.16.2)(64bit)libnss3.so(NSS_3.18)(64bit)libnss3.so(NSS_3.2)(64bit)libnss3.so(NSS_3.21)(64bit)libnss3.so(NSS_3.3)(64bit)libnss3.so(NSS_3.30)(64bit)libnss3.so(NSS_3.31)(64bit)libnss3.so(NSS_3.33)(64bit)libnss3.so(NSS_3.34)(64bit)libnss3.so(NSS_3.39)(64bit)libnss3.so(NSS_3.4)(64bit)libnss3.so(NSS_3.5)(64bit)libnss3.so(NSS_3.52)(64bit)libnss3.so(NSS_3.6)(64bit)libnss3.so(NSS_3.7)(64bit)libnss3.so(NSS_3.8)(64bit)libnss3.so(NSS_3.9)(64bit)libnss3.so(NSS_3.9.2)(64bit)libnss3.so(NSS_3.9.3)(64bit)libnssutil3.so()(64bit)libnssutil3.so(NSSUTIL_3.12)(64bit)libnssutil3.so(NSSUTIL_3.12.3)(64bit)libnssutil3.so(NSSUTIL_3.12.7)(64bit)libnssutil3.so(NSSUTIL_3.15)(64bit)libnssutil3.so(NSSUTIL_3.24)(64bit)libplc4.so()(64bit)libplds4.so()(64bit)libpthread.so.0()(64bit)libpthread.so.0(GLIBC_2.2.5)(64bit)libsmime3.so()(64bit)libsmime3.so(NSS_3.10)(64bit)libsmime3.so(NSS_3.2)(64bit)libsmime3.so(NSS_3.3)(64bit)libsmime3.so(NSS_3.4)(64bit)libsmime3.so(NSS_3.6)(64bit)libsmime3.so(NSS_3.9.3)(64bit)libsoftokn3.so()(64bit)libssl3.so()(64bit)libssl3.so(NSS_3.12.6)(64bit)libssl3.so(NSS_3.13.2)(64bit)libssl3.so(NSS_3.14)(64bit)libssl3.so(NSS_3.15)(64bit)libssl3.so(NSS_3.15.4)(64bit)libssl3.so(NSS_3.2)(64bit)libssl3.so(NSS_3.20)(64bit)libssl3.so(NSS_3.22)(64bit)libssl3.so(NSS_3.24)(64bit)libssl3.so(NSS_3.27)(64bit)libssl3.so(NSS_3.28)(64bit)libssl3.so(NSS_3.33)(64bit)libssl3.so(NSS_3.4)(64bit)libssl3.so(NSS_3.7.4)(64bit)libssl3.so(NSS_3.80)(64bit)libz.so.1()(64bit)nss(x86-64)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rtld(GNU_HASH)rpmlib(PayloadIsXz)3.90.0-2.el7_9.tuxcare.els43.0.4-14.6.0-14.0-15.2-14.11.3i{K�h�@f�@ev��d��d��@dx�b�?�b�y@b���b��@a�@@a@��`�@`��`Ȗ@`��@`?z@`3��`.V�`�@_%Y@_"�@_*@]�B�]��@]�]S��\���\��\�P�\�@\�g�\�-@\��\�7�\�C@\��@\��@\��\�|�\s�[�k@[���Z؄�Z�3@ZЛ�Z�2@Z�k��x�������������8�������X#gJj��O�����q�����������������han@redhat.com> 3.9-7Than Ngo <than@redhat.com> 3.9-6Than Ngo <than@redhat.com> 3.9-5.1Bernhard Rosenkraenzer <bero@redhat.com> 3.9-5Tim Powers <timp@redhat.com>Tim Powers <timp@redhat.com>Bernhard Rosenkraenzer <bero@redhat.com> 3.9-2Bernhard Rosenkraenzer <bero@redhat.com> 3.9-1Bernhard Rosenkraenzer <bero@redhat.com> 3.7-1Bernhard Rosenkraenzer <bero@redhat.com> 3.4-2Bernhard Rosenkraenzer <bero@redhat.com>- Let [:graph:], [:print:], and [:punct:] POSIX classes to handle Unicode
  characters in UCP mode to match Perl behavior (bug #1400267)
- Fix matching Unicode ranges in JIT mode (bug #1402288)- Fix CVE-2015-2328 (infinite recursion compiling pattern with recursive
  reference in a group with indefinite repeat) (bug #1330509)
- Fix CVE-2015-8385 (buffer overflow caused by named forward reference to
  duplicate group number) (bug #1330509)
- Fix CVE-2015-8386 (buffer overflow caused by lookbehind assertion)
  (bug #1330509)
- Fix CVE-2015-3217 (stack overflow caused by mishandled group empty match)
  (bug #1330509)
- Fix CVE-2015-5073 and CVE-2015-8388 (buffer overflow for forward reference
  within backward assertion with excess closing parenthesis) (bug #1330509)
- Fix CVE-2015-8391 (inefficient posix character class syntax check)
  (bug #1330509)
- Fix CVE-2016-3191 (workspace overflow for (*ACCEPT) with deeply nested
  parentheses) (bug #1330509)- Fix compiling expression where start-anchored character with more than one
  other case follows circumflex in multiline UTF mode (bug #1110621)
- Fix character class with a literal quotation (bug #1111091)
- Fix empty-matching possessive zero-repeat groups in interpreted mode
  (bug #1119320)
- Fix compiler crash for zero-repeated groups with a recursive back reference
  (bug #1119356)
- Reset non-matched groups within capturing group up to forced match
  (bug #1161597)
- Fix static linking (bug #1217111)
- Package pcredemo.c as a documentation for pcre-devel (bug #1217118)- Fix CVE-2014-8964 (unused memory usage on zero-repeat assertion condition)
  (bug #1169797)- Disable unsupported JIT mode on little-endian 64-bit PowerPC platform
  (bug #1125642)
- Raise optimization level to 3 on little-endian 64-bit PowerPC (bug #1123498)- Mass rebuild 2014-01-24- Raise optimization to level 3 on 64-bit PowerPC (bug #1051072)- Fix jitted range check (bug #1048101)- Mass rebuild 2013-12-27- Disable strict-aliasing on PPC64 (bug #881232)- Disable unsupported JIT on aarch64 (bug #969693)- Fix passing too small output vector to pcre_dfa_exec (bug #963284)- Fix bad handling of empty lines in pcregrep tool (bug #961789)
- Fix possible pcretest crash with a data line longer than 65536 bytes- Fix forward search in JIT when link size is 3 or greater
- Fix buffer over-read in UTF-16 and UTF-32 modes with JIT- Adjust autoreconf to fix FTBFS on F-19- Make inter-subpackage dependencies architecture specific (bug #892187)- 8.32 bump- Inter-depend sub-packages to prevent from mixing different versions- 8.32-RC1 bump- Set re_nsub in regcomp() properly (bug #853990)- Rebuilt for https://fedoraproject.org/wiki/Fedora_18_Mass_Rebuild- 8.31 bump- 8.31-RC1 bump- disable jit for sparcv9 and sparc64- Fix spelling in manual pages (bug #820978)- Possessify high ASCII (bug #815217)
- Fix ovector overflow (bug #815214)- Possesify \s*\R (bug #813237)- Fix look-behind assertion in UTF-8 JIT mode (bug #810314)- Remove old libpcre.so.0 from distribution
- Move library to /usr- 8.30 bump
- Add old libpcre.so.0 to preserve compatibility temporarily- 8.30 Relase candidate 1 with UTF-16 support and *API change*
- Enable UTF-16 variant of PCRE library
- The pcre_info() function has been removed from pcre library.
- Loading compiled pattern does not fix endianity anymore. Instead an errror
  is returned and the application can use pcre_pattern_to_host_byte_order() to
  convert the pattern.
- Surrogates (0xD800---0xDFFF) are forbidden in UTF-8 mode now.- Rebuilt for https://fedoraproject.org/wiki/Fedora_17_Mass_Rebuild- Fix unmatched subpattern to n�x����������������������Xg#igJj������������h������>�����V����������������>�e�enable sysvmsg extension (#142988)- prevent build of builtin dba as well as shared extension- split out dba and bcmath extensions into subpackages
- BuildRequire gcc-c++ to avoid AC_PROG_CXX{,CPP} failure (#155221)
- pear: update to DB-1.7.6
- enable FastCGI support in /usr/bin/php-cgi (#149596)- build /usr/bin/php with the CLI SAPI, and add /usr/bin/php-cgi,
  built with the CGI SAPI (thanks to Edward Rudd, #137704)
- add php(1) man page for CLI
- fix more test cases to use -n when invoking php- rebuild for new libpq soname- bundle from PEAR: HTTP, Mail, XML_Parser, Net_Socket, Net_SMTP
- snmp: disable MSHUTDOWN function to prevent error_log noise (#153988)
- mysqli: add fix for crash on x86_64 (Georg Richter, upstream #32282)- build shared objects as PIC (#154195)- fix PEAR installation and bundle PEAR DB-1.7.5 package- update to 5.0.4 (#153068)
- add .phps AddType to php.conf (#152973)
- better gcc4 fix for libxmlrpc- BuildRequire mysql-devel >= 4.1
- don't mark php.ini as noreplace to make upgrades work (#152171)
- fix subpackage descriptions (#152628)
- fix memset(,,0) in Zend (thanks to Dave Jones)
- fix various compiler warnings in Zend- package mysqli extension in php-mysql
- really enable pcntl (#142903)
- don't build with --enable-safe-mode (#148969)
- use "Instant Client" libraries for oci8 module (Kai Bolay, #149873)- fix build with GCC 4- install the ext/gd headers (#145891)
- enable pcntl extension in /usr/bin/php (#142903)
- add libmbfl array arithmetic fix (dcb314@hotmail.com, #143795)
- add BuildRequire for recent pcre-devel (#147448)- update to 5.0.3 (thanks to Robert Scheck et al, #143101)
- enable xsl extension (#142174)
- package both the xsl and dom extensions in php-xml
- enable soap extension, shared (php-soap package) (#142901)
- add patches from upstream 5.0 branch:
 * Zend_strtod.c compile fixes
 * correct php_sprintf return value usage- update for db4-4.3 (Robert Scheck, #140167)
- build against mysql-devel
- run tests in %check- truncate changelog at 4.3.1-1
- merge from 4.3.x package:
 - enable mime_magic extension and Require: file (#130276)- fix dom/sqlite enable/without confusion- fix phpize installation for lib64 platforms
- add fix for segfault in variable parsing introduced in 5.0.2- update to 5.0.2 (#127980)
- build against mysqlclient10-devel
- use new RTLD_DEEPBIND to load extension modules
- drop explicit requirement for elfutils-devel
- use AddHandler in default conf.d/php.conf (#135664)
- "fix" round() fudging for recent gcc on x86
- disable sqlite pending audit of warnings and subpackage split- don't build dom extension into 2.0 SAPI- ExclusiveArch: x86 ppc x86_64 for the moment- fix default extension_dir and conf.d/php.conf- update to 5.0.1
- only build shared modules once
- put dom extension in php-dom subpackage again
- move extension modules into %{_libdir}/php/modules
- don't use --with-regex=system, it's ignored for the apache* SAPIs- Merge in some spec file changes from Jeff Stern (jastern@uci.edu)- bump to 5.0.0
- add patch to prevent clobbering struct re_registers from regex.h
- remove domxml references, replaced with dom now built-in
- fix php.ini to refer to php5 not php4hou-1 17768071435.4.45-81.82.14.cpanel5.4.45-81.82.14.cpanelmbstring.inimbstring.soea-php54-php-mbstring-5.4.45libmbfl_LICENSEoniguruma_COPYINGucgendat_LICENSE/opt/cpanel/ea-php54/root/etc/php.d//opt/cpanel/ea-php54/root/usr/lib64/php/modules//opt/cpanel/ea-php54/root/usr/share/doc//opt/cpanel/ea-php54/root/usr/share/doc/ea-php54-php-mbstring-5.4.45/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1  -m64 -mtune=genericobs://private/EA4-production/CentOS_7/e4c0a9aca7b3b416a4e07e4a545604e5-scl-php54cpioxz2x86_64-redhat-linux-gnuv�m�N*���tpM�'?�������i��#x��~�|�Z�XPj�ø+.�7���V7$������x�������������(��������X*#�fJjH �],�����5����������������],�."libgomp.so.1libgomp.so.1.0.0libgomp-4.8.5ChangeLog.bz2ChangeLog.graphite.bz2libgomp.info.gz/usr/lib64//usr/share/doc//usr/share/doc/libgomp-4.8.5//usr/share/info/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches   -m64 -mtune=genericcpioxz2x86_64-redhat-linuxELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=5f4fb88af97be3ecacc71363136bb015b2a07119, strippeddirectoryUTF-8 Unicode text (bzip2 compressed data, block size = 900k)ASCII text (bzip2 compressed data, block size = 900k)PPPPPPPPPP	P
PPPPPP
PRR
R	RR
RRRRRR?��� v�3!�ׅ���s�z����{�P�fh�M
	�{�P�f�)��vhF��7piR&
�7˲��#;�%ݦ�d����-y�:˅�y���5�����#	��P���Q��=��b�b)��`�'<~a���\VH�Qe��wJ._�K�O���O}��j�as�F�59���J$'�ܞݞ��̂eU,y���w�^Z��t��U��Ԙb�,mR
zf��΃a�(�jWtO3+
��٤�#��V��ąmj��*$ӿ��c=�F_%n�߇kV*��/`>�^�zʏʲ)�zpG�����\�I��M�Z�0�Z�r�����4X�P5���gm�H��e�!�hVR�ʓA^��ULB�`����ϼ>��;[ 7$��[�2��6XP.��siZ1��' ���+����K�²�3��x{��Nπ�M_�Fڀb
b���*��|&��&C�uԳ�����2��q�5@�D!!Է	���vX~~,�����ߌ��7�ŭ���#�xf`���R���e�H'�W��,�熦��DI�|K�y�C[8*!�������3!�ׅ���s�z����{�P�fh�M
	�{�P�f2��rU{Cp��ʑ��M8��	�F��B�
�i0N���!��:�E����%�W�}�l�u�Y%�5�$���q��v#���$�O��Loh9�����`��Q���_KB�
�UQ)�8����%�?[�H��n��M����vU'@�h�j���9_�X�1Z�5�^Piṛ��*H�Ox�{�Zxm[{:�jZ��`Y�_�8$y����6�)g�޷;�V���R7uR���ī�T
�?P���S
i���Km�g⹨j��!��t���+/K뷏���RQ�+�Ž�8�ۘ�;;�����k�"�U�<�eHC����GS��6Cj��ӪL�kv�E�c9u��A!o{6�Tn�@�$��H�uxFKh�NI�Y�Vtu��a��6B@�D�Y��x�
4/d���8ˆ`MP�f�xT�ŗr>��k�� ��[�h##'�xe߱a�s �I�mYT��D|a�\Z�k&9�8�:eM�W�Knh�qyۣ]�ة��2�M��m%��f6a1d16494b93aee3fc630ab3a5ffbe5e5d360f5h��@�h��c760753d6dbd2b1067d93d3190dd420604416b780654904aa10a11a201159cd4bcf3c226ba7a74e17437818055b39c97aa3ee2e5ca4ab1a24e492be6f512e9d1817f3f797fbf564bf1a17d3de905a8cfc3ecd101d4004c482c263fecf9dc30b4394b76b5c53a2d189027b61834ff46bcfad2be5ef388805e910fb99e50599189a60dc4822f6a6895d1c01879c2ff8c36e4566a7e4122ee34a117a8c563f6fe8436f399f0f043ce1f24822c69aa5f6522b6f67711fe93b66605a9c9176360e403bae4f13d20a3d6b62d678c690fb531fabdb44c3e74687caa2b2850ec1ab8022be1c65512398093c8140081d64a2ef0b4e3bcdd4098001636c450f5425fd60340faee6b313ac3143142f10cd129410a306d39eb584e0f8a814ebdd9e29bfa1730ab874c93cee624748192d2b59a2609fbce46fb74f74664f6d2fed2142a67a942004ecce66c80f040dd5b4b09bb2c9985507d2bf8f7f258d684702715a5a817ce5f4fdf6a8cc6d8fee25688d0a04d666f277078dc93726fa15c47c5ad3b4b2116f84ddc1395c402d545cc62278a402b38c0f118fd032d45b35e96384597c5610156fbcf4539ff788a73e5ee50ced48276b317ed0c1ded53fddd14a82256762f8d5e6b97cc228ab83029e48fb11f8f842797156d54992e0f20fd32fb108d4949abe5bbbab89a8ab989c3d1c28d2e6268bbe9e4ed84e6a2a6435983a4f7132ffe3b0c44298fc1c149afbf4c8996fb92427ae41e4649b934ca495991b7852b8557bf85a4642f2b354bb1e8f8403d5c55d6f8712ab8a2c47a548c05464de813f9d682367d03551e9cd71a7e925dc9fde1a948411a775adb2bb3ffa8f4bd97424d7aa49e67a9bfa3f3f93b296a73ee5590f832f9f35ef788e28ef0e712473abd8c77af3e6d7690b818a939bea5bce6eb46cebae9ae993f08a41356169d2e332af31d3ac82b3f30b7844d35737284d9e7f93556b3ae9cc5e0b923b014327e240fccfb0def841ae51071e5fe84914049de1c805c80974c5e780ac812ff78e4ebca7dbc3c8fcc24fec69fa492a76635dd0f2247ba9bb61f0fbfceaa2481231ee80bea62a50d8d411af66e6904cd4b81b9d78e8d5a9694391bd5b4b60ae2a2d731443a7323bd54195512adabd7165f8c56900c82fa9018c27992ec9e97c4c9820e9faedd67a315a9669243226a00de25afc9dfbccf40d2f7a637b55edd9e6a95c005f7c0b68d8e236ff12810d7ee95a8a687b07db9448f35bc199190398253a8b26538eb9c60622effd12e671d8b7c569bf22738a1f82f8fe0e48b140ab176d0677a3469fd70e891412b15a69db43629c6333a5f653749d918996fb3671e0b0c8033330a39d6d3f686956da213f7de0498c8090636�x����������������������X?#�eJj������������8��������V�����!�����������������V�V�V�work with hal- Load Policy needs translock- Fix cups html interface- Add hal changes suggested by Jeremy
- add policyhelp to point at policy html pages- Additional fixes for nvidia and cups- Update to upstream
- Merged my latest fixes
- Fix cups policy to handle unix domain sockets- NSCD socket is in nscd_var_run_t needs to be able to search dir- Fixes Apache interface file- Fixes for new version of cups- Turn off polyinstatiate util after FC5- Fix problem with privoxy talking to Tor- Turn on polyinstatiation- Don't transition from unconfined_t to fsadm_t- Fix policy update model.- Update to upstream- Fix load_policy to work on MLS
- Fix cron_rw_system_pipes for postfix_postdrop_t
- Allow audotmount to run showmount- Fix swapon
- allow httpd_sys_script_t to be entered via a shell
- Allow httpd_sys_script_t to read eventpolfs- Update from upstream- allow cron to read apache files- Fix vpnc policy to work from NetworkManager- Update to upstream
- Fix semoudle polcy- Update to upstream 
- fix sysconfig/selinux link- Add router port for zebra
- Add imaze port for spamd
- Fixes for amanda and java- Fix bluetooth handling of usb devices
- Fix spamd reading of ~/
- fix nvidia spec- Update to upsteam- Add users_extra files- Update to upstream- Add semodule policy- Update from upstream- Fix for spamd to use razor port- Fixes for mcs
- Turn on mount and fsadm for unconfined_t- Fixes for the -devel package- Fix for spamd to use ldap- Update to upstream- Update to upstream
- Fix rhgb, and other Xorg startups- Update to upstream- Separate out role of secadm for mls- Add inotifyfs handling- Update to upstream
- Put back in changes for pup/zen- Many changes for MLS 
- Turn on strict policy- Update to upstream- Update to upstream
- Fixes for booting and logging in on MLS machine- Update to upstream
- Turn off execheap execstack for unconfined users
- Add mono/wine policy to allow execheap and execstack for them
- Add execheap for Xdm policy- Update to upstream
- Fixes to fetchmail,- Update to upstream- Fix for procmail/spamassasin
- Update to upstream
- Add rules to allow rpcd to work with unlabeled_networks.- Update to upstream
- Fix ftp Man page- Update to upstream- fix pup transitions (#177262)
- fix xen disks (#177599)- Update to upstream- More Fixes for hal and readahead- Fixes for hal and readahead- Update to upstream
- Apply- Add wine and fix hal problems- Handle new location of hal scripts- Allow su to read /etc/mtab- Update to upstream- Fix  "libsemanage.parse_module_headers: Data did not represent a module." problem- Allow load_policy to read /etc/mtab- Fix dovecot to allow dovecot_auth to look at /tmp- Allow restorecon to read unlabeled_t directories in order to fix labeling.- Add Logwatch policy- Fix /dev/ub[a-z] file context- Fix library specification
- Give kudzu execmem privs- Fix hostname in targeted policy- Fix passwd command on mls- Lots of fixes to make mls policy work- Add dri libs to textrel_shlib_t
- Add system_r role for java
- Add unconfined_exec_t for vncserver
- Allow slapd to use kerberos- Add man pages- Add enableaudit.pp- Fix mls policy- Update mls file from old version- Add sids back in
- Rebuild with update checkpolicy- Fixes to allow automount to use portmap
- Fixes to start kernel in s0-s15:c0.c255- Add java unconfined/execmem policy- Add file context for /var/cvs
- Dontaudit webalizer search of homedir- Update from upstream- Clean up spec
- range_transition crond to SystemHigh- Fixes for hal
- Update to upstream- Turn back on execmem since we need it for java, firefox, ooffice
- Allow gpm to stream socket to itself- fix requirements to be on the actual packages so that policy can get
  created properly at install time- Allow unconfined_t to execmod texrel_shlib_t- Update to upstream 
- Turn off allow_execmem and allow_execmod booleans
- Add tcpd and automount policies- Add two new httpd booleans, turned off by default
     * httpd_can_network_relay
     * httpd_can_network_connect_db- Add ghost �x���������������������X#/fJj����s�����������6Y�����^����������������6Y5Y7Y�om PIEs. (#588818)
             When working from build IDs, don't open a named file
             that mismatches.
  - readelf: Handle DWARF 4 formats.- Update to 0.147- Update to 0.146
  - libdwfl: New function dwfl_core_file_report.
  - libelf: Fix handling of phdrs in truncated file. (#577310)
  - libdwfl: Fix infinite loop handling clobbered link_map. (#576379)
- Package translations.- Update to 0.145
  - Fix build with --disable-dependency-tracking. (#564646)
  - Fix build with most recent glibc headers.
  - libdw: Fix CFI decoding. (#563528)
  - libdwfl: Fix address bias returned by CFI accessors. (#563528)
             Fix core file module layout identification. (#559836)
  - readelf: Fix CFI decoding.- Fix sloppy #include's breaking build with F-13 glibc.- Update to 0.144
  - libdw: New function dwarf_aggregate_size for computing (constant) type
           sizes, including array_type cases with nontrivial calculation.
  - readelf: Don't give errors for missing info under -a.
             Handle Linux "VMCOREINFO" notes under -n.
- Resolves: RHBZ #527004, RHBZ #530704, RHBZ #550858- Update to 0.143
  - libdw: Various convenience functions for individual attributes now use
           dwarf_attr_integrate to look up indirect inherited attributes.
           Location expression handling now supports DW_OP_implicit_value.
  - libdwfl: Support automatic decompression of files in XZ format,
             and of Linux kernel images made with bzip2 or LZMA
             (as well as gzip).- Update to 0.142
  - libelf: Bug fix in filling gaps between sections. (#512840)
  - libelf: Add elf_getshdrnum alias for elf_getshnum and elf_getshdrstrndx
            alias for elf_getshstrndx and deprecate original names.
  - libebl, elflint: Add support for STB_GNU_UNIQUE. (#511436)
  - readelf: Add -N option, speeds up DWARF printing
             without address->name lookups. (#505347)
  - libdw: Add support for decoding DWARF CFI into location description form.
           Handle some new DWARF 3 expression operations previously omitted.
           Basic handling of some new encodings slated for DWARF 4.- Update to 0.141
  - libebl: sparc backend fixes (#490585)
            some more arm backend support
  - libdwfl: fix dwfl_module_build_id for prelinked DSO case (#489439)
             fixes in core file support (#494858)
             dwfl_module_getsym interface improved for non-address symbols
  - eu-strip: fix infinite loop on strange inputs with -f
  - eu-addr2line: take -j/--section=NAME option for binutils compatibility
                  (same effect as '(NAME)0x123' syntax already supported)
- Resolves: RHBZ #495213, RHBZ #465872, RHBZ #470055, RHBZ #484623- Rebuilt for https://fedoraproject.org/wiki/Fedora_11_Mass_Rebuild- Update to 0.140
  - libelf: Fix regression in creation of section header. (#484946)- Update to 0.139
  - libcpu: Add Intel SSE4 disassembler support
  - readelf: Implement call frame information and exception handling dumping.
             Add -e option.  Enable it implicitly for -a.
  - elflint: Check PT_GNU_EH_FRAME program header entry.
  - libdwfl: Support automatic gzip/bzip2 decompression of ELF files. (#472136)- Fix libelf regression.- Update to 0.138
  - Install <elfutils/version.h> header file for applications to use in
    source version compatibility checks.
  - libebl: backend fixes for i386 TLS relocs; backend support for NT_386_IOPERM
  - libcpu: disassembler fixes (#469739)
  - libdwfl: bug fixes (#465878)
  - libelf: bug fixes
  - eu-nm: bug fixes for handling corrupt input files (#476136)- fix libdwfl regression (#462689)- Update to 0.137
  - libdwfl: bug fixes; new segment interfaces;
             all the libdwfl-based tools now support --core=COREFILE option
- Resolves: RHBZ #325021, RHBZ #447416- fix conditional comparison- Update to 0.135
  - libdwfl: bug fixes
  - eu-strip: changed handling of ET_REL files wrt symbol tables and relocs- Update to 0.134
  - elflint: backend improvements for sparc, alpha (#204170)
  - libdwfl, libelf: bug fixes �x��������������s�������XI#�fJj����X ������H8������4�����f����������������4
44�ass rebuild 2013-12-27- man and info patched - clarified scale after multiplication- Rebuilt for https://fedoraproject.org/wiki/Fedora_20_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_19_Mass_Rebuild- Minor spec cleanup- Rebuilt for https://fedoraproject.org/wiki/Fedora_18_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_17_Mass_Rebuild- Rebuilt for glibc bug#747377- do not mask SIGINT in dc when reading from stdin (#697340)- Rebuilt for https://fedoraproject.org/wiki/Fedora_15_Mass_Rebuild- fix possible segfault in arrays handling(debbug #586969)
- initialize f_void to work with math lib again(#664080)- update to upstream alpha 1.06.95 (in use in Gentoo, Slackware
  for quite a long time, marked stable there)
- removed already applied patches, fix small memory leak
  (gentoo patch)
- add missing BR for bison and texinfo- Don't complain if installing with --excludedocs (#515934)- Rebuilt for https://fedoraproject.org/wiki/Fedora_12_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_11_Mass_Rebuild- Autorebuild for GCC 4.3- Added Examples directory into doc
- Added bc info file- Remove bc-1.06-flex.patch
- do not run autofoo
- fix the Licence tag- Package review (#225611)- update of source URI- fixed incorrect processing of decimal separator
- Resolves: #253729- dc accepts the input which contains wrong symbols of radix in same way like bc
- Resolves: #151844
- Added library string.h to remove warnings.- removed grep and mktemp usage from post script, also the requires- flex supports -8 now (pmachata)- fix buildroot
- remove trailing dot from summary
- fix post/preun requirements
- use make install DESTDIR=...
- convert changelog to utf-8
- use smp flags
- use 'flex -I' instead 'flex -I8' (not supported anymore)
- run autofoo stuff to update files for current automake- scripts should never fail: rhbz#223677- rebuild for ncurses- rebuild
- add missing br automake- added missing flex build require- bump again for double-long bug on ppc(64)- rebuilt for new gcc4.1 snapshot and glibc changes- rebuilt- fixed rpm macro usage in chengelog (#137800)- Rebuilt for new readline.- added BuildRequires for readline-devel (#134699)- rebuilt- rebuilt- fixed incorrect capitalization in bc info page (#89851)- rebuild- rebuilt- rebuilt- rebuild on all arches- automated rebuild- automated rebuild- Rebuild- s/Copyright/License/
- The %doc file AUTHOR should be AUTHORS- automated rebuild- Fixed a variable initialization problem in load.c which broke badly on S390.- use mktemp, not the pid shell variable, in rpm scriptlets- rebuild with new readline
- Add patch to fix compilation with recent readline versions- Add COPYING, COPYING.LIB, FAQ, AUTHORS, NEWS, README- update to bc 1.06- rebuild- automatic rebuild- use %makeinstall, %configure, %{_mandir}, %{_infodir}
  and %{_tmppath}- added URL
- let build system handle man page gzipping- fixed bug 7145 (long commands -> coredump) 
- removed explicit stripping, it does this by itself anyway
- gzipped man-pages- Rebuild with new readline (4.1)- Rebuild with new readline (4.0)
- fix Source URL
- some spec file cleanups- handle compressed manpages- auto rebuild in the new build environment (release 4)- use %configure- update to 1.05a.- translations modified for de- updated to 1.05 with build root.- translations modified for de, fr, tr- got upgrades of info entry working (I hope)- fixed incorrect info entry- added install-info support- upgraded from 1.03 to 1.04- built against glibc/bin/sh/bin/sh	

1.06.95-13.el71.06.95-13.el7bcdcbc-1.06.95AUTHORSCOPYINGCOPYING.LIBExamplesckbook.bpi.bprimes.btwins.bFAQNEWSREADMEbc.info.gzdc.info.gzbc.1.gzdc.1.gz/usr/bin//usr/share/doc//usr/share/doc/bc-1.06.95//u�x�������������c�������X#<gJj�������������i�������K����������������������K�K#s�rhel} > 6 rather than when it's > 7- Add libverto-devel requires for krb5-devel
- Add otp support- fix a memory leak when acquiring credentials using a keytab (RT#7586, #911110)- prebuild PDF docs to reduce multilib differences (internal tooling, #884065)
- drop the kerberos-iv portreserve file, and drop the rest on systemd systems
- escape uses of macros in comments (more of #884065)- update to 1.11.1
  - drop patch for noticing negative timeouts being passed to the poll()
    wrapper in the client transmit functions- set "rdns = false" in the default krb5.conf (#908323,#908324)- update to 1.11 release- update to 1.11 beta 2- when building with our bundled copy of libverto, package it in with -libs
  rather than with -server (#886049)- update to 1.11 beta 1- handle releases where texlive packaging wasn't yet as complicated as it
  is in Fedora 18
- fix an uninitialized-variable error building one of the test programs- move the rather large pile of html and pdf docs to -workstation, so
  that just having something that links to the libraries won't drag
  them onto a system, and we avoid having to sort out hard-coded paths
  that include %{_libdir} showing up in docs in multilib packages
- actually create %{_var}/kerberos/kdc/user, so that it can be packaged
- correct the list of packaged man pages
- don't dummy up required tex stylesheets, require them
- require pdflatex and makeindex- update to 1.11 alpha 1
  - drop backported patch for RT #7406
  - drop backported patch for RT #7407
  - drop backported patch for RT #7408
  - the new docs system generates PDFs, so stop including them as sources
  - drop backported patch to allow deltat.y to build with the usual
    warning flags and the current gcc
  - drop backported fix for disabling use of a replay cache when verifying
    initial credentials
  - drop backported fix for teaching PKINIT clients which trust the KDC's
    certificate directly to verify signed-data messages that are signed with
    the KDC's certificate, when the blobs don't include a copy of the KDC's
    certificate
  - drop backported patches to make keytab-based authentication attempts
    work better when the client tells the KDC that it supports a particular
    cipher, but doesn't have a key for it in the keytab
  - drop backported fix for avoiding spurious clock skew when a TGT is
    decrypted long after the KDC sent it to the client which decrypts it
  - move the cross-referenced HTML docs into the -libs package to avoid
    broken internal links
  - drop patches to fixup paths in man pages, shouldn't be needed any more- tag a couple of other patches which we still need to be applied during
  %{?_rawbuild} builds (zmraz)- actually pull up the patch for RT#7063, and not some other ticket (#773496)- add patch based on one from Filip Krska to not call poll() with a negative
  timeout when the caller's intent is for us to just stop calling it (#838548)- on EL6, conflict with libsmbclient before 3.5.10-124, which is when it
  stopped linking with a symbol which we no longer export (#771687)
- pull up patch for RT#7063, in which not noticing a prompt for a long
  time throws the client library's idea of the time difference between it
  and the KDC really far out of whack (#773496)
- add a backport of more patches to set the client's list of supported enctypes
  when using a keytab to be the list of types of keys in the keytab, plus the
  list of other types the client supports but for which it doesn't have keys,
  in that order, so that KDCs have a better chance of being able to issue
  tickets with session keys of types that the client can use (#837855)- cut down the number of times we load SELinux labeling configuration from
  a minimum of two times to actually one (more of #845125)- backport patch to disable replay detection in krb5_verify_init_creds()
  while reading the AP-REQ that's generated in the same function (RT#7229)- undo rename from krb5-pkinit-openssl to krb5-pkinit on EL6
- version the Obsoletes: on the krb5-pkinit-openssl to krb5-pkinit re�x��������������R�������X5#�gJjp�Z�������������������������������B�?$d���'�	-�	N��������0�	\�r������	
@��
�4��d�
�
�
(�8�9	D:
�G�HI\XpYx\�]�^�b�d�e�f�l�t�uvH	whx�y�
� 48P`
x����g�h�Cperl-Business-ISBN-Data20120719.0012.el7The data pack for Business::ISBNThis is a data pack for Business::ISBN.  You can update
the ISBN data without changing the version of Business::ISBN.
Most of the interesting stuff is in Business::ISBN.S�B^worker1.bsys.centos.org��CentOSGPL+ or ArtisticCentOS BuildSystem <http://bugs.centos.org>Development/Librarieshttp://search.cpan.org/dist/Business-ISBN-Data/linuxnoarch	�E�E����3
�h��^&A큤����A큤A큤����������A�A큤����S�B^PL�PL�PL�S�B]PL�PL�PL�PL�PL�PL�PL�S�B]S�B]S�B]PL�PL�S�B]4d2cfc77d0c950938ab6b592395a6be85aece33971101658ab73e957cd1405c5207a67f693f595a04b354f476360d88a98b1c59ad69e63d44477c0ec13c42235932468ecddc18d5b4451155fad7448f45ba5dde7c3a7a1f94f7d9928ab6e0e6dd81ea75a67ba908e2b532c2aaf8daf6849ce8e8c951e5c444e96491c00f518e2ba84e0c07233a812ade951c81307c6b472b513505b6b5953b7bfdea23c6b32adffba0fc879439c253868d7c93dbfca0ecd99bb0e7430b3ecde2d5c83f37e6f13b0db96e65e2b5300f140170b054f3b6c4bb171240b085f4d5e21f16f961bcac99bdde94940c4ca3357c3fcf5d94c806c76190b5063eb0f6fb4eff94170768235e7cd40b0f5cb02a0a8ecd67657170df8787a9d3939b2653c722728bada6a31297f7a285ca9a7ce64b994c7b5d7b7f881b7a9841a87f4c95a232b1696531cdc30b0c02ab7bcbc425667e101f938c4c4ea77c74858e7252b9a310f7e24b35b43393e974be329a28f5267bbc5522cf1433699bbce4118534ce518e3f475771e421cc82fac231cf5301e39c8b9bef0e1a124d33111d4775345853191029947b309c6rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootperl-Business-ISBN-Data-20120719.001-2.el7.src.rpm������������������������������������������������������������������������perl(Business::ISBN::Data)perl-Business-ISBN-Data@@@@@@@@



/usr/bin/perlperlperl(:MODULE_COMPAT_5.16.3)perl(Carp)perl(File::Basename)perl(File::Spec::Functions)perl(strict)perl(vars)perl(warnings)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)1:5.0103.0.4-14.6.0-14.0-15.2-14.11.1R�k�P1@P�@P	H@O؀�OW@O�N��MQ0@M��K�t�K�@J��Jj�I��@I*�@G��G<4�G �@G �@Daniel Mach <dmach@redhat.com> - 20120719.001-2Paul Howarth <paul@city-fan.org> - 20120719.001-1Paul Howarth <paul@city-fan.org> - 20120719-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 20081208-10Petr Pisar <ppisar@redhat.com> - 20081208-9Paul Howarth <paul@city-fan.org> - 20081208-8Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 20081208-7Marcela Mašláňová <mmaslano@redhat.com> - 20081208-6Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 20081208-5Marcela Maslanova <mmaslano@redhat.com> - 20081208-4Marcela Maslanova <mmaslano@redhat.com> - 20081208-3Stepan Kasal <�x��������������A�������Xe#{gJj�������������Y������&�����N����������������&'�EL-7epel-testing.repoepel.repo90-epel.presetepel-release-7GPL/etc/pki/rpm-gpg//etc/yum.repos.d//usr/lib/systemd/system-preset//usr/share/doc//usr/share/doc/epel-release-7/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches   -m64 -mtune=genericcpioxz2noarch-redhat-linux-gnuASCII textdirectoryhttps://bugz.fedoraproject.org/epel-release?���@7X�3!��}|J^��>��j/��5,d�a3��
	j/��5,d��r�hrE��ю��Jg�
���]
��g�1�/Q�^������[_��ʸ
m�%�9+�+�_�*V��'�mҫu������w
UkÃD��4���Di�hfL��6��&�%�^�$�u=����Q�:��`�W`��E�Ԑ%+�1.����A����"}�`HĹ˧^�?&_G��:{��./Qn�v�-Y�&���Cԏ�ա��<^{m6��Q����Cr����|2^�؞�#�)�-�i�-`NFh}�B<>�H���'�� @e:��-L�e�}�%0o6�T
�؃C�S��9u�%$\GZ0I�Q�����ά�k��=
��
����]fg�d�Y�!�6�I����̰�����9���C����#�j���; �r� �)��p!��g��L�{5t�{���z�lM[?�ի�W\>�����,'�n1%�?St��Gb�T�;�iVM����s�Lt��J��q<]��r�f����B�����H�9
�3��n$�4
�G]���3!��}|J^��>��j/��5,d�a3��
	j/��5,d�y��/�"��[�A�@�`X�0�}K��ɰ�:H��1��W.� 1�����fJ4e��d��F��_�Η��ܓt"��W�HD8r�`ζ'8�U�Js�^*�u��ԡ&ayl��E���)G,9��L��G(��h�������IE�cɋ�Z���	�!J���2R�#V�q���y�N
E`�nmn^��2�FӔz���5sk���;g~*0���vF��?����֡c��m��B���bVX����i4��3��9�Ja/��+�w�5_f�}'u [�w�g��K����O^o����h=@�����F�0I�K�u�G飩D���~@�M<V��;'���g�m,EF<�:��'>��~�S��"%�����F�l��j1��k~�f(�-Օݷ��TDQ8!�)���ɗ�����;I�
Ղ<Jz�u*�]d_�v�q��q��3���`�Ro�M��T���&q0��ˠ6���%�ϼ-/�Lo?�_�2e955ed60c2c81b065e24e38159016294d8c2757bL�Th�bL�Trther regex speedups
  - fix re.translate handling in regex (#112869)
  - change regfree to match old regex behaviour (what is freed
    and clearing of freed pointers)
  - fix accesses to unitialized memory in regex (#113507, #113425,
      - PT_GNU_RELRO support- update from CVS
  - fix pmap_set fd and memory leak (#112726)
- fix backreference handling in regex
- rebuilt under glibc without the above bug to fix
  libc.so linker script (#112738)- update from CVS
  - faster getpid () in NPTL builds
  - fix to make pthread_setcancelstate (PTHREAD_CANCEL_DISABLE, )
    really disable cancellation (#112512)
  - more regex fixes and speedups
  - fix nextafter*/nexttoward*
  - handle 6th syscall(3) argument on AMD64
  - handle memalign/posix_memalign in mtrace
  - fix linuxthreads memory leak (#112208)
  - remove throw () from cancellation points in linuxthreads (#112602)
  - fix NPTL unregister_atfork
  - fix unwinding through alternate signal stacks- update from CVS
  - 2.3.3 release
  - lots of regex fixes and speedups (#110401)
  - fix atan2
  - fix pshared condvars in NPTL
  - fix pthread_attr_destroy for attributes created with
    pthread_attr_init@GLIBC_2.0
- for the time being, include both nb_NO* and no_NO* as locales
  so that the distribution can catch up with the no_NO->nb_NO
  transition
- add BuildPrereq texinfo (#110252)- update from CVS
  - fix getifaddrs (CAN-2003-0859)
  - fix ftw fd leak
  - fix linuxthreads sigaction (#108634)
  - fix glibc 2.0 stdio compatibility
  - fix uselocale (LC_GLOBAL_LOCALE)
  - speed up stdio locking in non-threaded programs on IA-32
  - try to maintain correct order of cleanups between those
    registered with __attribute__((cleanup))
    and with LinuxThreads style pthread_cleanup_push/pop (#108631)
  - fix segfault in regex (#109606)
  - fix RE_ICASE multi-byte handling in regex
  - fix pthread_exit in libpthread.a (#109790)
  - FTW_ACTIONRETVAL support
  - lots of regex fixes and speedups
  - fix ceill/floorl on AMD64- update from CVS
  - fix ld.so --verify (and ldd)- update from CVS
  - fix sprof (#103727)
  - avoid infinite loops in {,f}statvfs{,64} with hosed mounts file
  - prevent dlopening of executables
  - fix glob with GLOB_BRACE and without GLOB_NOESCAPE
  - fix locale printing of word values �x�������������p1�������X#MfJj������������P��c�����|�����������������c�c�B (?�d����	�	&�L�P�h�l�s�y�	�������� 	6
Lx�
��3j���	(	68	@9	�:}G�H�I�X�Y\ ]L^�b>d�e�f�l�t�u$vPw�x$yP������
��   g  h $ClshwB.02.1817.el7HardWare LiSterlshw (Hardware Lister) is a small tool to provide detailed informaton on
the hardware configuration of the machine. It can report exact memory
configuration, firmware version, mainboard configuration, CPU version
and speed, cache configuration, bus speed, etc. on DMI-capable x86s
systems and on some PowerPC machines (PowerMac G4 is known to work).

Information can be output in plain text, XML or HTML.

For detailed information on lshw features and usage, please see the
included documentation or go to the lshw Web page,
http://lshw.ezix.org/_t�#x86-02.bsys.centos.org��CentOSGPLv2CentOS BuildSystem <http://bugs.centos.org>Applications/Systemhttp://ezix.org/project/wiki/HardwareLiSterlinuxx86_64
����	 �
�'{F����A큤����������A큤��_t�!_t�"_t�W�J_t�W�J_t�W�J_t�"W�J_t�3322d876cfcb8f4711b1485e0618c04990efceb50a5ce0be3db636bcfa27a5002342fef15118d3de650f68a4dbcef9f3ced3b470c3d6dd9b0e9b730fa5d549eb87c398101cd709dca6ab3d483033744550694ed0b9d49e8c8decb36db92752ea3234ad73b7541855a51d3b73eff6a46a5f483b3a0835aa2c94a86af2180095e9c2c71dfce222cada008a8c84301d07a10cf20dfacb259ee0e120e03b011f38f3c66cfa343442f5633ca13a7a0e4f09f582eba13ffa78d861a3eda1fd73c564573c9512c459ae9c60393ae6571d2ae34537e6844f0d599bb57787b09d901cc7838177f97513213526df2cf6184d8ff986c675afb514d4e68a404010521b880643562a3e60ceeff97e089d4073d1440ee1d78a8bd4881e056703fac4393c67b39d�rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootlshw-B.02.18-17.el7.src.rpm��������������������������������������������lshwlshw(x86-64)@@@@@@@@@@@@@


@
hwdatalibc.so.6()(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libgcc_s.so.1()(64bit)libgcc_s.so.1(GCC_3.0)(64bit)libsqlite3.so.0()(64bit)libstdc++.so.6()(64bit)libstdc++.so.6(CXXABI_1.3)(64bit)libstdc++.so.6(GLIBCXX_3.4)(64bit)libstdc++.so.6(GLIBCXX_3.4.11)(64bit)libstdc++.so.6(GLIBCXX_3.4.9)(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rtld(GNU_HASH)rpmlib(PayloadIsXz)3.0.4-14.6.0-14.0-15.2-14.11.3^�x�^���^s^�]D%�\n��Z|;�Zq��Y��Y��@Y�V@Y�Yi@Y	�@X��X��X���X�Z�W�t@W�9�W�P�W��@WV�@W#L�V�@U���U���U���T��@TWn@Lianbo Jiang <lijiang@redhat.com> - B.02.18-17Lianbo Jiang <lijiang@redhat.com> - B.02.18-16Lianbo Jiang <lijiang@redhat.com> - B.02.18-15Lianbo Jiang <lijiang@redhat.com> - B.02.18-14Lianbo Jiang <lijiang@redhat.com> - B.02.18-13Petr Oros <poros@redhat.com> - B.02.18-12Petr Oros <poros@redhat.com> - B.02.18-11Petr Oros <poros@redhat.com> - B.02.18-10Petr Oros <poros@redhat.com> - B.02.18-9Petr Oros <poros@redhat.com> - B.02.18-8Petr Oros <poros@redhat.com> - B.02.18-7Petr Oros <poros@redhat.com> - B.02.18�x�������������� �������X�#�gJj�����U������x�������`������������������	��nfigure with --with-kerberos=k5only instead of --with-kerberos=k5
- build slapd with threads- rebuild, 2.0.15 is now designated stable- update to 2.0.15- update to 2.0.14- update to 2.0.12 to pull in fixes for setting of default TLS options, among
  other things
- update to migration tools 39
- drop tls patch, which was fixed better in this release- install saucer correctly- try to fix ldap_set_options not being able to set global options related
  to TLS correctly- don't attempt to create a cert at install-time, it's usually going
  to get the wrong CN (#51352)- add a build-time requirement on pam-devel
- add a build-time requirement on a sufficiently-new libtool to link
  shared libraries to other shared libraries (which is needed in order
  for prelinking to work)- require cyrus-sasl-md5 (support for DIGEST-MD5 is required for RFC
  compliance) by name (follows from #43079, which split cyrus-sasl's
  cram-md5 and digest-md5 modules out into cyrus-sasl-md5)- enable passwd back-end (noted by Alan Sparks and Sergio Kessler)- start to prep for errata release- link libldap with liblber- add symlink liblber.so libldap.so and libldap_r.so in /usr/lib- move shared libraries to /lib
- redo init script for better internationalization (#26154)
- don't use ldaprc files in the current directory (#38402) (patch from
  hps@intermeta.de)
- add BuildPrereq on tcp wrappers since we configure with
  --enable-wrappers (#43707)
- don't overflow debug buffer in mail500 (#41751)
- don't call krb5_free_creds instead of krb5_free_cred_contents any
  more (#43159)- make config files noreplace (#42831)- actually change the default config to use the dummy cert
- update to MigrationTools 38- build dummy certificate in %post, use it in default config
- configure-time shenanigans to help a confused configure script- tweak migrate_automount and friends so that they can be run from anywhere- update to 2.0.11- update to 2.0.10- update to 2.0.9- update to 2.0.8
- drop patch which came from upstream- rebuild in new environment- back out pidfile patches, which interact weirdly with Linux threads
- mark non-standard schema as such by moving them to a different directory- update to MigrationTools 36, adds netgroup support- fix thinko in that last patch- try to work around some buffering problems- gettextize the init script- gettextize the init script- move the RFCs to the base package (#21701)
- update to MigrationTools 34- add support for additional OPTIONS, SLAPD_OPTIONS, and SLURPD_OPTIONS in
  a /etc/sysconfig/ldap file (#23549)- change automount object OID from 1.3.6.1.1.1.2.9 to 1.3.6.1.1.1.2.13,
  per mail from the ldap-nis mailing list- force -fPIC so that shared libraries don't fall over- add Norbert Klasen's patch (via Del) to fix searches using ldaps URLs
  (OpenLDAP ITS #889)
- add "-h ldaps:///" to server init when TLS is enabled, in order to support
  ldaps in addition to the regular STARTTLS (suggested by Del)- correct mismatched-dn-cn bug in migrate_automount.pl- update to the correct OIDs for automount and automountInformation
- add notes on upgrading- update to 2.0.7
- drop chdir patch (went mainstream)- change automount object classes from auxiliary to structural- update to Migration Tools 27
- change the sense of the last simple patch- reorganize the patch list to separate MigrationTools and OpenLDAP patches
- switch to Luke Howard's rfc822MailMember schema instead of the aliases.schema
- configure slapd to run as the non-root user "ldap" (#19370)
- chdir() before chroot() (we don't use chroot, though) (#19369)
- disable saving of the pid file because the parent thread which saves it and
  the child thread which listens have different pids- add missing required attributes to conversion scripts to comply with schema
- add schema for mail aliases, autofs, and kerberosSecurityObject rooted in
  our own OID tree to define attributes and classes migration scripts expect
- tweak automounter migration script- try adding the suffix first when doing online migrations
- force lda�x�������������`�������XP#gJj����H�O�����~�����������������pcre32_copy_named_substring.3.gzpcre32_copy_substring.3.gzpcre32_dfa_exec.3.gzpcre32_exec.3.gzpcre32_free_study.3.gzpcre32_free_substring.3.gzpcre32_free_substring_list.3.gzpcre32_fullinfo.3.gzpcre32_get_named_substring.3.gzpcre32_get_stringnumber.3.gzpcre32_get_stringtable_entries.3.gzpcre32_get_substring.3.gzpcre32_get_substring_list.3.gzpcre32_jit_exec.3.gzpcre32_jit_stack_alloc.3.gzpcre32_jit_stack_free.3.gzpcre32_maketables.3.gzpcre32_pattern_to_host_byte_order.3.gzpcre32_refcount.3.gzpcre32_study.3.gzpcre32_utf32_to_host_byte_order.3.gzpcre32_version.3.gzpcre_assign_jit_stack.3.gzpcre_compile.3.gzpcre_compile2.3.gzpcre_config.3.gzpcre_copy_named_substring.3.gzpcre_copy_substring.3.gzpcre_dfa_exec.3.gzpcre_exec.3.gzpcre_free_study.3.gzpcre_free_substring.3.gzpcre_free_substring_list.3.gzpcre_fullinfo.3.gzpcre_get_named_substring.3.gzpcre_get_stringnumber.3.gzpcre_get_stringtable_entries.3.gzpcre_get_substring.3.gzpcre_get_substring_list.3.gzpcre_jit_exec.3.gzpcre_jit_stack_alloc.3.gzpcre_jit_stack_free.3.gzpcre_maketables.3.gzpcre_pattern_to_host_byte_order.3.gzpcre_refcount.3.gzpcre_study.3.gzpcre_utf16_to_host_byte_order.3.gzpcre_utf32_to_host_byte_order.3.gzpcre_version.3.gzpcreapi.3.gzpcrebuild.3.gzpcrecallout.3.gzpcrecompat.3.gzpcrecpp.3.gzpcrejit.3.gzpcrelimits.3.gzpcrematching.3.gzpcrepartial.3.gzpcrepattern.3.gzpcreperform.3.gzpcreposix.3.gzpcreprecompile.3.gzpcresample.3.gzpcrestack.3.gzpcresyntax.3.gzpcreunicode.3.gz/usr/bin//usr/include//usr/lib64//usr/lib64/pkgconfig//usr/share/doc//usr/share/doc/pcre-devel-8.32//usr/share/doc/pcre-devel-8.32/html//usr/share/man/man1//usr/share/man/man3/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches   -m64 -mtune=genericcpioxz2x86_64-redhat-linux-gnuPOSIX shell script, ASCII text executableC source, ASCII textC++ source, ASCII textASCII textpkgconfig filedirectoryHTML document, ASCII texttroff or preprocessor input, ASCII text (gzip compressed data, from Unix, max compression)
�x������������������XE#=gJj�������������&������#s�����K����������������#s�KdO�name
- reintroduce the init scripts for non-systemd releases
- forward-port %{?_rawbuild} annotations from EL6 packaging- update to 1.10.3, rolling in the fixes from MITKRB5-SA-2012-001- selinux: hang on to the list of selinux contexts, freeing and reloading
  it only when the file we read it from is modified, freeing it when the
  shared library is being unloaded (#845125)- go back to not messing with library file paths on Fedora 17: it breaks
  file path dependencies in other packages, and since Fedora 17 is already
  released, breaking that is our fault- add upstream patch to fix freeing an uninitialized pointer and dereferencing
  another uninitialized pointer in the KDC (MITKRB5-SA-2012-001, CVE-2012-1014
  and CVE-2012-1015, #844779 and #844777)
- fix a thinko in whether or not we mess around with devel .so symlinks on
  systems without a separate /usr (sbose)- Rebuilt for https://fedoraproject.org/wiki/Fedora_18_Mass_Rebuild- backport a fix to allow a PKINIT client to handle SignedData from a KDC
  that's signed with a certificate that isn't in the SignedData, but which
  is available as an anchor or intermediate on the client (RT#7183)- back out this labeling change (dwalsh):
  - when building the new label for a file we're about to create, also mix
    in the current range, in addition to the current user- update to 1.10.2
  - when building the new label for a file we're about to create, also mix
    in the current range, in addition to the current user
  - also package the PDF format admin, user, and install guides
  - drop some PDFs that no longer get built right
- add a backport of Stef's patch to set the client's list of supported
  enctypes to match the types of keys that we have when we are using a
  keytab to try to get initial credentials, so that a KDC won't send us
  an AS reply that we can't encrypt (RT#2131, #748528)
- don't shuffle around any shared libraries on releases with no-separate-/usr,
  since /usr/lib is the same place as /lib
- add explicit buildrequires: on 'hostname', for the tests, on systems where
  it's in its own package, and require net-tools, which used to provide the
  command, everywhere- skip the setfscreatecon() if fopen() is passed "rb" as the open mode (part
  of #819115)- have -server require /usr/share/dict/words, which we set as the default
  dict_file in kdc.conf (#817089)- change back dns_lookup_kdc to the default setting (Stef Walter, #805318)
- comment out example.com examples in default krb5.conf (Stef Walter, #805320)- update to 1.10.1
  - drop the KDC crash fix
  - drop the KDC lookaside cache fix
  - drop the fix for kadmind RPC ACLs (CVE-2012-1012)- when removing -workstation, remove our files from the info index while
  the file is still there, in %preun, rather than %postun, and use the
  compressed file's name (#801035)- Fix string RPC ACLs (RT#7093); CVE-2012-1012- Add upstream lookaside cache behavior fix (RT#7082)- add patch to accept keytab entries with vno==0 as matches when we're
  searching for an entry with a specific name/kvno (#230382/#782211,RT#3349)- update to 1.10 final- Add upstream crashfix patch (RT#7081)- update to beta 1- mktemp was long obsoleted by coreutils- modify the deltat grammar to also tell gcc (4.7) to suppress
  "maybe-uninitialized" warnings in addition to the "uninitialized" warnings
  it's already being told to suppress (RT#7080)- update to alpha 2
- drop a couple of patches which were integrated for alpha 2- pull in patch for RT#7046: tag a ccache containing credentials obtained via
  S4U2Proxy with the principal name of the proxying principal (part of #761317)
  so that the default principal name can be set to that of the client for which
  it is proxying, which results in the ccache looking more normal to consumers
  of the ccache that don't care that there's proxying going on
- pull in patch for RT#7047: allow tickets obtained via S4U2Proxy to be cached
  (more of #761317)
- pull in patch for RT#7048: allow PAC verification to only bother trying to
  verify the signature with k�x�������������P�����X"#�fJj��������H�������������s��������������������d Bug 456666 msghack doesn't check for mandatory cmd line params 
  by adding checking statements and display usage (msghack.py modified)
- rpath patch for binary-or-shlib-defines-rpath in x86_64.- fix autopoint messing up CVS files with upstream patch (#441481)- if %buildjar is off make sure libintl.jar does not get installed (#433210)- turn on building of libintl.jar now that we have gcc43- rebuild with gcc43- update to 0.17 release
  - update License field to GPLv3
  - add gettext-0.17-open-args.patch to fix build from upstream
  - gettext-tools-tests-lang-gawk-fail.patch, gettext-php-headers.patch,
    gettext-php-prinf-output-237241.patch, and
    gettext-xglade-define-xml-major-version-285701.patch are no longer needed
- drop superfluous po-mode-init.el source
- no need to run autoconf and autoheader when building
- pass -findirect-dispatch to gcj to make java binaries ABI independent
  (jakub,#427796)
- move autopoint, gettextize, and {_datadir}/{name}/ to main package
- force removal of emacs/ so install does not fail when no emacs- add a libs subpackage (suggested by Dwayne Bailey, #294891)
- move preloadable_libintl.so to the devel subpackage- remove gettext-xglade-include-expat-285701.patch, add
  gettext-xglade-define-xml-major-version-285701.patch to determine
  XML_MAJOR_VERSION from expat.h and define it in config.h (#285701)- buildrequire expat-devel
- add gettext-xglade-include-expat-285701.patch to include expat.h
  to get xgettext to dl the right libexpat (Nils Philippsen, #285701)- specify license is GPL and LGPL version 2 or later- fix encoding of msghack script (Dwayne Bailey, #250248)- add gettext-php-prinf-output-237241.patch to workaround php test failure
  (#237241)
- add gettext-php-headers.patch to correct php test headers
  (Robert Scheck, #232832)- set preloadable_libintl.so executable in %install so it gets stripped
- force removal of infodir/dir since it is not there when /sbin is not in path- add buildjar switch for building of libintl.jar
- lots of spec file cleanup (Mamoru Tasaka, #225791):
- preserve timestamps of installed files
- disable building of static library
- use %find_lang for .mo files
- remove examples from -devel package
- do not own en@*quot locale dirs
- set preloadable_libintl.so executable
- add ChangeLog to -devel package
- add %check to run make check
- add gettext-tools-tests-lang-gawk-fail.patch to work around gawk test failure- rebuild to pick up dependency on libgcj.so.8rh instead libgcj.so.7rh- protect install-info in devel %post and %preun too (Ville Skyttä, #223689)
- forward port fix to reset of timestamp of examples ChangeLog for
  brp-java-repack-jars libintl.jar multilib conflict (#205207)- protect install-info in %post and %preun (Ville Skyttä, #223689)- update to 0.16.1- re-enable openmp on ia64- update to 0.16 release
- disable openmp on ia64 (#216988)- update to 0.15 release
- mkinstalldirs and libintl.jar are gone
- javaversion.class added- buildrequire zip and unzip to fix libintl.jar multilib conflict (#205207)- move libgettext*.so devel files to devel package (Patrice Dumas, #203622)- update to 0.14.6
- include preloadable_libintl.so again (Roozbeh Pournader, #149809)
- remove .la files (Kjartan Maraas, #172624)
- cleanup spec file- Bump release number.- rebuild- --disable-csharp, otherwise it'll build a dll when mono is 
  installed in the buildroot.- bump again for double-long bug on ppc(64)- rebuilt for new gcc4.1 snapshot and glibc changes- rebuilt again- rebuilt- convert spec to UTF-8
- remove old tarballs from sources- updated to 0.14.5
- Add cvs as Requires for gettext-devel- updated to 0.14.3
- fixed compiling problem on gcc4 (#150992)
- fixed Group for -devel (#138303)
- moved gettextize and autopoint to -devel (#137542, #145768)
- moved some of the man pages- rebuilt with gcc 4.0- Add env var to redirect use fastjar instead of jar
- BuildRequires fastjar and libgcj- fix call on phase0_getc()
- fix temp file issue (#136323 - CAN-2004-0966 - mjc)- fixed typo on %preun on -deve�x�������������������X�#?gJj������������h�cO���������������������cOdObO�5- kadmind: add upstream patch to fix free() on an invalid pointer (#696343,
  MITKRB5-SA-2011-004, CVE-2011-0285)- don't discard the error code from an error message received in response
  to a change-password request (#658871, RT#6893)- override INSTALL_SETUID at build-time so that ksu is installed into
  the buildroot with the right permissions (part of #225974)- backport change from SVN to fix a computed-value-not-used warning in
  kpropd (#684065)- turn off NSS as the backend for libk5crypto for now to work around its
  DES string2key not working (#679012)
- add revised upstream patch to fix double-free in KDC while returning
  typed-data with errors (MITKRB5-SA-2011-003, CVE-2011-0284, #674325)- throw in a not-applied-by-default patch to try to make pkinit debugging
  into a run-time boolean option named "pkinit_debug"- turn on NSS as the backend for libk5crypto, adding nss-devel as a build
  dependency when that switch is flipped- krb5kdc init script: prototype some changes to do a quick spot-check
  of the TGS and kadmind keys and warn if there aren't any non-weak keys
  on file for them (to flush out parts of #651466)- add upstream patches to fix standalone kpropd exiting if the per-client
  child process exits with an error (MITKRB5-SA-2011-001), a hang or crash
  in the KDC when using the LDAP kdb backend, and an uninitialized pointer
  use in the KDC (MITKRB5-SA-2011-002) (CVE-2010-4022, #664009,
  CVE-2011-0281, #668719, CVE-2011-0282, #668726, CVE-2011-0283, #676126)- Rebuilt for https://fedoraproject.org/wiki/Fedora_15_Mass_Rebuild- fix a compile error in the SELinux labeling patch when -DDEBUG is used (Sumit
  Bose)- properly advertise that the kpropd init script now supports force-reload
  (Zbysek Mraz, #630587)- pkinit: when verifying signed data, use the CMS APIs for better
  interoperability (#636985, RT#6851)- update to 1.9 final- fix link flags and permissions on shared libraries (ausil)- update to 1.9 beta 3- update to 1.9 beta 2- drop not-needed-since-1.8 build dependency on rsh (ssorce)- start moving to 1.9 with beta 1
  - drop patches for RT#5755, RT#6762, RT#6774, RT#6775
  - drop no-longer-needed backport patch for #539423
  - drop no-longer-needed patch for CVE-2010-1322
- if WITH_NSS is set, built with --with-crypto-impl=nss (requires NSS 3.12.9)- incorporate upstream patch to fix uninitialized pointer crash in the KDC's
  authorization data handling (CVE-2010-1322, #636335)- rebuild- pull down patches from trunk to implement k5login_authoritative and
  k5login_directory settings for krb5.conf (#539423)- Rebuilt for gcc bug 634757- fix reading of keyUsage extensions when attempting to select pkinit client
  certs (part of #629022, RT#6775)
- fix selection of pkinit client certs when one or more don't include a
  subjectAltName extension (part of #629022, RT#6774)- build with -fstack-protector-all instead of the default -fstack-protector,
  so that we add checking to more functions (i.e., all of them) (#629950)
- also link binaries with -Wl,-z,relro,-z,now (part of #629950)- fix a logic bug in computing key expiration times (RT#6762, #627022)- update to 1.8.3
  - drop backports of fixes for gss context expiration and error table
    registration/deregistration mismatch
  - drop patch for upstream #6750- tell krb5kdc and kadmind to create pid files, since they can
- add logrotate configuration files for krb5kdc and kadmind (#462658)
- fix parsing of the pidfile option in the KDC (upstream #6750)- libgssapi: pull in patch from svn to stop returning context-expired errors
  when the ticket which was used to set up the context expires (#605366,
  upstream #6739)- pull up fix for upstream #6745, in which the gssapi library would add the
  wrong error table but subsequently attempt to unload the right one- update to 1.8.2
  - drop patches for CVE-2010-1320, CVE-2010-1321- rebuild- ksu: move session management calls to before we drop privileges, like
  su does (#596887), and don't skip the PAM account check for root or the
  same user (more �x�������������@�����X~#�gJj�=h�������:J�����R����������������:J9J�T�l�FH��n�]5-��`
)�5��+S{�;��V�i��_�)�>�)��@l��_d��ͺ�-��,BsLSj�z��e���Uv���ӹ4&,�q����5��)v�S�3ƛM ���A�)����7q:��#D��s��)T���/
�V�6�&=���Ѷt���D�F����G��r���	�B�m�Z*�zeb;����?*d���CF�V���чJ	��䥡T��H�!R�Ɍ[��Bž��,��H�-Qo�'�=<k�'i#H�c̙����4z�`Ԯ��R(��"r�OV���
%�$8��c��z7O	�>=8������qEV�Z�0� lr��ы����B}�Bjd�c72e7b538b06d056dac82aba7d75282812d4508ci�]	<�i�Fg LED interaction ignore activity LED src modes (Stefan Assmann) [1173788]
- [netdrv] i40e: Fix NPAR Tx Scheduler init (Stefan Assmann) [1173788]
- [netdrv] i40e: Fix dependencies in the i40e driver on configfs (Stefan Assmann) [1173788]
- [netdrv] i40e/i40evf: Bump versions (Stefan Assmann) [1173788]
- [netdrv] i40e: Only enable TC0 for NIC partition type (Stefan Assmann) [1173788]
- [netdrv] i40e: Register DCBNL ops in MFP mode (Stefan Assmann) [1173788]
- [netdrv] i40e: Fix RSS size at init since default num queue calculation has changed (Stefan Assmann) [1173788]
- [netdrv] i40e: Move RSS table size for VSIs to the VSI struct (Stefan Assmann) [1173788]
- [netdrv] i40e/i40evf: Add missing packet types for VXLAN encapsulated packet types (Stefan Assmann) [1173788]
- [netdrv] i40e: Fix issue with removal of apps from DBCNL app table (Stefan Assmann) [1173788]
- [netdrv] i40e: Add FW check to disable DCB and wrap autoneg workaround with FW check (Stefan Assmann) [1173788]
- [netdrv] i40e: Enable more than 64 qps for the Main VSI (Stefan Assmann) [1173788]
- [netdrv] i40e: don't disable PF LB when disabling VFs (Stefan Assmann) [1173788]
- [netdrv] i40e: Add safety net for switch calling (Stefan Assmann) [1173788]
- [netdrv] i40e/i40evf: print FW build number in version string (Stefan Assmann) [1173788]
- [netdrv] i40e: Skip the priority tagging if DCB is not enabled (Stefan Assmann) [1173788]
- [netdrv] i40e: check pointers before use (Stefan Assmann) [1173788]
- [netdrv] i40e: catch NVM write semaphore timeout and retry (Stefan Assmann) [1173788]
- [netdrv] i40e: stop flow director on shutdown (Stefan Assmann) [1173788]
- [netdrv] i40e: disconnect irqs on shutdown (Stefan Assmann) [1173788]
- [netdrv] i40e: Issue a PF reset if Tx queue disable timeout (Stefan Assmann) [1173788]
- [netdrv] i40e: Fix the Tx ring qset handle when DCB reconfigures (Stefan Assmann) [1173788]
- [netdrv] i40e: Fix the case where per TC queue count was higher than queues enabled (Stefan Assmann) [1173788]
- [netdrv] i40e: fix race in hang check (Stefan Assmann) [1173788]
- [netdrv] i40e: Fix TSO with more than 8 frags per segment issue (Stefan Assmann) [1173788]
- [netdrv] i40e: Don't check for Tx hang when PF down (Stefan Assmann) [1173788]
- [netdrv] i40e: fix shift precedence issue (Stefan Assmann) [1173788]
- [netdrv] i40e: Fix memory leak at failure path in i40e_dbg_command_write() (Stefan Assmann) [1173788]
- [netdrv] i40e/i40evf: Update driver versions (Stefan Assmann) [1173788]
- [netdrv] i40e: Use ethtool private flags to display NPAR status (Stefan Assmann) [1173788]
- [netdrv] i40e: Set FLAG_RD when sending buffer FW must read (Stefan Assmann) [1173788]
- [netdrv] i40e: print Rx packet split status (Stefan Assmann) [1173788]
- [netdrv] i40e: setup FCoE device type (Stefan Assmann) [1173788]
- [netdrv] i40e: Set BUF flag for Set Version AQ command (Stefan Assmann) [1173788]
- [netdrv] i40e: Add support for getlink, setlink ndo ops (Stefan Assmann) [1173788]
- [netdrv] i40e: Implement configfs for NPAR BW configuration (Stefan Assmann) [1173788]
- [netdrv] i40e: Add NPAR BW get and set functions (Stefan Assmann) [1173788]
- [netdrv] i40e: enable packet split only when IOMMU present (Stefan Assmann) [1173788]
- [netdrv] i40e: Add method to keep track of current rxnfc settings (Stefan Assmann) [1173788]
- [netdrv] i40e/i40evf: Use advertised speed settings in ethtool and refactor get_settings (Stefan Assmann) [1173788]
- [netdrv] i40e/i40evf: Fix output of i40e_debug_aq() for big endian machines (Stefan Assmann) [1173788]
- [netdrv] i40e: Fix i40e_ndo_set_vf_spoofchk (Stefan Assmann) [1173788]
- [n�x�������������������X7#�eJj�������������j������>�����f����������������>{>�plch@redhat.com> - 1.4.11-23Marcel Plch <mplch@redhat.com> - 1.4.11-22Marcel Plch <mplch@redhat.com> - 1.4.11-21Marcel Plch <mplch@redhat.com> - 1.4.11-20Tomáš Mráz <tmraz@redhat.com> - 1.4.11-19Tomáš Mráz <tmraz@redhat.com> - 1.4.11-18Tomáš Mráz <tmraz@redhat.com> - 1.4.11-17Tomáš Mráz <tmraz@redhat.com> - 1.4.11-16Tomáš Mráz <tmraz@redhat.com> - 1.4.11-15Tomáš Mráz <tmraz@redhat.com> - 1.4.11-14Marcela Mašláňová <mmaslano@redhat.com> - 1.4.11-13Marcela Mašláňová <mmaslano@redhat.com> - 1.4.11-12Marcela Mašláňová <mmaslano@redhat.com> - 1.4.11-11Daniel Mach <dmach@redhat.com> - 1.4.11-10Marcela Mašláňová <mmaslano@redhat.com> - 1.4.11-9Marcela Mašláňová <mmaslano@redhat.com> - 1.4.11-8Marcela Mašláňová <mmaslano@redhat.com> - 1.4.11-7Daniel Mach <dmach@redhat.com> - 1.4.11-6Marcela Mašláňová <mmaslano@redhat.com> - 1.4.11-5Marcela Mašláňová <mmaslano@redhat.com> - 1.4.11-4Marcela Mašláňová <mmaslano@redhat.com> - 1.4.11-3Marcela Mašláňová <mmaslano@redhat.com> - 1.4.11-2Marcela Mašláňová <mmaslano@redhat.com> - 1.4.11-1Tomáš Mráz <tmraz@redhat.com> - 1.4.10-5Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.4.10-4Marcela Mašláňová <mmaslano@redhat.com> - 1.4.10-3Marcela Mašláňová <mmaslano@redhat.com> - 1.4.10-1Marcela Mašláňová <mmaslano@redhat.com> - 1.4.9-1Václav Pavlín <vpavlin@redhat.com> - 1.4.8-13Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.4.8-12Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.4.8-11Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.4.8-10Tomáš Mráz <tmraz@redhat.com> - 1.4.8-9Marcela Mašláňová <mmaslano@redhat.com> - 1.4.8-8Karsten Hopp <karsten@redhat.com> 1.4.8-7Rex Dieter <rdieter@fedoraproject.org> 1.4.8-6Marcela Mašláňová <mmaslano@redhat.com> - 1.4.8-5Tomáš Mráz <tmraz@redhat.com> - 1.4.8-4Tomáš Mráz <tmraz@redhat.com> - 1.4.8-3Tomáš Mráz <tmraz@redhat.com> - 1.4.8-2Marcela Mašláňová <mmaslano@redhat.com> - 1.4.8-1Marcela Mašláňová <mmaslano@redhat.com> - 1.4.7-3Tomáš Mráz <tmraz@redhat.com> - 1.4.7-2Marcela Mašláňová <mmaslano@redhat.com> - 1.4.7-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.4.6-9Marcela Mašláňová <mmaslano@redhat.com> - 1.4.6-8Marcela Mašláňová <mmaslano@redhat.com> - 1.4.6-7Marcela Mašláňová <mmaslano@redhat.com> - 1.4.6-6Tomas Mraz <tmraz@redhat.com> - 1.4.6-5Marcela Mašláňová <mmaslano@redhat.com> - 1.4.6-4Marcela Mašláňová <mmaslano@redhat.com> - 1.4.6-3Marcela Mašláňová <mmaslano@redhat.com> - 1.4.6-2Marcela Mašláňová <mmaslano@redhat.com> - 1.4.6-1Marcela Mašláňová <mmaslano@redhat.com> - 1.4.5-4Marcela Mašláňová <mmaslano@redhat.com> - 1.4.5-2Marcela Mašláňová <mmaslano@redhat.com> - 1.4.5-1Marcela Mašláňová <mmaslano@redhat.com> - 1.4.4-1Marcela Mašláňová <mmaslano@redhat.com> - 1.4.3-3Marcela Mašláňová <mmaslano@redhat.com> - 1.4.3-2Marcela Mašláňová <mmaslano@redhat.com> - 1.4.3-1Marcela Mašláňová <mmaslano@redhat.com> - 1.4.2-2Marcela Mašláňová <mmaslano@redhat.com> - 1.4.2-1Tomas Mraz <tmraz@redhat.com> - 1.4.1-3Tomas Mraz <tmraz@redhat.com> - 1.4.1-2Marcela Mašláňová <mmaslano@redhat.com> - 1.4.1-1Tomas Mraz <tmraz@redhat.com> - 1.4-4Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.4-3Marcela Mašláňová <mmaslano@redhat.com> - 1.4-2Marcela Mašláňová <mmaslano@redhat.com> - 1.3-2Marcela Mašláňová <mmaslano@redhat.com> - 1.3-1Marcela Mašláňová <mmaslano@redhat.com> - 1.2-8Tomas Mraz <tmraz@redhat.com> - 1.2-7Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.2-6Marcela Mašláňová <mmaslano@redhat.com> - 1.2-5Marcela Mašláňová <mmaslano@redhat.com> - 1.2-4Marcela Maslanova <mmaslano@redhat.com> - 1.2-3Marcela Maslanova <mmaslano@redhat.com> - 1.2-2Marcela Maslanova <mmaslano@redhat.com> - 1.2-1Tomas Mraz <tmraz@redhat.com> - 1.1-3Marcela Maslan�x�������������0�����Xo#�fJj�������,�����Z�����������������,t�F�Intire <cory@cpanel.net> - 7.2.22-1Cory McIntire <cory@cpanel.net> - 7.2.21-1Cory McIntire <cory@cpanel.net> - 7.2.20-3Cory McIntire <cory@cpanel.net> - 7.2.20-2Cory McIntire <cory@cpanel.net> - 7.2.20-1Tim Mullin <tim@cpanel.net> - 7.2.19-2Cory McIntire <cory@cpanel.net> - 7.2.19-1Julian Brown <julian.brown@cpanel.net> - 7.2.18-2Cory McIntire <cory@cpanel.net> - 7.2.18-1Daniel Muey <dan@cpanel.net> - 7.2.17-4Tim Mullin <tim@cpanel.net> - 7.2.17-3Tim Mullin <tim@cpanel.net> - 7.2.17-2Cory McIntire <cory@cpanel.net> - 7.2.17-1Cory McIntire <cory@cpanel.net> - 7.2.16-2Cory McIntire <cory@cpanel.net> - 7.2.16-1Cory McIntire <cory@cpanel.net> - 7.2.15-1Tim Mullin <tim@cpanel.net> - 7.2.14-3Cory McIntire <cory@cpanel.net> - 7.2.14-2Cory McIntire <cory@cpanel.net> - 7.2.14-1Cory McIntire <cory@cpanel.net> - 7.2.13-1Cory McIntire <cory@cpanel.net> - 7.2.12-1Tim Mullin <tim@cpanel.net> - 7.2.11-2Cory McIntire <cory@cpanel.net> - 7.2.11-1Cory McIntire <cory@cpanel.net> - 7.2.10-1Cory McIntire <cory@cpanel.net> - 7.2.9-1Tim Mullin <tim@cpanel.net> - 7.2.8-2Cory McIntire <cory@cpanel.net> - 7.2.8-1Cory McIntire <cory@cpanel.net> - 7.2.7-1Rishwanth Yeddula <rish@cpanel.net> - 7.2.6-2Cory McIntire <cory@cpanel.net> - 7.2.6-1Cory McIntire <cory@cpanel.net> - 7.2.5-1Rishwanth Yeddula <rish@cpanel.net> - 7.2.4-3Rishwanth Yeddula <rish@cpanel.net> - 7.2.4-2Daniel Muey <dan@cpanel.net> - 7.2.4-1Cory McIntire <cory@cpanel.net> - 7.2.3-3Daniel Muey <dan@cpanel.net> - 7.2.3-2Daniel Muey <dan@cpanel.net> - 7.2.3-1Daniel Muey <dan@cpanel.net> - 7.2.2-1<darren@cpanel.net> - 7.2.1-5<darren@cpanel.net> - 7.2.1-4Cory McIntire <cory@cpanel.net> - 7.2.1-3<julian.brown@cpanel.net> - 7.2.1-2Jacob Perkins <jacob.perkins@cpanel.net> - 7.2.1-1<dan@cpanel.net> - 7.2.0-13<cory@cpanel.net> - 7.2.0-12<cory@cpanel.net> - 7.2.0-11.RC6<dan@cpanel.net> - 7.2.0-10.RC5Jacob Perkins <jacob.perkins@cpanel.net> - 7.2.0-9.RC5Dan Muey <dan@cpanel.net> - 7.2.0-8.RC3<cory@cpanel.net> - 7.2.0-7.RC3Tim Mullin <tim@cpanel.net> - 7.2.0-6.RC3Dan Muey <dan@cpanel.net> - - 7.2.0-5.RC3<dan@cpanel.net> - 7.2.0-4.RC3<dan@cpanel.net> - 7.2.0-3.RC1Dan Muey <dan@cpanel.net> - 7.2.0-2.beta3Dan Muey <dan@cpanel.net> - 7.2.0-1.beta3- EA4-136: Fix libxml2 v2.15.0 compatibility- ZC-12167: Correct libxml2 problem- EA-11821: Patch to build with the latest ea-libxml2- ZC-10873: Do not build on Ubuntu 22- EA-10532: Update litespeed to 8.0.1- EA-9013: Disable %check section- EA-9625: Update litespeed to 7.9- ZC-8005: Replace ea-openssl11 with system openssl on C8- ZC-7893: Update DSO config to factor in PHP 8- EA-9390: Fix build with latest ea-brotli (v1.0.9)- EA-9338: Update scl-php72 from v7.2.33 to v7.2.34- EA-9281: Update litespeed from upstream to 7.8- EA-9222: Update scl-php72 from v7.2.32 to v7.2.33- EA-9189: Update litespeed from upstream to 7.7- EA-9152: Update scl-php72 from v7.2.31 to v7.2.32- ZC-6875: Build on C8- EA-9087: Fix PHP version in DSO description- EA-9067: Update scl-php72 from v7.2.30 to v7.2.31- EA-9015: Update scl-php72 from v7.2.29 to v7.2.30- EA-8928: Updated the required version for ea-libcurl- EA-8931: Update scl-php72 from v7.2.28 to v7.2.29- ZC-6247: Remove conflict between php-fpm and runtime.- EA-8873: Update scl-php72 from v7.2.27 to v7.2.28- EA-8854: Fix circular dependencies in our PHP packages- EA-8850: Update scl-php72 from v7.2.26 to v7.2.27- ZC-4361: Update ea-openssl requirement to v1.1.1 (ZC-5583)- EA-8797: Update scl-php72 from v7.2.25 to v7.2.26- EA-8762: Update litespeed from upstream to 7.6- EA-8760: Update scl-php72 from v7.2.24 to v7.2.25- EA-8718: Update scl-php72 from v7.2.23 to v7.2.24- EA-8670: Update scl-php72 from v7.2.22 to v7.2.23- EA-8549: Build php-fpm with pcntl- EA-8635: Update scl-php72 from v7.2.21 to v7.2.22- EA-8593: Update scl-php72 from v7.2.20 to v7.2.21- EA-8576: Update litespeed from upstream to 7.5- EA-8558: Update litespeed from upstream to 7.4.2- EA-8560: Update scl-php72 from v7.2.19 to v7.2.20- EA-8538:�x�������������������X�#�gJj��������p������������������������������skasal@redhat.com> - 20081208-2Stepan Kasal <skasal@redhat.com> - 20081208-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 20081020-3Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 20081020-2Stepan Kasal <skasal@redhat.com> - 20081020-1Tom "spot" Callaway <tcallawa@redhat.com> - 1.15-4Robin Norwood <rnorwood@redhat.com> - 1.15-3Robin Norwood <rnorwood@redhat.com> - 1.15-2Robin Norwood <rnorwood@redhat.com> - 1.15-1- Mass rebuild 2013-12-27- Update to 20120719.001:
  - Require Test::More ≥ 0.95 for subtest support
  - No code or feature changes
- Bump Test::Manifest version requirement to 1.21
- Bump Test::More version requirement to 0.95
- Drop redundant buildreq perl(Test::Prereq)- Update to 20120719:
  - Support using data from RangeMessage.xml, so you can use the latest data
    from ISBN without updating this module
- Fix shellbang and permissions of make_data.pl script to placate rpmlint
- Filter dependency on perl(LWP::Simple), required only by make_data.pl script,
  not in normal operation
- Don't need to remove empty directories from the buildroot
- BR: perl(Carp), perl(File::Spec::Functions) and perl(Test::Manifest) ≥ 1.14
- BR: at least version 1.00 of perl(Test::Pod)- Rebuilt for https://fedoraproject.org/wiki/Fedora_18_Mass_Rebuild- Perl 5.16 rebuild- Clean up for modern rpmbuild:
  - Drop BuildRoot specification
  - Drop %clean section
  - Don't bother cleaning buildroot in %install section
  - Make %files list more explicit
  - Use DESTDIR rather than PERL_INSTALL_ROOT
  - Use %{_fixperms} macro rather than our own chmod incantation
  - Replace provides filter with version that works with rpm ≥ 4.9
- Include tests as %doc since they're referred to by examples/README- Rebuilt for https://fedoraproject.org/wiki/Fedora_17_Mass_Rebuild- Perl mass rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_15_Mass_Rebuild- Rebuild to fix problems with vendorarch/lib (#661697)- Mass rebuild with perl-5.12.0- rebuild against perl 5.10.1- new upstream version- Rebuilt for https://fedoraproject.org/wiki/Fedora_12_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_11_Mass_Rebuild- new upstream version- rebuild for new perl- Should not provide perl(Business::ISBN)- Fix BuildRequires- Initial build	

�20120719.00120120719.001-2.el7perl-Business-ISBN-Data-20120719.001ChangesLICENSEREADMEexamplesREADMEtcheck_data_structure.tload.tpod.tpod_coverage.ttest_manifestBusiness::ISBN::Data.3pm.gzBusinessISBNData.pmRangeMessage.xmlmake_data.pl/usr/share/doc//usr/share/doc/perl-Business-ISBN-Data-20120719.001//usr/share/doc/perl-Business-ISBN-Data-20120719.001/examples//usr/share/doc/perl-Business-ISBN-Data-20120719.001/t//usr/share/man/man3//usr/share/perl5/vendor_perl//usr/share/perl5/vendor_perl/Business//usr/share/perl5/vendor_perl/Business/ISBN/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches   -m64 -mtune=genericcpioxz2noarch-redhat-linux-gnudirectoryASCII text, with escape sequencesASCII text, with no line terminatorsASCII textPerl script, ASCII text executableawk script, ASCII texttroff or preprocessor input, ASCII text (gzip compressed data, from Unix, max compression)Perl5 module source textXML  document textPRRRRRRRRR?����[�S�*K$ƨ������*
 w���1�+�q	:l���N����ƣ��[�qaa����
�֗�9�E֤��!F̥��3�6�nZ��sT)��e����R��x������������� �����X'#�gJj����0R�����������:�����R����������������:9;�7cf1f4f3af66ef8b752905e1485644f2e5041ba04910fb2b2f61e9be5fead29717f843c1ba4a0145826a932ae0437f37bcfc0cb6c0dd6d907841d5b6a215915eeb2f78f9b7f7ee3c2ae5635e0c3d6b299a698465d3f42af9bcc81ad52f1e2bbd4c724cdd180316bfe413f572685437162d2b8a005615359cfcdafddbf0d356278f519b3373f9de25c9b19895ed3c6b36b6ef3897efa4d235f5e287468ae16371c420d6a3c9dfbd2e16a4388313b388286e6c5b44139ffc3b5baf24b28923768a11902e2a961bcb91baa6ff385649d511a2ad5311f3ffd8162eb29f1d5e68c0041532b39b93dc46a08ddbac7f318a605fd494f2b89fab566df1c97d53a6ec8946f9181ac926c88100525cafb69c6a943449278b4deef12c5d463522ecb66a94f2a2c92740125279736d656554588093d81b6eeb88cccc3c096bf0d0940448ff0419428f1bf3e13972284bb1094a86d36fba84a9f149ddbbcaf028781f5297b1623423d4c81ff4fbcc8bf2901285a02140445e5bf2d2e9ca8262888a177d7e83f6c6617480dd583e812d28a113904f0978384475efb8315bd0f78c97b6e103dfbfb072b4eb9bbda0c1b3cf3cf2746cf36c43fc2f98973e2af2b92a59a92696e307b1f483c1bb73eff76e51dc270cd998c1f0906e798eb1764231224c0beee84a2d5adcbff1062315fc694c1d7c821e31e6b1e956925d5e0e2e6b2b3fc57fc43c2234a45aefe1ba626ae08ee1527d0113590b293e206754e15c911d588c761746ecbe36d6c36682bd4f0ea38db7efe73941a889850594f0eca78725223d24c457caaab9a14e9c39c8298ae4ce32ae0ee81b55b9dbb641d31ed945111ea54bc7ee64ac067293306577c64ef73d50a1ad3c6f819564281d2c59bbe7a698b205b511bdbe48aefadc99481e25c0cadf96244ef5bc93317e829913e33435c157bc2ec8237171d9721a296c39b9b33f3533efaf09558ed36a3b1ae15d90c5a12724c3352arootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootpython-pycurl-7.19.0-19.el7.src.rpm��������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������pycurlpython-pycurlpython-pycurl(x86-64)@@@@@@@@@



@
keyutils-libslibc.so.6()(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.15)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.4)(64bit)libcurllibcurl.so.4()(64bit)libpthread.so.0()(64bit)libpython2.7.so.1.0()(64bit)python(abi)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PartialHardlinkSets)rpmlib(PayloadFilesHavePrefix)rtld(GNU_HASH)rpmlib(PayloadIsXz)7.29.02.73.0.4-14.6.0-14.0.4-14.0-15.2-14.11.3U�|@T>a�R�U�R�k�Qd�Q7/�Q+R@Q�P4�P
��On@MQ0@ME@Ljy�LH2�K���JlE@I�o@I�o@I���I��@I1.�Hl�@HG�@G��G|�@F�_�Fj�@Ex@Ex@Ex@Ex@Ex@Kamil Dudka <kdudka@redhat.com> - 7.19.0-19Kamil Dudka <kdudka@redhat.com> - 7.19.0-18Daniel Mach <dmach@redhat.com> - 7.19.0-17Daniel Mach <dmach@redhat.com> - 7.19.0-16Kamil Dudka <kdudka@redhat.com> - 7.19.0-15.1Kamil Dudka <kdudka@redhat.com> - 7.19.0-15Kamil Dudka <kdudka@redhat.com> - 7.19.0-14Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 7.19.0-13Jan Synáček <jsynacek@redhat.com> - 7.19.0-12Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 7.19.0-11Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 7.19.0-10Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 7.19.0-9Dennis Gilmore <dennis@ausil.us> - 7.19.0-8Jeffrey C. Ollie <jeff@ocjtech.us> - 7.19.0-7David Malcolm <dmalcolm@redhat.com> - 7.19.0-6Karel Klic <kklic@redhat.com> - 7.19.0-5Fedora Release Engi�x��������������{����X�#�gJjP'������������s��������������������+�0- Use only -f when removing unwanted headers- Add secmodt.h to the headers installed by nss-devel
- nss-devel must install secmodt.h which moved from softoken to pk11wrap with nss-3.14- Update to NSS_3_14_RTM- Update to NSS_3_14_RC1
- update nss-589636.patch to apply to httpdserv
- turn off ocsp tests for now
- remove no longer needed patches
- remove headers shipped by nss-util- Update to NSS_3_13_6_RTM- Rebase pem sources to fedora-hosted upstream to pick up two fixes from rhel-6.3
- Resolves: rhbz#847460 - Fix invalid read and free on invalid cert load
- Resolves: rhbz#847462 - PEM module may attempt to free uninitialized pointer 
- Remove unneeded fix gcc 4.7 c++ issue in secmodt.h that actually undoes the upstream fix- Fix pluggable ecc support- Rebuilt for https://fedoraproject.org/wiki/Fedora_18_Mass_Rebuild- Fix checkin comment to prevent unwanted expansions of percents- Resolves: Bug 830410 - Missing Requires %{?_isa}
- Use Requires: %{name}%{?_isa} = %{version}-%{release} on tools
- Drop zlib requires which rpmlint reports as error E: explicit-lib-dependency zlib
- Enable sha224 portion of powerup selftest when running test suites
- Require nspr 4.9.1- Resolves: rhbz#833529 - revert unwanted change to nss.pc.in- Resolves: rhbz#833529 - Remove unwanted space from the Libs: line on nss.pc.in- Update to NSS_3_13_5_RTM- Resolves: Bug 812423 - nss_Init leaks memory, fix from RHEL 6.3- Resolves: Bug 805723 - Library needs partial RELRO support added
- Patch coreconf/Linux.mk as done on RHEL 6.2- Update to NSS_3_13_4_RTM
- Update the nss-pem source archive to the latest version
- Remove no longer needed patches
- Resolves: Bug 806043 - use pem files interchangeably in a single process
- Resolves: Bug 806051 - PEM various flaws detected by Coverity
- Resolves: Bug 806058 - PEM pem_CreateObject leaks memory given a non-existing file name- Resolves: Bug 805723 - Library needs partial RELRO support added- Cleanup of the spec file
- Add references to the upstream bugs
- Fix typo in Summary for sysinit- Pick up fixes from RHEL
- Resolves: rhbz#800674 - Unable to contact LDAP Server during winsync
- Resolves: rhbz#800682 - Qpid AMQP daemon fails to load after nss update
- Resolves: rhbz#800676 - NSS workaround for freebl bug that causes openswan to drop connections- Update to NSS_3_13_3_RTM- fix issue with gcc 4.7 in secmodt.h and C++11 user-defined literals- Resolves: Bug 784672 - nss should protect against being called before nss_Init- Rebuilt for https://fedoraproject.org/wiki/Fedora_17_Mass_Rebuild- Deactivate a patch currently meant for stable branches only- Resolves: Bug 770682 - nss update breaks pidgin-sipe connectivity
- NSS_SSL_CBC_RANDOM_IV set to 0 by default and changed to 1 on user request- Revert to using current nss_softokn_version
- Patch to deal with lack of sha224 is no longer needed- Resolves: Bug 754771 - [PEM] an unregistered callback causes a SIGSEGV- Resolves: Bug 750376 - nss 3.13 breaks sssd TLS
- Fix how pem is built so that nss-3.13.x works with nss-softokn-3.12.y
- Only patch blapitest for the lack of sha224 on system freebl
- Completed the patch to make pem link against system freebl- Removed unwanted /usr/include/nss3 in front of the normal cflags include path
- Removed unnecessary patch dealing with CERTDB_TERMINAL_RECORD, it's visible- Statically link the pem module against system freebl found in buildroot
- Disabling sha224-related powerup selftest until we update softokn
- Disable sha224 and pss tests which nss-softokn 3.12.x doesn't support- Rebuild with nss-softokn from 3.12 in the buildroot
- Allows the pem module to statically link against 3.12.x freebl
- Required for using nss-3.13.x with nss-softokn-3.12.y for a merge inrto rhel git repo
- Build will be temprarily placed on buildroot override but not pushed in bodhi- Fix broken dependencies by updating the nss-util and nss-softokn versions- Update to NSS_3_13_1_RTM
- Update builtin certs to those from NSSCKBI_1_88_RTM- Update to NSS_3_13_RTM- Update to NSS_3_13_RC0- Fix at�x�������������k����X#�gJj������������W�����?����������������W���S�Z�w@Z\��ZOh�ZN@Z	�Y�@Y�|�Y�B@Y�@Y�@Y�@Y�@Y�J�Yg`�Y1S@Yi@Yi@Y	�@Y.�Y�@Y��X���X�~@X•@X�O@X�O@X�B�X��@X���X��@X��Wu	�Wrf�Wc�@Wc�@WB�Wo@Wo@Wo@W�W��WW@V�n@V�@V�>@V�`�Vp�V'~@U�6@U�6@U�A�U��@U�U��Uݪ@U��UȒ@U���U��@U�'�U�3@U���Ux&�Ux&�Uq�@U?v@U8�U0��U-@U'�@U:�T��T�q@T��Tto@Td�@T)I�S�@S��@Sہ@S��@Sn�S�@R�J@R�R�U�R۾@R۾@R�@R�@R�x@RΏ@R�k�R��@R�;�R�i�R�@Rz/@Rv:�Rt�@RrF@Ro�@Ro�@RnQ�Re@RW�@RS�R�@Q�Q��Q��@Q�K�Q��@Q���Q�W@Q�'@Qq1�QN�Q9�Q7/�Q#@Q��Q�@P�!@Pՠ�P�	@P�q�P��@P�@P�A�P�X�P�d@P�d@P��P��P��@P���P�5@P��Pn�P;a@P(�@P	H@O�;�O�;�O�@O�i�O�@O�@O�}�O~�Oi�OY�OX�@OOd�O&�@O!@@O�O�@O�@N�>@N�>@N��Nܲ@N�`�Nؽ�N��N��@N�u�N�;@Np�@Nf@NA!@N*��Np�M�@M�W�M�c@M��M�@M��@M��MfH@M^_@MZj�MS�@MQ0@MQ0@MQ0@MQ0@MK�@MG��MF�@M6�@M-��M�M@L�s@L�O�L��L�Z@L�6�L�d�L�@L�*@L��@L�A@L���L��@L�4�Lx�@Lx�@Li(@Lf�@L_�L_�LT@L0�L0�L��K�@K�s�K�s�K��K�C�K�C�K�C�K]��KM��KLd@KD{@K<�@K5��K4�@K,�@K+n�K*@K �K�@K�@K�@K��Jݦ@J�<�J�S�J�S�J�@J�v@J��@J�G@J�G@J���J���J��@J�R�J��J��@J�i�J�i�J�@J�@J��J��J�u@J�u@J�u@J�u@J�u@J�#�J�#�J��@J��@J���J���J���J�/@J�:�J�:�Jz�Jj�J?r@J?r@J,�@J)�J)�J�@J{�I�z�I�z�I��I��IԨ�IԨ�I��I��I��I�2�H��H��H�+�H�@H��@H�o�H�@�H`�HC�HG@G�Q�G�]@G��@G��@G�~�G�-@G�-@G�-@G�}�G�@G_�@GS�G1��G��F��F��Fޚ@F�@F��@Fvs�Fk�F`
@E��E�(�E���El$�E	D@E	D@D��@D��@D�@D��@Dv�C��C�@C�C�@C��@C�Z�C�Z�C�Z�C�Z�Bϼ@Azat Nurgaliev <anurgaliev@cloudlinux.com> - 3.90.0-2.tuxcare.els4Pavel Kopylov <pkopylov@cloudlinux.com> - 3.90.0-2.tuxcare.els3Pavel Kopylov <pkopylov@cloudlinux.com> - 3.90.0-2.tuxcare.els2Pavel Kopylov <pkopylov@cloudlinux.com> - 3.90.0-2.tuxcare.els1Bob Relyea <rrelyea@redhat.com> - 3.90.0-2Bob Relyea <rrelyea@redhat.com> - 3.90.0-1Bob Relyea <rrelyea@redhat.com> - 3.79.0-5Bob Relyea <rrelyea@redhat.com> - 3.79.0-4Bob Relyea <rrelyea@redhat.com> - 3.79.0-3Bob Relyea <rrelyea@redhat.com> - 3.79.0-2Bob Relyea <rrelyea@redhat.com> - 3.79.0-1Bob Relyea <rrelyea@redhat.com> - 3.67.0-4Bob Relyea <rrelyea@redhat.com> - 3.67.0-3Bob Relyea <rrelyea@redhat.com> - 3.67.0-2Bob Relyea <rrelyea@redhat.com> - 3.67.0-1Bob Relyea <rrelyea@redhat.com> - 3.66.0-2Bob Relyea <rrelyea@redhat.com> - 3.66.0-1Bob Relyea <rrelyea@redhat.com> - 3.53.1-7Bob Relyea <rrelyea@redhat.com> - 3.53.1-6Bob Relyea <rrelyea@redhat.com> - 3.53.1-5Bob Relyea <rrelyea@redhat.com> - 3.53.1-4Daiki Ueno <dueno@redhat.com> - 3.53.1-3Daiki Ueno <dueno@redhat.com> - 3.53.1-2Daiki Ueno <dueno@redhat.com> - 3.53.1-1Bob Relyea <rrelyea@redhat.com> - 3.44.0-8Bob Relyea <rrelyea@redhat.com> - 3.44.0-7Bob Relyea <rrelyea@redhat.com> - 3.44.0-6Bob Relyea <rrelyea@redhat.com> - 3.44.0-5Bob Relyea <rrelyea@redhat.com> - 3.44.0-4Daiki Ueno <dueno@redhat.com> - 3.44.0-3Daiki Ueno <dueno@redhat.com> - 3.44.0-2Daiki Ueno <dueno@redhat.com> - 3.44.0-1Daiki Ueno <dueno@redhat.com> - 3.43.0-9Daiki Ueno <dueno@redhat.com> - 3.43.0-8Daiki Ueno <dueno@redhat.com> - 3.43.0-7Daiki Ueno <dueno@redhat.com> - 3.43.0-6Daiki Ueno <dueno@redhat.com> - 3.43.0-5Bob Relyea <rrelyea@redhat.com> - 3.43.0-4Daiki Ueno <dueno@redhat.com> - 3.43.0-3Bob Relyea <rrelyea@redhat.com> - 3.43.0-2Daiki Ueno <dueno@redhat.com> - 3.43.0-1Bob Relyea <rrelyea@redhat.com> - 3.36.0-8.1Bob Relyea <rrelyea@redhat.com> - 3.36.0-8Daiki Ueno <dueno@redhat.com> - 3.36.0-7Daiki Ueno <dueno@redhat.com> - 3.36.0-6Daiki Ueno <dueno@redhat.com> - 3.36.0-5Daiki Ueno <dueno@redhat.com> - 3.36.0-4Daiki Ueno <dueno@redhat.com> - 3.36.0-3Daiki Ueno <dueno@redhat.com> - 3.36.0-2Daiki Ueno <dueno@redhat.com> - 3.36.0-1Daiki Ueno <dueno@redhat.com> - 3.34.0-4Daiki Ueno <dueno@redhat.com> - 3.34.0-3Daiki Ueno <dueno@redhat.com> - 3.34.0-2Daiki Ueno <dueno@redhat.com> - 3.34.0-1Daiki Ueno <dueno@redhat.com> - 3.34.0-0.1.beta1Daiki Ueno <dueno@redhat.com> - 3.33.0-3Daiki Ueno <dueno@redhat.com> - 3.33.0-2Daiki Ueno <dueno@redhat.com> - 3.33.0-1Daiki Ueno <dueno@redhat.com> - 3.28.4-14Daiki Ueno <dueno@redhat.com> - 3.28.4-13Daiki Ueno <dueno@redhat.com> - 3.28.4-12Daiki Uen�x��������������Z����X�#�gJj�9������ {������������`�����������������[���st
- php-devel requires pcre-devel and php-cli (instead of php)
- provides php-phar
- update systzdata patch to v10, timezone are case insensitive- php-fpm: create apache user if needed
- php-cli: provides cli command in standard root (scl)- add configtest option to init script
- test configuration before service reload
- fix php-fpm service relocation
- fix php-fpm config relocation
- drop embdded subpackage for scl- missing requires on scl-runtime
- relocate /var/lib/session
- fix php-devel requires
- rename, but don't relocate macros.php- initial spec rewrite for scl build- fix typo in systemd macro- php-fpm: enable PrivateTmp
- php-fpm: new systemd macros (#850268)
- php-fpm: add upstream patch for startup issue (#846858)- systemd integration, https://bugs.php.net/63085
- no odbc call during timeout, https://bugs.php.net/63171
- check sqlite3_column_table_name, https://bugs.php.net/63149- most failed tests explained (i386, x86_64)- fix for http://bugs.php.net/63126 (#783967)- patch to ensure we use latest libdb (not libdb4)- really fix rhel tests (use libzip and libdb)- fix test to enable zip extension on RHEL-7- remove session.save_path from php.ini
  move it to apache and php-fpm configuration files- update to 5.4.7
  http://www.php.net/releases/5_4_7.php
- php-fpm: don't daemonize- enable php-fpm on secondary arch (#849490)- update to 5.4.6
- update to v9 of systzdata patch
- backport fix for new libxml- update to 5.4.5- also provide php(language)%{_isa}
- define %{php_version}- drop BR for libevent (#835671)
- provide php(language) to allow version check- add missing provides (core, ereg, filter, standard)- update to 5.4.4 (CVE-2012-2143, CVE-2012-2386)
- use /usr/lib/tmpfiles.d instead of /etc/tmpfiles.d
- use /run/php-fpm instead of /var/run/php-fpm- update to 5.4.3 (CVE-2012-2311, CVE-2012-2329)- update to 5.4.2 (CVE-2012-1823)- update to 5.4.1- rebuild for new icu
- switch (conditionally) to libdb-devel- fix Loadmodule with MPM event (use ZTS if not MPM worker)
- split conf.d/php.conf + conf.modules.d/10-php.conf with httpd 2.4- rebuild for missing automatic provides (#807889)- really use _httpd_mmn- rebuild against httpd 2.4
- use _httpd_mmn, _httpd_apxs macros- update to PHP 5.4.0 finale- update to PHP 5.4.0RC8- update to PHP 5.4.0RC7
- provides env file for php-fpm (#784770)
- add patch to use system libzip (thanks to spot)
- don't provide INSTALL file- all binaries in /usr/bin with zts prefix- update to PHP 5.4.0RC6
  https://fedoraproject.org/wiki/Features/Php54- fix systemd unit- switch to systemd- Rebuild for new libpng- rebuild with new gmp without compat lib- rebuild with new gmp- revert is_a() to php <= 5.3.6 behavior (from upstream)
  with new option (allow_string) for new behavior- add mysqlnd sub-package
- drop patch4, use --libdir to use /usr/lib*/php/build
- add patch to redirect mysql.sock (in mysqlnd)- update to 5.3.8
  http://www.php.net/ChangeLog-5.php#5.3.8- update to 5.3.7
  http://www.php.net/ChangeLog-5.php#5.3.7
- merge php-zts into php (#698084)- rebuild for net-snmp SONAME bump- enable mhash extension (emulated by hash extension)- rebuild for new MySQL client library- update to 5.3.6
  http://www.php.net/ChangeLog-5.php#5.3.6
- fix php-pdo arch specific requires- disable zip extension per "No Bundled Libraries" policy (#551513)- rebuild for icu 4.6- fix systemd-units requires- add tmpfiles.d configuration for php-fpm
- add Arch specific requires/provides- Rebuilt for https://fedoraproject.org/wiki/Fedora_15_Mass_Rebuild- update to 5.3.5
  http://www.php.net/ChangeLog-5.php#5.3.5
- clean duplicate configure options- rebuild against MySQL 5.5.8
- remove all RPM_SOURCE_DIR- security patch from upstream for #660517- update to 5.3.4
  http://www.php.net/ChangeLog-5.php#5.3.4
- move phpize to php-cli (see #657812)- ghost /var/run/php-fpm (see #656660)
- add filter_setup to not provides extensions as .so- use mysql_config in libdir directly to avoid biarch build failures- rebuild for new net-snmp- add php-�x�������������J����X�#�fJj����������
t�����b����������������
tt�u�tuxcare.els1Marek Polacek <polacek@redhat.com> 4.8.5-44Marek Polacek <polacek@redhat.com> 4.8.5-43Marek Polacek <polacek@redhat.com> 4.8.5-42Marek Polacek <polacek@redhat.com> 4.8.5-41Marek Polacek <polacek@redhat.com> 4.8.5-40Marek Polacek <polacek@redhat.com> 4.8.5-39Marek Polacek <polacek@redhat.com> 4.8.5-38Jeff Law <law@redhat.com> 4.8.5-37Marek Polacek <polacek@redhat.com> 4.8.5-36Marek Polacek <polacek@redhat.com> 4.8.5-35Marek Polacek <polacek@redhat.com> 4.8.5-34Jeff Law <law@redhat.com> 4.8.5-33Jeff Law <law@redhat.com> 4.8.5-32Marek Polacek <polacek@redhat.com> 4.8.5-31Marek Polacek <polacek@redhat.com> 4.8.5-30Jeff Law <law@redhat.com> 4.8.5-29Marek Polacek <polacek@redhat.com> 4.8.5-28Marek Polacek <polacek@redhat.com> 4.8.5-27Jeff Law <law@redhat.com> 4.8.5-26Jeff Law <law@redhat.com> 4.8.5-25Jeff Law <law@redhat.com> 4.8.5-24Marek Polacek <polacek@redhat.com> 4.8.5-23Marek Polacek <polacek@redhat.com> 4.8.5-22Marek Polacek <polacek@redhat.com> 4.8.5-21Marek Polacek <polacek@redhat.com> 4.8.5-20Jeff Law <law@redhat.com> 4.8.5-19Marek Polacek <polacek@redhat.com> 4.8.5-18Marek Polacek <polacek@redhat.com> 4.8.5-17Marek Polacek <polacek@redhat.com> 4.8.5-16Marek Polacek <polacek@redhat.com> 4.8.5-15Marek Polacek <polacek@redhat.com> 4.8.5-14Jakub Jelinek <jakub@redhat.com> 4.8.5-13Jakub Jelinek <jakub@redhat.com> 4.8.5-12Jakub Jelinek <jakub@redhat.com> 4.8.5-11Jakub Jelinek <jakub@redhat.com> 4.8.5-10Jakub Jelinek <jakub@redhat.com> 4.8.5-9Jakub Jelinek <jakub@redhat.com> 4.8.5-8Jakub Jelinek <jakub@redhat.com> 4.8.5-7Jakub Jelinek <jakub@redhat.com> 4.8.5-6Jakub Jelinek <jakub@redhat.com> 4.8.5-5Jakub Jelinek <jakub@redhat.com> 4.8.5-4Jakub Jelinek <jakub@redhat.com> 4.8.5-3Jakub Jelinek <jakub@redhat.com> 4.8.5-2Jakub Jelinek <jakub@redhat.com> 4.8.5-1Richard Henderson <rth@redhat.com> 4.8.3-9Jakub Jelinek <jakub@redhat.com> 4.8.3-8Jakub Jelinek <jakub@redhat.com> 4.8.3-7Jakub Jelinek <jakub@redhat.com> 4.8.3-6Richard Henderson <rth@redhat.com> 4.8.3-5Jakub Jelinek <jakub@redhat.com> 4.8.3-4Jakub Jelinek <jakub@redhat.com> 4.8.3-3Jakub Jelinek <jakub@redhat.com> 4.8.3-2Jakub Jelinek <jakub@redhat.com> 4.8.3-1Jakub Jelinek <jakub@redhat.com> 4.8.2-18Jakub Jelinek <jakub@redhat.com> 4.8.2-17Jakub Jelinek <jakub@redhat.com> 4.8.2-16Jakub Jelinek <jakub@redhat.com> 4.8.2-15Jakub Jelinek <jakub@redhat.com> 4.8.2-14Jakub Jelinek <jakub@redhat.com> 4.8.2-13Jakub Jelinek <jakub@redhat.com> 4.8.2-12Jakub Jelinek <jakub@redhat.com> 4.8.2-11Jakub Jelinek <jakub@redhat.com> 4.8.2-10Jakub Jelinek <jakub@redhat.com> 4.8.2-9Jakub Jelinek <jakub@redhat.com> 4.8.2-8Jakub Jelinek <jakub@redhat.com> 4.8.2-7Jakub Jelinek <jakub@redhat.com> 4.8.2-6Jakub Jelinek <jakub@redhat.com> 4.8.2-5Jakub Jelinek <jakub@redhat.com> 4.8.2-4Jakub Jelinek <jakub@redhat.com> 4.8.2-3Jakub Jelinek <jakub@redhat.com> 4.8.2-2Jakub Jelinek <jakub@redhat.com> 4.8.2-1Jakub Jelinek <jakub@redhat.com> 4.8.1-12Jakub Jelinek <jakub@redhat.com> 4.8.1-11Jakub Jelinek <jakub@redhat.com> 4.8.1-10Jakub Jelinek <jakub@redhat.com> 4.8.1-9Jakub Jelinek <jakub@redhat.com> 4.8.1-8Jakub Jelinek <jakub@redhat.com> 4.8.1-7Jakub Jelinek <jakub@redhat.com> 4.8.1-6Jakub Jelinek <jakub@redhat.com> 4.8.1-5Jakub Jelinek <jakub@redhat.com> 4.8.1-4Jakub Jelinek <jakub@redhat.com> 4.8.1-3Jakub Jelinek <jakub@redhat.com> 4.8.1-2Jakub Jelinek <jakub@redhat.com> 4.8.1-1Jakub Jelinek <jakub@redhat.com> 4.8.0-8Jakub Jelinek <jakub@redhat.com> 4.8.0-7Jakub Jelinek <jakub@redhat.com> 4.8.0-6Jakub Jelinek <jakub@redhat.com> 4.8.0-5Jakub Jelinek <jakub@redhat.com> 4.8.0-4Jakub Jelinek <jakub@redhat.com> 4.8.0-3Jakub Jelinek <jakub@redhat.com> 4.8.0-2Jakub Jelinek <jakub@redhat.com> 4.8.0-1Jakub Jelinek <jakub@redhat.com> 4.8.0-0.18Jakub Jelinek <jakub@redhat.com> 4.8.0-0.17Jakub Jelinek <jakub@redhat.com> 4.8.0-0.16Jakub Jelinek <jakub@redhat.com> 4.8.0-0.15Jakub Jelinek <jakub@redhat.com> 4.8.0-0.14Jakub Jelinek <jakub@redhat.com> 4.8.0-0.13Jakub Jelinek <jakub@�x�������������x9����X!wgJj�Z�������B����O������������������O8�?(d��%�+�	7�	_���������	�������	
�
������	�	�	(�8�9�:GXH`IhXlY|\�]�^�bkdef
l�$8<
L�x|�g�h�Ccpanel-perl-536-perlio-utf8.strict0.0091.cp108~el7CPAN module - Fast and correct UTF-8 IOCpanel build perl module 'PerlIO::utf8_strict'Fast and correct UTF-8 IOb��Gbh-centos-7.dev.cpanel.netN!perlcpanel/perlhttps://metacpan.orglinuxx86_64YGȁ$�$aٻ1b��Dcd60e596055655e5365aded5a644773ea33f774b2a2665f508e6788e1e06e4e3a63b4ea8a56e050bb70658d8c85244e06298a13b25cf90c944ae688b236c0a56rootrootrootrootcpanel-perl-536-perlio-utf8.strict-0.009-1.cp108~el7.src.rpm��������cpanel-perl(PerlIO::utf8_strict)cpanel-perl-perlio-utf8.strictcpanel-perl-536-perlio-utf8.strictcpanel-perl-536-perlio-utf8.strict(x86-64)




cpanel-perl-536cpanel-perl-536-strictcpanel-perl-536-warningscpanel-perl-536-xsloaderrpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(CompressedFileNames)rpmlib(PayloadIsXz)rpmlib(TildeInVersions)4.6.0-14.0-13.0.4-15.2-14.10.0-14.11.1b���b�@`-@_�9�Y��V<�@S>��Todd Rinaldo <toddr@cpan.org> - 0.009-1.cp108Busy Camels <bc@cpanel.net> - 0.008-1.cp108Busy Camels <bc@cpanel.net> - 0.008-1.cp1198Todd Rinaldo <toddr@cpan.org> - 0.008-1.cp1194Todd Rinaldo <toddr@cpanel.net> - 0.007-1.cp1170Todd Rinaldo <toddr@cpan.org> - 0.006-1.cp1156Todd Rinaldo <toddr@cpanel.net> - 0.004-1.cp1146- Update from upstream: PerlIO-utf8_strict 0.009- Bump to 1.cp108 for re-build- Bump to 1.cp1198 for debian re-build- Update from upstream: PerlIO-utf8_strict 0.008- Update from upstream: PerlIO-utf8_strict 0.007- Update from upstream: PerlIO-utf8_strict 0.006- Update from upstream: PerlIO-utf8_strict 0.0040.0090.0090.009-1.cp108~el70.009-1.cp108~el7utf8_strict.pmutf8_strict.so/usr/local/cpanel/3rdparty/perl/536/cpanel-lib/x86_64-linux/PerlIO//usr/local/cpanel/3rdparty/perl/536/cpanel-lib/x86_64-linux/auto/PerlIO/utf8_strict/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches   -m64 -mtune=genericcpioxz2x86_64-redhat-linux-gnu?���!�(�\&��	ʶ�:�{43f670d00f32377ae3316e8365051b8a96540a0ac�VAP8c�VAnel8.0.27-2.2.3.cpanel8.0.27-2.2.3.cpanel8.0.27-2.2.3.cpanel8.0.27-2.2.3.cpanel8.0.27-2.2.3.cpanel8.0.27-2.2.3.cpanel8.0.27-2.2.3.cpanel8.0.27-2.2.3.cpanel8.0.27-2.2.3.cpanel8.0.27-2.2.3.cpanel8.0.27-2.2.3.cpanel8.0.27-2.2.3.cpanel8.0.27-2.2.3.cpanel8.0.27-2.2.3.cpanel8.0.27-2.2.3.cpanel8.0.27-2.2.3.cpanel8.0.278.0.278.0.27-2.2.3.cpanel8.0.27-2.2.3.cpanel8.0.27-2.2.3.cpanel8.0.27-2.2.3.cpanel8.0.27-2.2.3.cpanel8.0.27-2.2.3.cpanelphp.d20-ctype.ini20-phar.ini20-tokenizer.iniphp.iniphpmodulesctype.sophar.sotokenizer.soea-php80-php-common-8.0.27CODING_STANDARDS.mdEXTENSIONSLICENSENEWSREADME.REDIST.BINSREADME.mdTSRM_LICENSEZEND_LICENSElibmagic_LICENSEphp.ini-developmentphp.ini-productionphplib/opt/cpanel/ea-php80/root/etc//opt/cpanel/ea-php80/root/etc/php.d//opt/cpanel/ea-php80/root/usr/lib64//opt/cpanel/ea-php80/root/usr�x��������������(����X/#�gJjeak X4����������������������������������X��@X���W8d�W3�W(��W ��W
@@V�=@V^�@U���U�a@Un�@U>$�U:�T�!�T�D@T��T�}�T�,@T��@T�p@T��T��@Te�T2�@S��@S�@S�@S��@S���S���S�r�S0@S�@S��R��@R��@R�@R��Rp�Re@R].@R[�R' �RZ@Q��Q�@Q��Q���Qd�Q^��QZ�@QG�Q=�@Q7/�Q
\�P��Px@Pv��PS@P2&�P@P
��P	H@P��P�@O�O�9�O���O}�@OpZ@OOd�OD�OC�@OB5�O;�@O'�O�N��N��@N��@Ny�Nm�@NT�NG��N&�@Np�M�I@MY@MQ0@MIG@M>�@M8#�M%��L�[@L�@L�Lw��LH2�LE��L,�@L,�@L�@K�@K�@K�g@K�r�K��Kf�@KU��KK�K
y@K>�J��Ĵ�J�_@J��@J�v@J��@J��@J�u@J��@Jj�JKO�J.N�I��@I�n@I�2�I���Iq�@IFF�H��@H�8@H��@H�z@Hkm�HQ�H=I@H)��G�@G΋@GƢ@G��@G�D@G��G��G��@G��G��G�N�GS�G/�G�@G�F�l@F��F�%@F��@F�$@F���F���F��@F�@FR�@F,��Eّ@Et
�E[@E?Q�E��E�@D��@D��@D���DP�@C�t�C�@C�.�C�Cá�C�q�C���Cs6@Cs6@CJW�C;�@C	�@B�=�B�T�B��Bx�@Bn-@Bn-@B$Y@B$Y@B$Y@A��Aڅ@A�v�A[�@A+-�A$�@A�@@�6@@��@��@��@���@�c@@�@}'�@r��@h�@Dw@@9�@@,�@@(�@ �@�@@�@?�F@?��?�?�\@?��?��@?�6�?r�?a�@?L�@?!�?'@?��?>@?�?�@?&@>��@>܍�>��@>�F�>�R@>�]�>���>G�@>.��>�@=��@=��=�z@=�z@=ϛ�=�a@=�S�=�
�=��@=j@<�@<s��<p�<o�@<i�<c��<Z�@<R�@<QH�<N��<Ek@<Ek@<B�@<B�@<B�@<!�;��;�P@;��;�8@;��;�+�;��@;�|@;�M@;{��;r{@;n��;j�@;X@;Uz@;E�@;C@;A��;@b@;8y@;7'�;0�@;��;�@;	@;@:��@:��@:~��:u[@:p@:mr@:f�:^�:\N�:L|�:,�:+�@:"L�:@:�:W@9��@9��@9�V@9�@9�m@9��9�I�9�@9�1�9��@9�k@9���9��9��@9�j@9�$@9r�@9m�@9l]�9i��9dt�9a�9X�@9J�9;�@9f@9�9�@9��8�e@8��@8�m�8��8�J@7��@7�D@7�}�7‰@7��@7�e�7��@6��@6�-�67@Ivan Danilov <idanilov@cloudlinux.com> - 2.4.46-13Ivan Danilov <idanilov@cloudlinux.com> - 2.4.46-12Matus Honek <mhonek@redhat.com> - 2.4.46-11Matus Honek <mhonek@redhat.com> - 2.4.46-10Matus Honek <mhonek@redhat.com> - 2.4.46-9Matus Honek <mhonek@redhat.com> - 2.4.46-8Fedora Release Engineering <releng@fedoraproject.org> - 2.4.46-7Matus Honek <mhonek@redhat.com> - 2.4.46-6Petr Pisar <ppisar@redhat.com> - 2.4.46-5Matus Honek <mhonek@redhat.com> - 2.4.46-4Matus Honek <mhonek@redhat.com> - 2.4.46-3Jitka Plesnikova <jplesnik@redhat.com> - 2.4.46-2Matus Honek <mhonek@redhat.com> - 2.4.46-1Matus Honek <mhonek@redhat.com> - 2.4.45-14Matus Honek <mhonek@redhat.com> - 2.4.45-13Matus Honek <mhonek@redhat.com> - 2.4.45-12Matus Honek <mhonek@redhat.com> - 2.4.45-11Matus Honek <mhonek@redhat.com> - 2.4.45-10Igor Gnatenko <ignatenkobrain@fedoraproject.org> - 2.4.45-9Matus Honek <mhonek@redhat.com> - 2.4.45-8Matus Honek <mhonek@redhat.com> - 2.4.45-7Björn Esser <besser82@fedoraproject.org> - 2.4.45-6Matus Honek <mhonek@redhat.com> - 2.4.45-5Matus Honek <mhonek@redhat.com> - 2.4.45-4Fedora Release Engineering <releng@fedoraproject.org> - 2.4.45-3Fedora Release Engineering <releng@fedoraproject.org> - 2.4.45-2Matus Honek <mhonek@redhat.com> - 2.4.45-1Matus Honek <mhonek@redhat.com> - 2.4.44-12Jitka Plesnikova <jplesnik@redhat.com> - 2.4.44-11Matus Honek <mhonek@redhat.com> - 2.4.44-10Matus Honek <mhonek@redhat.com> - 2.4.44-9Fedora Release Engineering <releng@fedoraproject.org> - 2.4.44-8Matus Honek <mhonek@redhat.com> - 2.4.44-7Matus Honek <mhonek@redhat.com> - 2.4.44-6Matus Honek <mhonek@redhat.com> - 2.4.44-5Matus Honek <mhonek@redhat.com> - 2.4.44-4Matus Honek <mhonek@redhat.com> - 2.4.44-3Jitka Plesnikova <jplesnik@redhat.com> - 2.4.44-2Matus Honek <mhonek@redhat.com> - 2.4.44-1Matus Honek <mhonek@redhat.com> - 2.4.43-5Matus Honek <mhonek@redhat.com> - 2.4.43-4Peter Robinson <pbrobinson@fedoraproject.org> 2.4.43-3Fedora Release Engineering <releng@fedoraproject.org> - 2.4.43-2Fedora Release Monitoring <release-monitoring@fedoraproject.org> - 2.4.43-1Matúš Honěk <mhonek@redhat.com> - 2.4.41-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2.4.40-14Jitka Plesnikova <jplesnik@redhat.com> - 2.4.40-13Jan Synáček <jsynacek@redhat.com> - 2.4.40-12Jan Synáček <jsynacek@redhat.com> - 2.4.40-11Jan Synáček <jsynacek@redhat.com> - 2.4.40-10Jan Synáček <jsynacek@redhat.com> - 2.4.40-9Jan Synáček <jsynacek@redhat.com> - 2.4.40-9Jan Synáček <jsynacek@redhat.com> - 2.4.40-8Jan Synáček <jsynacek@redhat.com> - 2.4.40-7Jan Syná�Hx�����@�������8���H��4+�+�<��o������������������y��^	��^	U� H�������������"�����������...@��������P���
 ����	����������!������������7��IS�����@����������������`���@�0���������������P����X�#�gJj�8����=������������������=�=�=�de firewallctl (RHBZ#1374799)- Tolerate ipv6_rpfilter fail (RHBZ#1285769)
- Fix set_rules to copy the rule before extracting the table (RHBZ#1373260)
- Translation update (RHBZ#1273296)
- Conflict with NetworkManager < 1:1.4.0-3.el7 (RHBZ#1366288)- Do not use exit code 254 for {ALREADY,NOT}_ENABLED sequences (RHBZ#1366654)
- Fail with NOT_AUTHORIZED if authorization fails (RHBZ#1368549)
- firewall-cmd: Fix get and set description for permanent zones (RHBZ#1368949)
- Fix loading of service helpers in active zones (RHBZ#1371116)- Print errors and warnings to stderr additional patch (RHBZ#1360894)
- Fixed trace back in firewallctl (RHBZ#1367155)
- Fix client crash if systembus can not be aquired (RHBZ#1367038)
- Make ALREADY_ENABLED a warning (RHBZ#1366654)
- Added conflict to old squid package providing the squid.service file
  (RHBZ#1366308)
- Fixed firewall-cmd help typo (RHBZ#1367171)- Fixed firewall-config gettext usage (RHBZ#1361612)
- Fixed ifcfg file reader and writer (RHBZ#1362171)
- Fixed loading ipset entries from file in commands (RHBZ#1365198)
- Added conflicts to old main package to sub packages (RHBZ#1361669)
- Do not show settings of zones etc. without authentication (RHBZ#1357098)
- Fixed CVE-2016-5410 (RHBZ#1359296)- Fix test suite for command change (RHBZ#1360871)
- Fix test suite with stderr usage (RHBZ#1360894)
- Rebuild for wrong docdir without version (RHBZ#1057327#c7)- Updated conflict for selinux-policy (RHBZ#1304723)
- Fixed exit codes in command line clients (RHBZ#1357050)
- Fixed traceback in firewall-cmd without args (RHBZ#1357063)
- Fixed source docs in man pages and help output (RHBZ#1357888)
- Fixed rebuild of changed man pages (RHBZ#1360362)
- Use stderr for errors and warnings in command line tools (RHBZ#1360894)
- Fixed lockdown not denying invalid commands (RHBZ#1360871)- Rebase to 0.4.3.2
- Fix regression with unavailable optional commands
- All missing backend messages should be warnings
- Individual calls for missing restore commands
- Only one authenticate call for add and remove options and also sequences
- RH-Satellite-6 service now upstream
- Conflict for selinux-policy needed to be updated to newer release
  (RHBZ#1304723)- Rebase to 0.4.3.1
- firewall.command: Fix python3 DBusException message not interable error
- src/Makefile.am: Fix path in firewall-[offline-]cmd_test.sh while installing
- firewallctl: Do not trace back on list command without further arguments
- firewallctl (man1): Added remaining sections zone, service, ..
- firewallctl: Added runtime-to-permanent, interface and source parser,
  IndividualCalls setting
- firewall.server.config: Allow to set IndividualCalls property in config
  interface
- Fix missing icmp rules for some zones
- runProg: Fix issue with running programs
- firewall-offline-cmd: Fix issues with missing system-config-firewall
- firewall.core.ipXtables: Split up source and dest addresses for transaction
- firewall.server.config: Log error in case of loading malformed files in
  watcher
- Install and package the firewallctl man page- Readding RH-Satellite-6 service- Fixed typo in Requires(post)- Rebase to 0.4.3
- Rebase to the new upstream and new release (RHBZ#1302802)
- New firewallctl command line utility (RHBZ#1147959)
- Adds radius TCP ports (RHBZ#1219717)
- XSD enhancements for conflicting tag specification (RHBZ#1296573)
- Adds port for corosync-qnetd to high-availability service (RHBZ#1347530)- Rebase to 0.4.2
- Allows unspecifying zone binding for interfaces in firewall-config
  (RHBZ#1066037)
- Adds improved management of zone binding for interfaces, connections and
  sources (RHBZ#1083626)
- Adds commands to showing details of zones, services, .. (RHBZ#1147500)
- Adds a default logging option (RHBZ#1147951)
- Adds quiet option for firewall-offline-cmd (RHBZ#1220467)
- Adds support for zone chain usage in direct rules (RHBZ#1136801,
  RHBZ#1336881)
- Adds source port support in zones, services and rich rules (RHBZ#1214770)
- Adds services imap and smtps (RHBZ#1220196)
- Fixes runtime to permanent migr�x������������������X�#�fJjroot����������7e�����_����������������7e6exlibcap/libcap-devel
- use 'ntp' user, tune the pre/post scripts, %files
- add $OPTIONS to the init script- droproot/caps patch
- add ntpd user in pre
- make %{_sysconfdir}/ntp ntpd writable- allow comments in %{_sysconfdir}/ntp/step-tickers file (#28786).
- need patch0 (glibc patch) on ia64 too- also set prog=ntpd in initscript- use "$prog" instead of "$0" for the init script- i18n-neutral .init script (#26525)- use gethostbyname on addresses in %{_sysconfdir}/ntp.conf for ntptime command (#26250)- start earlier and stop later (#23530)- i18nize init script (#26078)- typo in ntp.conf (#23173).- rebuilt to fix permissions of /usr/share/doc/ntp-xxx- correct mis-spellings in ntpq.htm (#20007).- add %ghost %{_sysconfdir}/ntp/drift (#15222).- comment out default values for keys, warn about starting with -A (#19316).
- take out -A from ntpd startup as well.
- update to 4.0.99k.- use vsnprintf rather than vsprintf (#16676).- remove Conflicts: so that the installer is happy.- workaround glibc-2.1.90 lossage for now.- move initscript back- automatic rebuild- move and update init script, update post/preun/postun scripts- noreplace ntp.conf,keys files- Create 4.0.99j package.
- FHS packaging./bin/sh/bin/sh/bin/sh/bin/sh	
4.2.6p5-29.el7.centos.24.2.6p5-29.el7.centos.24.2.6p5-29.el7.centos.2ntpkeysstep-tickersntpdatentpdate.servicentpdate-wrapperntpdatentpdate-4.2.6p5COPYRIGHTntpdate.8.gz/etc//etc/ntp//etc/sysconfig//usr/lib/systemd/system//usr/libexec//usr/sbin//usr/share/doc//usr/share/doc/ntpdate-4.2.6p5//usr/share/man/man8/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches   -m64 -mtune=genericcpioxz2x86_64-redhat-linux-gnudirectoryASCII textBourne-Again shell script, ASCII text executableELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked (uses shared libs), for GNU/Linux 2.6.32, BuildID[sha1]=f594958610efe3f347b1e5c1fd5ac1f5c8f37bd6, strippedUTF-8 Unicode texttroff or preprocessor input, ASCII text, with very long lines (gzip compressed data, from Unix, max compression)
RRR
RRRR	R
RRRRRR?���U�^�=�$ƨ���b��k0���kS|�o+�#��`bM�o!t&�$B�Dm��.X���?�aɢܹ�Aާ	13�;v�
�,��jS=siZt+�J0*�/T66����2��e����{yH�h�DC�1`9\�]��&�%��ea&%V����u�|��C��
���),a�Wc�/t0B~�a���,8<�e�H�/�~+�候3L���^4���7�׾Ě�i1��f�5����l�ℯ9h|}vv�*i�\��$I
�"j<�T
%��FB�ÄE����pEZT7����s�d�~���ofMF6��{�>�W�>k��z�A#VS�\B[d-қ�|Q,<\KS�b����*I�{8<�pm����a6��4����³��,,���˫rиO^Φ���zy)O��J�@�lû�!K��s��S�k�a4�R�-�
}���w����t���E��XZ������j=�����6�r#�e��?�<;��j���S���	��{�'�]4��մQ�c"et�^�=�$ƨ������L`C��,�H��ӄ��؎�Àh�S��11g�i���%^��2��g���P�6��JO[��wpP�r
���hTO��|�pT J+^y�i_hs�
�j�r���xf��FyR_f�!j*��u�VtH��E��h{���-����iUg>�b��
�5e|��u��ֱ�ݏL�\�?O{����݁���T�;��M���sg�����5��[t���#����/��G��3������{�K�o�Nؿ�ɮ��e���e��Nm�-�W�Mey�Vy�:V��f,F�������Ц\S�^��Jg���)_0���1�<�kF�>�!=��P���q-�I\k�Q����Z�*&�'Mg�,X�H�"/(!�jsﴸS��%�G9���,��򓘖j��h�K�'�^��z�{m1��(�()o1�69��ڼ%��d]�o��j:˦d5o6�p2%�/�*O�5�m'NJn|��
�5>�/|��WIR�~���,ֶk�^��d40942ab713f3ddb558371615aef2dacb75748fcbL���dbL��ationship inversion (Eric Sandeen) [1071179]
- [fs] btrfs: fix send dealing with file renames and directory moves (Eric Sandeen) [1071179]
- [fs] btrfs: only add roots if necessary in find_parent_nodes() (Eric Sandeen) [1071179]
- [fs] btrfs: Fix 32/64-bit problem with BTRFS_SET_RECEIVED_SUBVOL ioctl (Eric Sandeen) [1071179]
- [fs] btrfs: add missing error check i�x�������������@�����X$#+fJjt ov���������L2Y�����Z����������������2Y1Y3Y�@@@@@@@@@@@@@@


@
/bin/shelfutils-libelf(x86-64)elfutils-libs(x86-64)libasm.so.1()(64bit)libasm.so.1(ELFUTILS_1.0)(64bit)libc.so.6()(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.3)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libc.so.6(GLIBC_2.6)(64bit)libc.so.6(GLIBC_2.7)(64bit)libc.so.6(GLIBC_2.8)(64bit)libdl.so.2()(64bit)libdl.so.2(GLIBC_2.2.5)(64bit)libdw.so.1()(64bit)libdw.so.1(ELFUTILS_0.122)(64bit)libdw.so.1(ELFUTILS_0.126)(64bit)libdw.so.1(ELFUTILS_0.127)(64bit)libdw.so.1(ELFUTILS_0.130)(64bit)libdw.so.1(ELFUTILS_0.138)(64bit)libdw.so.1(ELFUTILS_0.148)(64bit)libdw.so.1(ELFUTILS_0.149)(64bit)libdw.so.1(ELFUTILS_0.158)(64bit)libdw.so.1(ELFUTILS_0.159)(64bit)libdw.so.1(ELFUTILS_0.160)(64bit)libdw.so.1(ELFUTILS_0.161)(64bit)libdw.so.1(ELFUTILS_0.165)(64bit)libdw.so.1(ELFUTILS_0.167)(64bit)libdw.so.1(ELFUTILS_0.171)(64bit)libdw.so.1(ELFUTILS_0.173)(64bit)libdw.so.1(ELFUTILS_0.175)(64bit)libelf.so.1()(64bit)libelf.so.1(ELFUTILS_1.0)(64bit)libelf.so.1(ELFUTILS_1.1)(64bit)libelf.so.1(ELFUTILS_1.1.1)(64bit)libelf.so.1(ELFUTILS_1.2)(64bit)libelf.so.1(ELFUTILS_1.3)(64bit)libelf.so.1(ELFUTILS_1.4)(64bit)libelf.so.1(ELFUTILS_1.5)(64bit)libelf.so.1(ELFUTILS_1.6)(64bit)libelf.so.1(ELFUTILS_1.7)(64bit)libgcc_s.so.1()(64bit)libgcc_s.so.1(GCC_3.0)(64bit)libgcc_s.so.1(GCC_3.3.1)(64bit)libstdc++.so.6()(64bit)libstdc++.so.6(CXXABI_1.3)(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rtld(GNU_HASH)rpmlib(PayloadIsXz)0.176-5.el70.176-5.el73.0.4-14.6.0-14.0-15.2-14.11.3^r
@]Ik�]Ik�\Ɋ@\�@[*A�[d@[{@Z:P�Z�Y��Y�@Y-^�Y&�@Y"�X���W�@U���U��U�@Uyx@S��@S��R�U�R��@R�k�RUE@RIg�R)�RC@R�@Q�@Q�@Q��Q*�Q']�Q"@P�@P;a@P*=�P@P�@O�@O�^@Oy��OF*@OW@O�MZj�MQ0@M-��L��@L�L�*@L�@L(��K޺�K��K��@KPX�KO@J�j�Jn�@I�X@I��@I��Iy�@I\�@I[^�H�f@H��@Hr@H(1@G���Gʖ�G��@G6�G�@G��Fɂ@F��@FiD�F&@E�@E��@E��@E+�@D�e�D�{�D��@D�K�Du�@D2_�C�@C�Cǖ@C�q�C���C�@Cf@C!y@C3@Ca@B��B�@B�@B��B�B��B�/@B�h�B��@BP�B}�@B}�@BQ,@BQ,@BQ,@BG�BAZ@B5�B�@AV�@A!�@@�B�@��@mU�@Dw@@,�@@�@@�@?�F@?��?��?��?�.@?t*@?p5�?�@?��?�?
�@>��@>��@>�j@>��@>Z	@>T�@>N+�>H�>BN@>5@>.��>.��> @=�z@=�(�=�(�=��@=�@=�=�K@=�=�@=�V�=�@=Ӑ@=�U�=��@=���=��@=�=�=��@=���=�T�Mark Wielaard <mjw@redhat.com> - 0.176-5Mark Wielaard <mjw@redhat.com> - 0.176-4Mark Wielaard <mjw@redhat.com> - 0.176-3Mark Wielaard <mjw@fedoraproject.org> - 0.176-2Mark Wielaard <mjw@redhat.com> - 0.176-1Mark Wielaard <mjw@redhat.com> - 0.172-2Mark Wielaard <mjw@redhat.com> - 0.172-1Mark Wielaard <mjw@redhat.com> - 0.171-1Mark Wielaard <mjw@redhat.com> - 0.170-4Mark Wielaard <mjw@redhat.com> - 0.170-3Mark Wielaard <mjw@redhat.com> - 0.170-2Mark Wielaard <mjw@redhat.com> - 0.170-1Mark Wielaard <mjw@redhat.com> - 0.168-8Mark Wielaard <mjw@redhat.com> - 0.168-7Mark Wielaard <mjw@redhat.com> - 0.168-6Mark Wielaard <mjw@redhat.com> - 0.168-5Mark Wielaard <mjw@redhat.com> - 0.166-2Mark Wielaard <mjw@redhat.com> - 0.163-3Mark Wielaard <mjw@redhat.com> - 0.163-2Mark Wielaard <mjw@redhat.com> - 0.163-1Mark Wielaard <mjw@redhat.com> - 0.162-1Mark Wielaard <mjw@redhat.com> - 0.160-1Mark Wielaard <mjw@redhat.com> - 0.158-3Daniel Mach <dmach@redhat.com> - 0.158-2Petr Machata <pmachata@redhat.com> - 0.158-1Daniel Mach <dmach@redhat.com> - 0.157-3Mark Wielaard <mjw@redhat.com> 0.157-2Mark Wielaard <mjw@redhat.com> 0.157-1Mark Wielaard <mjw@redhat.com> 0.156-5Mark Wielaard <mjw@redhat.com> 0.156-4Mark Wielaard <mjw@redhat.com> 0.156-3Jan Kratochvil <jan.kratochvil@redhat.com> 0.156-2Jan Kratochvil <jan.kratochvil@redhat.com> 0.156-1Karsten Hopp <karsten@redhat.com> 0.155-6Mark Wielaard <mjw@redhat.com> - 0.155-5Mark Wielaard <mjw@redhat.com> - 0.155-4Mark Wielaard <mjw@redhat.com> - 0.155-3Mark Wielaard <mjw@redhat.com> - 0.155-2Mark Wielaard <mjw@redhat.com> - 0.155-1Petr Machata <pmach�x�������������������X[#eJjb1e8�����������E�����6�����������������E�
��n 5.6.17 via update_pkg.pl (EA-4051)- mod_php requires a non-threaded Apache mpm (EA-3982)- Enabled short_open_tags (ZC-1283)- Disable ZTS Support (EA-3790)- make ea-php5x-php-fpm depend on ea-php5X-php-cli (EA-3836)- Updated to version 5.6.16 via update_pkg.pl (EA-3923)- Rename www.conf to www.conf.example (ZC-1206)- Updated to version 5.6.15 via update_pkg.pl (EA-3784)- Use libphp5.so as module name for simplicity/consistency (EA-3750)- Updated to version 5.6.14 via update_pkg.pl- Updated to version 5.6.13 via update_pkg.pl
- Updated timezonedb patch- Updated to version 5.6.12 via update_pkg.pl- Enabled mcrypt for all builds- Moved "ea-php-cli" to correct package- Added ea-php-cli requirement- Fix macros.php syntax error- Change ea-apache2 to ea-apache24
- corrected version number in previous change log entry- Set imap and recode to be incompatible
- Added libzip compile flags, but set to incompatible with all
  current versions of CentOS (e.g. <= 7).  RHEL patches PHP to
  be compatible with the version of libzip that's supplied by
  them.
- developer version of opcache.ini is distributed instead of auto-gen- Updated to PHP 5.6.6
- Made compatible with EA4 version of web server- Added back in the upstream archive, replaced the excised JSON- fileinfo: fix out-of-bounds read in elf note headers. CVE-2014-3710- xmlrpc: fix out-of-bounds read flaw in mkgmtime() CVE-2014-3668
- core: fix integer overflow in unserialize() CVE-2014-3669
- exif: fix heap corruption issue in exif_thumbnail() CVE-2014-3670- gd: fix NULL pointer dereference in gdImageCreateFromXpm().
  CVE-2014-2497
- gd: fix NUL byte injection in file names. CVE-2014-5120
- core: fix heap-based buffer overflow in DNS TXT record
  parsing. CVE-2014-4049
- network: fix segfault in dns_get_record
  (incomplete fix for CVE-2014-4049). CVE-2014-3597
- core: unserialize() SPL ArrayObject / SPLObjectStorage
  type confusion flaw. CVE-2014-3515
- core: type confusion issue in phpinfo(). CVE-2014-4721
- spl: fix use-after-free in ArrayIterator due to object
  change during sorting. CVE-2014-4698
- spl: fix use-after-free in SPL Iterators. CVE-2014-4670
- fileinfo: cdf_unpack_summary_info() excessive looping
  DoS. CVE-2014-0237
- fileinfo: CDF property info parsing nelements infinite
  loop. CVE-2014-0238
- fileinfo: cdf_read_short_sector insufficient boundary
  check. CVE-2014-0207
- fileinfo: fix extensive backtracking in regular expression
  (incomplete fix for CVE-2013-7345). CVE-2014-3538
- fileinfo: cdf_check_stream_offset insufficient boundary
  check. CVE-2014-3479
- fileinfo: cdf_count_chain insufficient boundary check
  CVE-2014-3480
- fileinfo: fix mconvert incorrect handling of truncated
  pascal string size. CVE-2014-3478
- fileinfo: cdf_read_property_info insufficient boundary
  check. CVE-2014-3487
- fileinfo: fix cdf_read_property_info
  (incomplete fix for CVE-2012-1571). CVE-2014-3587- fileinfo: fix out-of-bounds memory access CVE-2014-2270
- fileinfo: fix extensive backtracking CVE-2013-7345- gd: fix NULL deref in imagecrop CVE-2013-7327
- gd: drop vpx support, fix huge memory consumption #1075201- fix patch name
- fix memory leak introduce in patch for CVE-2014-1943
- fix heap-based buffer over-read in DateInterval CVE-2013-6712- fix infinite recursion in fileinfo CVE-2014-1943- fix heap overflow vulnerability in imagecrop CVE-2013-7226- allow multiple paths in ini_scan_dir #1058161- add security fix for CVE-2013-6420- rebuild- rebuild with test enabled
- add dependency on php-pecl-jsonc- update to PHP 5.5.6
- buildstrap build- update to PHP 5.5.5
- mod_php only for httpd24- update to PHP 5.5.4
- improve security, use specific soap.wsdl_cache_dir
  use /var/lib/php/wsdlcache for mod_php and php-fpm
- sync short_tag comments in php.ini with upstream
- relocate RPM macro- update to PHP 5.5.3
- improve system libzip patch
- fix typo and add missing entries in php.ini- update to PHP 5.5.1 for php55 SCL- rebuild for new httpd-mmn value- remove ZTS conditional stuf for ligibility
- add mod_php�x�������������0�����XB#�eJj�3������0������6q�����^����������������6q5q���*�dSD���r�L��L�h��ƷEŗ�AG|��PJ�Y�?����O��\��@��|�@s�O�J/��1l�w=u�'�#DhD�#����bi0����)qЦI��Â@ώ�˛���(l�k�7��̉�ˣ~�dd�:$ƨ�����<��0ck�z
�Y��;Z����-#��&c�Z豊��	��V�4ӳ65M�?KM����<o��b�E�kz�B��>'jD,�x�g/ͳߡ�u�4E#���Zdjjf]�ɿ�y��f*p8�Zx��0�">SA���K�yh���`�"s�"�.s�T��46����
K�F����	
)��z�-rjP�#��R�����ه�~N�>�rk�ذCcw�y�C��zEn�T�&�D��!�m�#�����.�3�H��?|p!��=B6�]$HW.d�����O	
�q�������ꎚw[]9�MY��j
�8sj2���&v��s��t��7���1��bˀp�y���f��=���U&�n�|�à����In��,9
�6N�@u#�����~
˸�-N!#��<�����:�-���4���L��ε ��{� S�E^�n��-���q,T$�뇰�q`���c����WJ}�����?}c�a�U�����=�59cca2d2df323793d143c39491f26936b1709737dg��<dg�o v7.4.18- EA-9625: Update litespeed to 7.9- EA-9622: Update ea-php74 from v7.4.15 to v7.4.16- EA-9565: Update ea-php74 from v7.4.14 to v7.4.15- EA-9517: Update ea-php74 from v7.4.13 to v7.4.14- ZC-8005: Replace ea-openssl11 with system openssl on C8- EA-9448: Update ea-php74 from v7.4.12 to v7.4.13- EA-9424: Fix the build on CentOS 8- EA-9401: Update ea-php74 from v7.4.11 to v7.4.12- ZC-7893: Update DSO config to factor in PHP 8- EA-9390: Fix build with latest ea-brotli (v1.0.9)- ZC-7497: Reinstate `runselftest`- EA-9339: Update ea-php74 from v7.4.10 to v7.4.11- EA-9281: Update litespeed from upstream to 7.8- EA-9282: Update ea-php74 from v7.4.9 to v7.4.10- EA-9224: Update ea-php74 from v7.4.8 to v7.4.9- EA-9189: Update litespeed from upstream to 7.7- EA-9150: Update ea-php74 from v7.4.7 to v7.4.8- ZC-6967: Build on C8- EA-9109: Update ea-php74 from v7.4.6 to v7.4.7- EA-9087: Fix PHP version in DSO description- EA-9072: Revert new .user.ini search behavior- EA-9070: Update ea-php74 from v7.4.5 to v7.4.6- ZC-6649: Re-enable multibyte regex for 7.4- EA-9014: Build ea-php74 with jpeg support- EA-9007: Update ea-php74 from v7.4.2 to v7.4.5- ZC-6287: Add php_intl with ea-libicu for C6- ZC-6287: Add libzip to zip Requires for C6- EA-8867: Update ea-php74 from v7.4.1 to v7.4.2- ZC-4640: Initial packaginghou-1 1683665360	

20190902-6420190902-647.4.337.4.337.4.337.4.337.4.33-3.3.16.cpanel7.4.33-3.3.16.cpanel7.4.33-3.3.16.cpanel7.4.33-3.3.16.cpanel7.4.33-3.3.16.cpanel7.4.33-3.3.16.cpanel7.4.33-3.3.16.cpanel7.4.33-3.3.16.cpanel7.4.33-3.3.16.cpanel7.4.33-3.3.16.cpanel7.4.33-3.3.16.cpanel7.4.33-3.3.16.cpanel7.4.33-3.3.16.cpanel7.4.33-3.3.16.cpanel7.4.33-3.3.16.cpanel7.4.33-3.3.16.cpanel7.4.33-3.3.16.cpanel7.4.33-3.3.16.cpanel7.4.33-3.3.16.cpanel7.4.33-3.3.16.cpanel7.4.33-3.3.16.cpanel7.4.33-3.3.16.cpanel7.4.33-3.3.16.cpanel7.4.33-3.3.16.cpanel7.4.33-3.3.16.cpanel7.4.33-3.3.16.cpanel7.4.33-3.3.16.cpanel7.4.33-3.3.16.cpanel7.4.33-3.3.16.cpanel7.4.33-3.3.16.cpanel7.4.337.4.337.4.33-3.3.16.cpanel7.4.33-3.3.16.cpanel7.4.33-3.3.16.cpanel7.4.33-3.3.16.cpanel7.4.33-3.3.16.cpanel7.4.33-3.3.16.cpanelphp.d20-ctype.ini20-json.ini20-phar.ini20-tokenizer.iniphp.iniphpmodulesctype.sojson.sophar.sotokenizer.soea-php74-php-common-7.4.33CODING_STANDARDS.mdEXTENSIONSLICENSENEWSREADME.REDIST.BINSREADME.mdTSRM_LICENSEZEND_LICENSElibmagic_LICENSEphp.ini-developmentphp.ini-productionphplib/opt/cpanel/ea-php74/root/etc//opt/cpanel/ea-php74/root/etc/php.d//opt/cpanel/ea-php74/root/usr/lib64//opt/cpanel/ea-php74/root/usr/lib64/php//opt/cpanel/ea-php74/root/usr/lib64/php/modules//opt/cpanel/ea-php74/root/usr/share/doc//opt/cpanel/ea-php74/root/usr/share/doc/ea-php74-php-common-7.4.33//opt/c�x�������������������X�#�eJj8859���������K~����������������������~�}�XQ�nfigs.py182_remove_constraints_from_icontact_throttle.py183_add_user_field_to_malware_scans.py184_create_a_table_for_secure_site_permissions.py185_delete_all_secure_site_id.py186_add_user_field_to_icontact_throttle.py187_fix_scan_unserialization.py188_add_protection_status_field_myimunify.py189_add_messages_to_send_nr.py190_add_analyst_cleanup_request_table.py191_create_wordpress_incident_table.py192_add_wordpress_incident_unique_index.py193_remove_sent_to_server_from_wordpress_incident.py194_add_wp_disabled_rules.py194_create_nonprivileged_config.py195_create_wordpress_site.py196_add_disabled_rules_sync_ts.py197_add_wordpress_site_manually_deleted_at.py198_add_wordpress_site_version.py__init__.py__pycache__001_initial.cpython-311.opt-1.pyc001_initial.cpython-311.pyc002_infected_domain_list.cpython-311.opt-1.pyc002_infected_domain_list.cpython-311.pyc003_import_from_list.cpython-311.opt-1.pyc003_import_from_list.cpython-311.pyc004_add_username_to_infected_domain_list.cpython-311.opt-1.pyc004_add_username_to_infected_domain_list.cpython-311.pyc005_timeout_in_iplist.cpython-311.opt-1.pyc005_timeout_in_iplist.cpython-311.pyc006_comment_in_plist.cpython-311.opt-1.pyc006_comment_in_plist.cpython-311.pyc007_add_country_code_fields.cpython-311.opt-1.pyc007_add_country_code_fields.cpython-311.pyc008_fill_countries.cpython-311.opt-1.pyc008_fill_countries.cpython-311.pyc009_drop_blocklist_history.cpython-311.opt-1.pyc009_drop_blocklist_history.cpython-311.pyc010_drop_country_entities.cpython-311.opt-1.pyc010_drop_country_entities.cpython-311.pyc011_create_new_country_entities.cpython-311.opt-1.pyc011_create_new_country_entities.cpython-311.pyc012_fill_countries_and_subnets.cpython-311.opt-1.pyc012_fill_countries_and_subnets.cpython-311.pyc013_add_indexes_to_iplist.cpython-311.opt-1.pyc013_add_indexes_to_iplist.cpython-311.pyc014_add_malware_hits.cpython-311.opt-1.pyc014_add_malware_hits.cpython-311.pyc015_add_iplist_expiration_index.cpython-311.opt-1.pyc015_add_iplist_expiration_index.cpython-311.pyc016_fix_autowhitelist_expiration.cpython-311.opt-1.pyc016_fix_autowhitelist_expiration.cpython-311.pyc017_remove_sensor_prefix.cpython-311.opt-1.pyc017_remove_sensor_prefix.cpython-311.pyc018_license_info.cpython-311.opt-1.pyc018_license_info.cpython-311.pyc019_purge_old_configs.cpython-311.opt-1.pyc019_purge_old_configs.cpython-311.pyc020_malware_scan_types.cpython-311.opt-1.pyc020_malware_scan_types.cpython-311.pyc021_add_testing_repo.cpython-311.opt-1.pyc021_add_testing_repo.cpython-311.pyc022_mod_security_vendors_migrations.cpython-311.opt-1.pyc022_mod_security_vendors_migrations.cpython-311.pyc023_add_default_rule_in_modsec_custom_conf.cpython-311.opt-1.pyc023_add_default_rule_in_modsec_custom_conf.cpython-311.pyc024_ignore_from_graylist.cpython-311.opt-1.pyc024_ignore_from_graylist.cpython-311.pyc025_malware_config_realtime.cpython-311.opt-1.pyc025_malware_config_realtime.cpython-311.pyc026_remove_old_temporary_file.cpython-311.opt-1.pyc026_remove_old_temporary_file.cpython-311.pyc027_disable_comdo_fp_rules.cpython-311.opt-1.pyc027_disable_comdo_fp_rules.cpython-311.pyc028_set_permanent_ttl_for_blacklist.cpython-311.opt-1.pyc028_set_permanent_ttl_for_blacklist.cpython-311.pyc029_custom_quarantine.cpython-311.opt-1.pyc029_custom_quarantine.cpython-311.pyc030_rename_max_incident_repetition.cpython-311.opt-1.pyc030_rename_max_incident_repetition.cpython-311.pyc031_add_mode_field.cpython-311.opt-1.pyc031_add_mode_field.cpython-311.pyc031_modsec_config_for_plesk_include.cpython-311.opt-1.pyc031_modsec_config_for_plesk_include.cpython-311.pyc032_chmod_quarantine.cpython-311.opt-1.pyc032_chmod_quarantine.cpython-311.pyc033_disable_cphulk.cpython-311.opt-1.pyc033_disable_cphulk.cpython-311.pyc034_hits_extras.cpython-311.opt-1.pyc034_hits_extras.cpython-311.pyc035_add_dos_expiration_field.cpython-311.opt-1.pyc035_add_dos_expiration_field.cpython-311.pyc036_add_block_port.cpython-311.opt-1.pyc036_add_block_port.cpython-31@x�����������������@Providenamee_c�8������������������X�#YgJjxv_pd������8�����C�����"�����������������C�C�C�iatnyk@cloudlinux.com> alutsiuk <alutsiuk@cloudlinux.com> - 1-2.1Anton Volkov <avolkov@cloudlinux.com> - 1-1.26Anton Volkov <avolkov@cloudlinux.com> - 1-1.25Anton Volkov <avolkov@cloudlinux.com>, Sergey Kozhekin <skozhekin@cloudlinux.com> - 1-1.24Stas Django <ssergiienko@cloudlinux.com>, Stepan Oksanichenko <soksanichenko@cloudlinux.com> - 1-1.23Stepan Oksanichenko <soksanichenko@cloudlinux.com> - 1-1.22Stepan Oksanichenko <soksanichenko@cloudlinux.com> - 1-1.21Vasiliy Kleschov <vkleschov@cloudlinux.com> - 1-1.20Vasiliy Kleschov <vkleschov@cloudlinux.com> - 1-1.19Vasiliy Kleschov <vkleschov@cloudlinux.com> - 1-1.18Vasiliy Kleschov <vkleschov@cloudlinux.com> - 1-1.17Vasiliy Kleschov <vkleschov@cloudlinux.com> - 1-1.15Vasiliy Kleschov <vkleschov@cloudlinux.com> - 1-1.14Vasiliy Kleschov <vkleschov@cloudlinux.com> - 1-1.13Vasiliy Kleschov <vkleschov@cloudlinux.com> - 1-1.12Vasiliy Kleschov <vkleschov@cloudlinux.com> - 1-1.11.1Vasiliy Kleschov <vkleschov@cloudlinux.com> - 1-1.10Eugene Zamriy <ezamriy@cloudlinux.com> - 1-1.9Eugene Zamriy <ezamriy@cloudlinux.com> - 1-1.8Eugene Zamriy <ezamriy@cloudlinux.com> - 1-1.7Eugene Zamriy <ezamriy@cloudlinux.com> - 1-1.6Vasiliy Kleschov <vkleschov@cloudlinux.com> - 1-1.5Vasiliy Kleschov <vkleschov@cloudlinux.com> - 1-1.4Vasiliy Kleschov <vkleschov@cloudlinux.com> - 1-1.3Vasiliy Kleschov <vkleschov@cloudlinux.com> - 1-1.2Vasiliy Kleschov <vkleschov@cloudlinux.com> - 1-1.1Vasiliy Kleschov <vkleschov@cloudlinux.com> - 1-1- CLPRO-144: Completely turn off cloudlinux-linksafe on container- add cl-linksafe-apply-group- LVEMAN-1748: Move linksafe group creation to %pre
- LU-2436: Remove cllib dependency from cloudlinux-linksafe- LU-2253, LU-2351: completely turn off cloudlinux-linksafe on solo- LVEMAN-1654: ensure that linksafe group is configured properly on CL8 installed from ISO image- LVEMAN-1648: add "--skip-php-reload" to cagefsctl --setup-cl-selector called by /usr/bin/cl-linksafe-reconfigure- LU-1641: investigate issues with CL8 installation into empty chroot (ISO install)
- SonarQube cloudlinux-linksafe ger_ev- CAG-833: /scripts/postupcp issue (cloudlinux-linksafe?)
- LU-482 Added root permission check to cl-linksafe-reconfigure- CAG-714: cloudlinux-linksafe package should turn off symlink traversal protection by default. Part II- CAG-714: cloudlinux-linksafe package should turn off symlink traversal protection by default- AL-2064: Add psaadm user to linksafe group on Plesk Onyx
- AL-2069: Fix alt-* packages files permissions correction- Added missing sysctl call to apply new linksafe settings- AL-1774: moved cloudlinux-linksafe configuration to /etc/sysctl.d directory- AL-1689: Fixed postupcp hook installation- Added ability to setup linksafe configuration while converting server from CentOS to CloudLinux- Removed python-cllib dependency- Fixed function for repairing sysctl linksafe parameters- Removed lve-utils dependency- Added hook for fixing Plesk work with enabled linksafe protection
- Fixed work of linksafe configuration for 2.6.18 kernel
- Fixed creation of fs.protected_*links_create parameters in /etc/sysctl.conf
- Fixed fs.protected_* parameters cleanup during package uninstallation- Create linksafe group in post section when installing the package- Update alt-python and alt-ruby permissions too- Execute cl-linksafe-reconfigure in postrrans instead of post section- Fix native PHP permissions and reconfigure selector- Don't delete linksafe group during upgrade- Fixed variables quoting in cpanel hooks- Added script to change right to theme files in cPanel to linksafe- Always create linksafe group, added cleanup actions- Checking Link Traversal Protection in more accurate way- Added post execution of cl-linksafe-reconfigure- initial release/bin/sh/bin/sh/bin/sh	

1-5.2.el7cloudlinux-linksafelib.shcl-linksa�x�������������X�����X,#~fJjix m���������n�������9�����
�����������������94
8	�?	Hd��#�(�	4�	g���������	����� 	$
(0�
�����(E8L	9p	:	G�H�I�X�Y�\�]�^b�d	!e	&f	)l	+�	D	X	\
	l�	�	�	�g	�h	�Ccpanel-perl-536-devel-stacktrace2.041.cp108~el7CPAN module - An object representing a stack traceCpanel build perl module 'Devel::StackTrace'An object representing a stack traceb��bh-centos-7.dev.cpanel.net[<artistic_2cpanel/perlhttps://metacpan.orglinuxnoarchCG��$�$\�=k\�=k4235f1a0bd705d15097c677752b53487981b6905ff2f5328ad107aef64b145224ea5c1762a8fca87088f5f932c52df4ccba0bd3038211e7a67588115407bd9carootrootrootrootcpanel-perl-536-devel-stacktrace-2.04-1.cp108~el7.src.rpm��������cpanel-perl(Devel::StackTrace)cpanel-perl(Devel::StackTrace::Frame)cpanel-perl-536-devel-stacktrace-framecpanel-perl-devel-stacktracecpanel-perl-devel-stacktrace-framecpanel-perl-536-devel-stacktrace




cpanel-perl-536cpanel-perl-536-file-speccpanel-perl-536-overloadcpanel-perl-536-scalar-utilcpanel-perl-536-strictcpanel-perl-536-warningsrpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(CompressedFileNames)rpmlib(PayloadIsXz)rpmlib(TildeInVersions)4.6.0-14.0-13.0.4-15.2-14.10.0-14.11.1b�@`-@]w�@[�-�X��@W��@V<�@S>��Q+R@Busy Camels <bc@cpanel.net> - 2.04-1.cp108Busy Camels <bc@cpanel.net> - 2.04-1.cp1198Todd Rinaldo <toddr@cpanel.net> - 2.04-1.cp1180Todd Rinaldo <toddr@cpanel.net> - 2.03-1.cp1178Todd Rinaldo <toddr@cpanel.net> - 2.02-1.cp1162Todd Rinaldo <toddr@cpan.org> - 2.01-1.cp1162Todd Rinaldo <toddr@cpan.org> - 2.00-1.cp1156Todd Rinaldo <toddr@cpanel.net> - 1.31-1.cp1146Todd Rinaldo <toddr@cpanel.net> - 1.27-1.cp1136- Bump to 1.cp108 for re-build- Bump to 1.cp1198 for debian re-build- Update from upstream: Devel-StackTrace 2.04- Update from upstream: Devel-StackTrace 2.03- Update from upstream: Devel-StackTrace 2.02- Update from upstream: Devel-StackTrace 2.01- Update from upstream: Devel-StackTrace 2.00- Update from upstream: Devel-StackTrace 1.31- Update from upstream: Devel-StackTrace 1.272.042.042.042.042.042.04-1.cp108~el7StackTrace.pmFrame.pm/usr/local/cpanel/3rdparty/perl/536/cpanel-lib/Devel//usr/local/cpanel/3rdparty/perl/536/cpanel-lib/Devel/StackTrace/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches   -m64 -mtune=genericcpioxz2noarch-redhat-linux-gnu?���*x���!v���
tv��847a50ab7fa1b3cf3e02b18398cb5661ffe72db6c�VA](c�VA9fb277623eceacde21e5bfaa4b546a56b940e2e984a641eb3f7adfeac9106c3a5d8e7e54f3f5099470cb223dfbda73791415be115637a8621fcebc4fc03ae703a4ff8335f472bf058dafad1cfd718d725989ae812def24730d19458e8fc1db5a67455a0d11915952df6d16b1a7a2a0452ff0c2bf094dbcf38117142a228120fc325edafad01afb13459f6a0f6b0ca767893806e4113d77f4a3e7e517ed56f210cc87f5508c0d61c761682a7a4c4c00a83df96aa2d7f0901991fdaf80d19e4e6ddf307fd032c6a497e6fed0df009a854d3aec907fb112dbe1325c7644d5bb3723a85e2979ae1bfcbe6452e31b1f9fcf60bac41675bf0a37b7033bebf1de96f3101cabed37ee26cfd763999649f9ac9a5f1e5a81cbc5125b8d85ff19d60b72f906be5197c9acd38b8c68651d1e982e0467efac9b5d46c4e928b99192bdea4e4fdf2079c9f1486d270c204850fca458c83dd54dfdb�x�����0o�������y�������	Packagesmeadd has_tdi_phy_lpm capability bit (Don Zickus) [1303209]
- [include] usb: p�x���������������H�����X(#�gJj����p� ������:�����R����������������:;9�e void*).
- Rename the keyctl_security.3 manpage to keyctl_get_security.3.- Fix the library naming wrt the version.
- Move the package to version to 1.4.- Fix spelling mistakes in manpages.
- Add an index manpage for all the keyctl functions.- Fix rpmlint warnings.- Fix compiler warnings in request-key.
- Expose the kernel function to get a key's security context.
- Expose the kernel function to set a processes keyring onto its parent.
- Move libkeyutils library version to 1.3.- Remove syscall manual pages (section 2) to man-pages package [BZ 203582]
- Don't write to serial port in debugging script- Call ldconfig during (un)installation.- Don't include the release number in the shared library filename
- Don't build static library- More bug fixes from Fedora reviewer.- Fix rpmlint errors- Add build dependency on glibc-kernheaders with key management syscall numbers- Add data pipe-in facility for keyctl request2- Rename library and header file "keyutil" -> "keyutils" for consistency
- Fix shared library version naming to same way as glibc.
- Add versioning for shared library symbols
- Create new keyutils-libs package and install library and main symlink there
- Install base library symlink in /usr/lib and place in devel package
- Added a keyutils archive library
- Shorten displayed key permissions list to just those we actually have- Add data pipe-in facilities for keyctl add, update and instantiate- Added stdint.h inclusion in keyutils.h
- Made request-key.c use request_key() rather than keyctl_search()
- Added piping facility to request-key- Added timeout keyctl option
- request_key auth keys must now be assumed
- Fix keyctl argument ordering for debug negate line in request-key.conf- Must invoke initialisation from perror() override in libkeyutils
- Minor UI changes- Bump version to permit building in main repositories.- Don't attempt to define the error codes in the header file.
- Pass the release ID through to the makefile to affect the shared library name.- Build in the perror() override to get the key error strings displayed.- Need a defattr directive after each files directive.- Package creation.	

1.5.8-3.el71.5.8-3.el7keyutils.hlibkeyutils.sokeyctl.3.gzkeyctl_assume_authority.3.gzkeyctl_chown.3.gzkeyctl_clear.3.gzkeyctl_describe.3.gzkeyctl_describe_alloc.3.gzkeyctl_get_keyring_ID.3.gzkeyctl_get_security.3.gzkeyctl_get_security_alloc.3.gzkeyctl_instantiate.3.gzkeyctl_instantiate_iov.3.gzkeyctl_invalidate.3.gzkeyctl_join_session_keyring.3.gzkeyctl_link.3.gzkeyctl_negate.3.gzkeyctl_read.3.gzkeyctl_read_alloc.3.gzkeyctl_reject.3.gzkeyctl_revoke.3.gzkeyctl_search.3.gzkeyctl_session_to_parent.3.gzkeyctl_set_reqkey_keyring.3.gzkeyctl_set_timeout.3.gzkeyctl_setperm.3.gzkeyctl_unlink.3.gzkeyctl_update.3.gzrecursive_key_scan.3.gzrecursive_session_key_scan.3.gz/usr/include//usr/lib64//usr/share/man/man3/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches   -m64 -mtune=genericcpioxz2x86_64-redhat-linux-gnuC source, ASCII texttroff or preprocessor input, ASCII text (gzip compressed data, from Unix, max compression)�x������������������Xn#UfJj��������������H+����� ����������������H+G+"�1�g��f��I�q��~9/3�Aӈ�'��w �,�i�,�x��ҫ�]��#����tp6u�e�v߹㿬��ݝ=6�3�ᧃg͑� ��e"�:�+��s.��*�=E��\��~�oc����x6��?'B�!�֭͢�g�̎��:اb�����q���q�e
��γ4r�y:o֤��Y�\�@Y��d���p7�0��W�m��ۏ����C��*��[����6�|З֨9G�9�c��L+�y���M��Ne)�4Tݭ�&#����.�e�M�$��Ǩg��O�'wLU9a•]��#~q�[��l�ZR����U�O���C������,�B��R�ڈ��v�=u�{����-��Ε�C�D�V�}�O��2��"}[�}�$�Z� �����8��L� �Ѿ߬��&!t}O��x��G^[�N�t��͇�*�����!|��ThA�94ce41cf90f1163f01e902cdfe63195be60caa30bL��pbL��1a5d1758de711271a98af000848028bebdc2d2fd9b775ba6fbf6c781426e9b83b2decb9cfc6d653acdd99329e1f8d0a3872d73668585be68f1052158438aae064cb4951067fd0bab0fc345ec727bc79b1ad616c2d72fc6e4c454cfa554fa027481538b7b6badd9f7c7b6fe18965d3e463b4fd4166d195293e6503133d91d9e2a9a6e87eb4857e3b439d87bdb620a5e9cdf4279aa40c5025b944c3545be4734519e109f38632c9f3314e0b2d24bd7b1ce9e980d684e0f314c93afdbe987a26de1d3cbd35a239da977620d5ee823a86d1d51ffc736f3bf9201a932e0c6bfc4afce356d4cbb2cf417e7450676df4a17c6afaef7207376571ab935f6c740868bd66e8d2299feecf515b1ab8a1db02c1c66ec172eecfce8d5cf4de65dcd4f8308d28700d5d62287747ceb4243900434872978bbf474caf6ac36f1bb30627571c73fce6e0c03504ac21c11ad4da3dda13074de8070e53de08d17f6123248cfbebd61b2e81860208b3ca6545a4b66d799ff094e60c9a3efdff3facfb1d2add1992efaefc33a0fb7ce86ff0f4fdda261b55e2a63fcbc48e4d44f4dc77977c851622845eff5b9ba62994418310e024f325rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootnet-tools-2.0-0.25.20131004git.el7.src.rpm������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������net-toolsnet-tools(x86-64)@@@@@@@


@
/bin/shlibc.so.6()(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.3)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libselinux.so.1()(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rtld(GNU_HASH)systemd-unitsrpmlib(PayloadIsXz)3.0.4-14.6.0-14.0-15.2-14.11.3\3?@Z�m�Z̧@Xۡ�X�g@X�g@X��XX�R�@R��R�U�R�k�RN��R/	�R' �R' �Q��Q��@Qy�Q�P�[�P���P�*�P���Pmz@Pi��PW�PG>�PG>�P4�P4�P	H@O�@O�@O�i�O�\@O"��O�O
y�O��N�U@N��N���N�
@N�j@N���Nw.�NT�N�@M�A�M��@M�V�M�@M��Mt�MQ0@MK�@M9u@M!�@M	�@M	�@L��LΫ�L�*@L��L��La?@L�K�s�K?5@K/c@K�@J�l�J�J�H@J��Jj�JT�@I�2�H�,�H�}@H|�@HsV�G�9�G­�G��F�v�FiD�FR�@F	@E�5@E݅�Eّ@E�3@E�`@E#�@E �@D�+@D��@D���Dm�@D`�@DWI�D?��D>=@D5�D+�@DS@C���C�@C�@C�C�:@C��@C��@C��C�q�CP�@B�B�<�B�R�B�:�Bn-@BR}�BJ��B8�B$Y@B#�B5�B	�@BX@A�n@A�U@A��@A�T@A��A�v�AZ��A<Q@A8\�A3�A3�A!�@A�A,�@�}@@��@���@�(�@~y@@ia@@`&�@4�@@,�@?I�@?I�@?B@?B@>��>��>��@>��@>�
@>̻�>̻�>�j@>��>x[�>C��>5@>.��=��=�?�=O�@=@<��<��@;f��;��:݁�:�R�:�i�:�@:yO�:I�9�@9l]�9<�8�Y�8��@8�@8�8}�@7� �7��7h�@7bK�7 `�6�%@6��@6�<@6��6vO@6i @6J�5�3@5���5�5I�@4���4���4M�4L�@4
Q@3�@Michal Ruprich <mruprich@redhat.com> - 2.0-0.25.20131004gitMichal Ruprich <mruprich@redhat.com> - 2.0-0.24.20131004gitMichal Ruprich <mruprich@redhat.com> - 2.0-0.23.20131004gitMichal Ruprich <mruprich@redhat.com> - 2.0-0.22.20131004gitMichal Ruprich <mruprich@redhat.com> - 2.0-0.21.20131004gitMichal Ruprich <mrup�x�������������8o����X?#9gJjh
(��������s�����w�����������������s�s�;�ded to a GSS
  credential store as "rcache"-type credentials (RT#7818/#7819/#7836,- update to 1.12.1
  - drop patch for RT#7794, included now
  - drop patch for RT#7797, included now
  - drop patch for RT#7803, included now
  - drop patch for RT#7805, included now
  - drop patch for RT#7807, included now
  - drop patch for RT#7045, included now
  - drop patches for RT#7813 and RT#7815, included now
  - add patch to always retrieve the KDC time offsets from keyring caches,
    so that we don't mistakenly interpret creds as expired before their
    time when our clock is ahead of the KDC's (RT#7820, #1030607)- update the PIC patch for iaesx86.s to not use ELF relocations to the version
  that landed upstream (RT#7815, #1045699)- pass -Wl,--warn-shared-textrel to the compiler when we're creating shared
  libraries- amend the PIC patch for iaesx86.s to also save/restore ebx in the
  functions where we modify it, because the ELF spec says we need to- grab a more-commented version of the most recent patch from upstream
  master
- make a guess at making the 32-bit AES-NI implementation sufficiently
  position-independent to not require execmod permissions for libk5crypto
  (more of #1045699)- add patch from Dhiru Kholia for the AES-NI implementations to allow
  libk5crypto to be properly marked as not needing an executable stack
  on arches where they're used (#1045699, and so many others)- revert that last change for a bit while sorting out execstack when we
  use AES-NI (#1045699)- add yasm as a build requirement for AES-NI support, on arches that have
  yasm and AES-NI- pull in fix from master to make reporting of errors encountered by
  the SPNEGO mechanism work better (RT#7045, part of #1043962)- update a test wrapper to properly handle things that the new libkrad does,
  and add python-pyrad as a build requirement so that we can run its tests- revise previous patch to initialize one more element- backport fixes to krb5_copy_context (RT#7807, #1044735/#1044739)- pull in fix from master to return a NULL pointer rather than allocating
  zero bytes of memory if we read a zero-length input token (RT#7794, part of
  - pull in fix from master to ignore an empty token from an acceptor if
  we've already finished authenticating (RT#7797, part of #1043962)
- pull in fix from master to avoid a memory leak when a mechanism's
  init_sec_context function fails (RT#7803, part of #1043962)
- pull in fix from master to avoid a memory leak in a couple of error
  cases which could occur while obtaining acceptor credentials (RT#7805, part
  of #1043962)- update to 1.12 final- update to beta2
  - drop obsolete backports for storing KDC time offsets and expiration times
    in keyring credential caches- rebase to master
- update to beta1
  - drop obsolete backport of fix for RT#7706- pull in fix to store KDC time offsets in keyring credential caches (RT#7768,
  - pull in fix to set expiration times on credentials stored in keyring
  credential caches (RT#7769, #1031724)- update to 1.11.4
  - drop patch for RT#7650, obsoleted
  - drop patch for RT#7706, obsoleted as RT#7723
  - drop patch for CVE-2013-1418/CVE-2013-6800, included in 1.11.4- switch to the simplified version of the patch for #1029110 (RT#7764)- check more thoroughly for errors when resolving KEYRING ccache names of type
  "persistent", which should only have a numeric UID as the next part of the
  name (#1029110)- incorporate upstream patch for remote crash of KDCs which serve multiple
  realms simultaneously (RT#7756, CVE-2013-1418/CVE-2013-6800,- drop patch to add additional access() checks to ksu - they add to breakage
  when non-FILE: caches are in use (#1026099), shouldn't be resulting in any
  benefit, and clash with proposed changes to fix its cache handling- add some minimal description to the top of the wrapper scripts we use
  when starting krb5kdc and kadmind to describe why they exist (tooling)- initial update to alpha1
  - drop backport of persistent keyring support
  - drop backport for RT#7689
  - drop obsolete patc�x��������������^����X�#gJj�����������������	M�����a����������������	M4
8�?Hd��"�'�	3�	?�l�p�����	���������	�
��^
`hr|��D\�(
89$:�G�H�I�X�Y�\�]�^�b�d e%f(l*�DX\
l����g�h�Ccpanel-perl-536-filesys-statvfs0.821.cp108~el7CPAN moduleCpanel build perl module 'Filesys::Statvfs'b�bh-centos-7.dev.cpanel.net9�perlcpanel/perlhttps://metacpan.orglinuxx86_64q2��$�$b�b�332e856348c911f4e9c312b5852ae77c5ed426e5d88934bfae4205ada2b69ef9dd102765e179000a712d471a2c4867b63d80f8aaea3c3dbc806222144bacd046rootrootrootrootcpanel-perl-536-filesys-statvfs-0.82-1.cp108~el7.src.rpm��������cpanel-perl(Filesys::Statvfs)cpanel-perl-filesys-statvfscpanel-perl-536-filesys-statvfscpanel-perl-536-filesys-statvfs(x86-64)




cpanel-perl-536rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(CompressedFileNames)rpmlib(PayloadIsXz)rpmlib(TildeInVersions)4.6.0-14.0-13.0.4-15.2-14.10.0-14.11.1b�@`-@Yy�Q+R@Busy Camels <bc@cpanel.net> - 0.82-1.cp108Busy Camels <bc@cpanel.net> - 0.82-1.cp1198Nicolas Rochelemagne <rochelemagne@cpanel.net> - 0.82-1.cp1168Todd Rinaldo <toddr@cpanel.net> - 0.82-1.cp1136- Bump to 1.cp108 for re-build- Bump to 1.cp1198 for debian re-build- Update patches: Filesys-Statvfs 0.82- Update from upstream: Filesys-Statvfs 0.820.820.820.82-1.cp108~el70.82-1.cp108~el7Statvfs.pmStatvfs.so/usr/local/cpanel/3rdparty/perl/536/cpanel-lib/x86_64-linux/Filesys//usr/local/cpanel/3rdparty/perl/536/cpanel-lib/x86_64-linux/auto/Filesys/Statvfs/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches   -m64 -mtune=genericcpioxz2x86_64-redhat-linux-gnu?���X�G�w�Z�u�X�)���eaf6e337be1caf282ee567436464a8f61a23a01bc�VE<c�VARemi Collet <remi@fedoraproject.org> 5.3.8-4.4Remi Collet <remi@fedoraproject.org> 5.3.8-4.3Adam Jackson <ajax@redhat.com> - 5.3.8-4.2Marcela Mašláňová <mmaslano@redhat.com> - 5.3.8-3.2Peter Schiffer <pschiffe@redhat.com> - 5.3.8-3.1Remi Collet <remi@fedoraproject.org> 5.3.8-3Remi Collet <remi@fedoraproject.org> 5.3.8-2Remi Collet <remi@fedoraproject.org> 5.3.8-1Remi Collet <remi@fedoraproject.org> 5.3.7-1Joe Orton <jorton@redhat.com> - 5.3.6-4Remi Collet <Fedora@famillecollet.com> 5.3.6-3Remi Collet <Fedora@famillecollet.com> 5.3.6-2Remi Collet <Fedora@famillecollet.com> 5.3.6-1Joe Orton <jorton@redhat.com> - 5.3.5-6Caolán McNamara <caolanm@redhat.com> 5.3.5-5Remi Collet <Fedora@famillecollet.com> 5.3.5-4Remi Collet <Fedora@famillecollet.com> 5.3.5-3Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 5.3.5-2Remi Collet <Fedora@famillecollet.com> 5.3.5-1Remi Collet <rpms@famillecollet.com> 5.3.4-2Remi Collet <rpms@famillecollet.com> 5.3.4-1.1Remi Collet <Fedora@famillecollet.com> 5.3.4-1Remi Collet <Fedora@famillecollet.com> 5.3.3-5Joe Orton <jorton@redhat.com> - 5.3.3-4Joe Orton <jorton@redhat.com> - 5.3.3-3Remi Collet <Fedora@famillecollet.com> 5.3.3-2Remi Collet <Fedora@famillecollet.com> 5.3.3-1Remi Collet <Fedora@famillecollet.com> 5.3.2-3Caolán McNamara <caolanm@redhat.com> 5.3.2-2Remi Collet <Fedora@famillecollet.com> 5.3.2-1Joe Orton <jorton@redhat.com> - 5.3.1-3Joe Orton <jorton�x�������������(N����X�#2eJj����pj�������������^V�����6����������������^V]V_V�lsh <dwalsh@redhat.com> 3.0.7-10Dan Walsh <dwalsh@redhat.com> 3.0.7-9Dan Walsh <dwalsh@redhat.com> 3.0.7-8Dan Walsh <dwalsh@redhat.com> 3.0.7-7Dan Walsh <dwalsh@redhat.com> 3.0.7-6Dan Walsh <dwalsh@redhat.com> 3.0.7-5Dan Walsh <dwalsh@redhat.com> 3.0.7-4Dan Walsh <dwalsh@redhat.com> 3.0.7-3Dan Walsh <dwalsh@redhat.com> 3.0.7-2Dan Walsh <dwalsh@redhat.com> 3.0.7-1Dan Walsh <dwalsh@redhat.com> 3.0.6-3Dan Walsh <dwalsh@redhat.com> 3.0.6-2Dan Walsh <dwalsh@redhat.com> 3.0.6-1Dan Walsh <dwalsh@redhat.com> 3.0.5-11Dan Walsh <dwalsh@redhat.com> 3.0.5-10Dan Walsh <dwalsh@redhat.com> 3.0.5-9Dan Walsh <dwalsh@redhat.com> 3.0.5-8Dan Walsh <dwalsh@redhat.com> 3.0.5-7Dan Walsh <dwalsh@redhat.com> 3.0.5-6Dan Walsh <dwalsh@redhat.com> 3.0.5-5Dan Walsh <dwalsh@redhat.com> 3.0.5-4Dan Walsh <dwalsh@redhat.com> 3.0.5-3Dan Walsh <dwalsh@redhat.com> 3.0.5-2Dan Walsh <dwalsh@redhat.com> 3.0.5-1Dan Walsh <dwalsh@redhat.com> 3.0.4-6Dan Walsh <dwalsh@redhat.com> 3.0.4-5Dan Walsh <dwalsh@redhat.com> 3.0.4-4Dan Walsh <dwalsh@redhat.com> 3.0.4-3Dan Walsh <dwalsh@redhat.com> 3.0.4-2Dan Walsh <dwalsh@redhat.com> 3.0.4-1Dan Walsh <dwalsh@redhat.com> 3.0.3-6Dan Walsh <dwalsh@redhat.com> 3.0.3-5Dan Walsh <dwalsh@redhat.com> 3.0.3-4Dan Walsh <dwalsh@redhat.com> 3.0.3-3Dan Walsh <dwalsh@redhat.com> 3.0.3-2Dan Walsh <dwalsh@redhat.com> 3.0.3-1Dan Walsh <dwalsh@redhat.com> 3.0.2-9Dan Walsh <dwalsh@redhat.com> 3.0.2-8Dan Walsh <dwalsh@redhat.com> 3.0.2-7Dan Walsh <dwalsh@redhat.com> 3.0.2-5Dan Walsh <dwalsh@redhat.com> 3.0.2-4Dan Walsh <dwalsh@redhat.com> 3.0.2-3Dan Walsh <dwalsh@redhat.com> 3.0.2-2Dan Walsh <dwalsh@redhat.com> 3.0.1-5Dan Walsh <dwalsh@redhat.com> 3.0.1-4Dan Walsh <dwalsh@redhat.com> 3.0.1-3Dan Walsh <dwalsh@redhat.com> 3.0.1-2Dan Walsh <dwalsh@redhat.com> 3.0.1-1Dan Walsh <dwalsh@redhat.com> 2.6.5-3Dan Walsh <dwalsh@redhat.com> 2.6.5-2Dan Walsh <dwalsh@redhat.com> 2.6.4-7Dan Walsh <dwalsh@redhat.com> 2.6.4-6Dan Walsh <dwalsh@redhat.com> 2.6.4-5Dan Walsh <dwalsh@redhat.com> 2.6.4-2Dan Walsh <dwalsh@redhat.com> 2.6.4-1Dan Walsh <dwalsh@redhat.com> 2.6.3-1Dan Walsh <dwalsh@redhat.com> 2.6.2-1Dan Walsh <dwalsh@redhat.com> 2.6.1-4Dan Walsh <dwalsh@redhat.com> 2.6.1-2Dan Walsh <dwalsh@redhat.com> 2.6.1-1Dan Walsh <dwalsh@redhat.com> 2.5.12-12Dan Walsh <dwalsh@redhat.com> 2.5.12-11Dan Walsh <dwalsh@redhat.com> 2.5.12-10Dan Walsh <dwalsh@redhat.com> 2.5.12-8Dan Walsh <dwalsh@redhat.com> 2.5.12-5Dan Walsh <dwalsh@redhat.com> 2.5.12-4Dan Walsh <dwalsh@redhat.com> 2.5.12-3Dan Walsh <dwalsh@redhat.com> 2.5.12-2Dan Walsh <dwalsh@redhat.com> 2.5.12-1Dan Walsh <dwalsh@redhat.com> 2.5.11-8Dan Walsh <dwalsh@redhat.com> 2.5.11-7Dan Walsh <dwalsh@redhat.com> 2.5.11-6Dan Walsh <dwalsh@redhat.com> 2.5.11-5Dan Walsh <dwalsh@redhat.com> 2.5.11-4Dan Walsh <dwalsh@redhat.com> 2.5.11-3Dan Walsh <dwalsh@redhat.com> 2.5.11-2Dan Walsh <dwalsh@redhat.com> 2.5.11-1Dan Walsh <dwalsh@redhat.com> 2.5.10-2Dan Walsh <dwalsh@redhat.com> 2.5.10-1Dan Walsh <dwalsh@redhat.com> 2.5.9-6Dan Walsh <dwalsh@redhat.com> 2.5.9-5Dan Walsh <dwalsh@redhat.com> 2.5.9-4Dan Walsh <dwalsh@redhat.com> 2.5.9-3Dan Walsh <dwalsh@redhat.com> 2.5.9-2Dan Walsh <dwalsh@redhat.com> 2.5.8-8Dan Walsh <dwalsh@redhat.com> 2.5.8-7Dan Walsh <dwalsh@redhat.com> 2.5.8-6Dan Walsh <dwalsh@redhat.com> 2.5.8-5Dan Walsh <dwalsh@redhat.com> 2.5.8-4Dan Walsh <dwalsh@redhat.com> 2.5.8-3Dan Walsh <dwalsh@redhat.com> 2.5.8-2Dan Walsh <dwalsh@redhat.com> 2.5.8-1Dan Walsh <dwalsh@redhat.com> 2.5.7-1Dan Walsh <dwalsh@redhat.com> 2.5.6-1Dan Walsh <dwalsh@redhat.com> 2.5.5-2Dan Walsh <dwalsh@redhat.com> 2.5.5-1Dan Walsh <dwalsh@redhat.com> 2.5.4-2Dan Walsh <dwalsh@redhat.com> 2.5.4-1Dan Walsh <dwalsh@redhat.com> 2.5.3-3Dan Walsh <dwalsh@redhat.com> 2.5.3-2Dan Walsh <dwalsh@redhat.com> 2.5.3-1Dan Walsh <dwalsh@redhat.com> 2.5.2-6Dan Walsh <dwalsh@redhat.com> 2.5.2-5Dan Walsh <dwalsh@redhat.com> 2.5.2-4Dan Walsh <dwalsh@redhat.com> 2.5.2-3Dan Walsh <dwalsh@redhat.com> 2.5.2-2Dan Walsh <dwalsh@redha�x��������������=����X-#EgJj:+�����������������������x0��  gss_release_name() right after a gss_import_name() (#198092)- rebuild- pull up latest revision of patch to reduce lockups in rsh/rshd- rebuild- rebuild- build- update to 1.5- mark profile.d config files noreplace (Laurent Rineau, #196447)- add buildprereq for autoconf- further munge krb5-config so that 'libdir=/usr/lib' is given even on 64-bit
  architectures, to avoid multilib conflicts; other changes will conspire to
  strip out the -L flag which uses this, so it should be harmless (#192692)- adjust the patch which removes the use of rpath to also produce a
  krb5-config which is okay in multilib environments (#190118)
- make the name-of-the-tempfile comment which compile_et adds to error code
  headers always list the same file to avoid conflicts on multilib installations
- strip SIZEOF_LONG out of krb5.h so that it doesn't conflict on multilib boxes
- strip GSS_SIZEOF_LONG out of gssapi.h so that it doesn't conflict on mulitlib
  boxes- Fix formatting typo in kinit.1 (krb5-kinit-man-typo.patch)- bump again for double-long bug on ppc(64)- give a little bit more information to the user when kinit gets the catch-all
  I/O error (#180175)- rebuild properly when pthread_mutexattr_setrobust_np() is defined but not
  declared, such as with recent glibc when _GNU_SOURCE isn't being used- Use full paths in krb5.sh to avoid path lookups- rebuilt- login: don't truncate passwords before passing them into crypt(), in
  case they're significant (#149476)- update to 1.4.3
- make ksu setuid again (#137934, others)- mark %{krb5prefix}/man so that files which are packaged within it are
  flagged as %doc (#168163)- add an xinetd configuration file for encryption-only telnetd, parallelling
  the kshell/ekshell pair (#167535)- change the default configured encryption type for KDC databases to the
  compiled-in default of des3-hmac-sha1 (#57847)- update to 1.4.2, incorporating the fixes for MIT-KRB5-SA-2005-002 and
  MIT-KRB5-SA-2005-003- rebuild- fix telnet client environment variable disclosure the same way NetKit's
  telnet client did (CAN-2005-0488) (#159305)
- keep apps which call krb5_principal_compare() or krb5_realm_compare() with
  malformed or NULL principal structures from crashing outright (Thomas Biege)
  (#161475)- apply fixes from draft of MIT-KRB5-SA-2005-002 (CAN-2005-1174,CAN-2005-1175)
  (#157104)
- apply fixes from draft of MIT-KRB5-SA-2005-003 (CAN-2005-1689) (#159755)- fix double-close in keytab handling
- add port of fixes for CAN-2004-0175 to krb5-aware rcp (#151612)- prevent spurious EBADF in krshd when stdin is closed by the client while
  the command is running (#151111)- add deadlock patch, removed old patch- update to 1.4.1, incorporating fixes for CAN-2005-0468 and CAN-2005-0469
- when starting the KDC or kadmind, if KRB5REALM is set via the /etc/sysconfig
  file for the service, pass it as an argument for the -r flag- drop krshd patch for now- add draft fix from Tom Yu for slc_add_reply() buffer overflow (CAN-2005-0469)
- add draft fix from Tom Yu for env_opt_add() buffer overflow (CAN-2005-0468)- don't include <term.h> into the telnet client when we're not using curses- update to 1.4
  - v1.4 kadmin client requires a v1.4 kadmind on the server, or use the "-O"
    flag to specify that it should communicate with the server using the older
    protocol
  - new libkrb5support library
  - v5passwdd and kadmind4 are gone
  - versioned symbols
- pick up $KRB5KDC_ARGS from /etc/sysconfig/krb5kdc, if it exists, and pass
  it on to krb5kdc
- pick up $KADMIND_ARGS from /etc/sysconfig/kadmin, if it exists, and pass
  it on to kadmind
- pick up $KRB524D_ARGS from /etc/sysconfig/krb524, if it exists, and pass
  it on to krb524d *instead of* "-m"
- set "forwardable" in [libdefaults] in the default krb5.conf to match the
  default setting which we supply for pam_krb5
- set a default of 24h for "ticket_lifetime" in [libdefaults], reflecting the
  compiled-in default- rebuild- rebuild- update to 1.3.6, which includes the previous fix- apply fix from Tom Yu for�x�������������-����X #�fJjX������������������~�����������������D?�?:�d����	�	[�� �8�<�C�Q�	}�������>�>	D>
�>�>�>
L>D>z>��>�L��(.889p:�>$@$G$0>H%(>I& >X&�Y&�\'>]'�>^+�8b2�d3De3If3Ll3Nt3h>u4`>v5X	w8\>x9T>y:L%�:�:�:�== 
?8�?d?h>?�g?�h?�Clibpwquality1.2.35.el7A library for password generation and password quality checkingThis is a library for password quality checks and generation
of random passwords that pass the checks.
This library uses the cracklib and cracklib dictionaries
to perform some of the checks.Z͇�x86-01.bsys.centos.org�CentOSBSD or GPLv2+CentOS BuildSystem <http://bugs.centos.org>System Environment/Basehttps://github.com/libpwquality/libpwquality/linuxx86_64�,�,�]+��N35=(#�c$o����	
n�"
�!���]��&6�(N$Q�b$�#$��V
k"�t(�$li������
)A��������A큤������������������������������������������������������������������������������������������������������������N�j Z͇�Z͇�Z͇�Z͇�Z͇�Z͇�N.��P �R1��N�ҍP��{Z͇�P��{Z͇�P��{P��{Q��JZ͇�Z͇�P�ԪP��{Z͇�Z͇�P��{Z͇�Q��JZ͇�Z͇�P��{P��{Z͇�Z͇�Z͇�Z͇�R1�(P��{P��{P��{Z͇�Z͇�P��{P��{Z͇�Z͇�P��{P��{P��{P��{P��{Z͇�Z͇�P��{P��{P��{Z͇�Z͇�P��{N��O�8dP�W�P�W�528b9e4a5923cd72f9e13cfa999a5adb746e7ad2cb704ca91dd70d80a502eae00f0e68599bb6da1bac6e80fe16b2162d1188f07dcf92537cc5c680a06e9ba2f4d0bf2a0f08e2a0bfe4e389a12861d64535498124d056422f68f7c506efb85a14fbfabadec37b67cee8dc49b795dfb667066ab465b3cc4c73275187aa20d0f545f28472621c5a7f28c9a4cf31c19399e0293f7d8fc53d02318b14620896598c35fa8bbb020d977bcedaa698cb8956ab04d477dff10fa48366a36f7b0455a984b2aa44d09f651bf99b56253187c7778a240740c767d28453ab7fdc9804c842baee6f273a06340a0bce301cf8e958854d0c32042800334e5e7cbdf30b4ec67aac2c05cb4c9e05f0745480a461fc53dbaac315524c3c0d2c9836718ad9d84fd96efcd1675a9afd976296542f331397cc2effcf3fee5af173708cb7641067fb6c554e1f7bb3714213177e39a3f28ba6a4c0eb631db50ff7f5e52e02dae7bc38e5ccb0a88fa5434d5d819bf98f13b3a574730dc578e841e67a7b82b3ed0cb925c9034082c71b4def4871e3ee80934c22b80de4d85c3f6ff5f3ac30b502572e9266148e18ee81c06f344402478267f4fa701e913304ea6ae8f1968684f0fa460d6ecf8d38a899f33098f713acc793ee2b364068e0138dee8a1b74490ca87df7cbf3161ceafc22a43f9066acd7f484af342b90701848e873cbbc0346aa5644328b9bc0bdbb8ac755b8463d5945606d6e24d545cf246c9f1fc82b212326569086f56132249598d1fac2aef34ae7ce919581aada2e535b393b54e89e553c965a39a48fc94b90663d51f63b9ddbd8411bcd750f79b044360cf3e42c294c14218832ddbe005040b605faf72422bf5b63a2bd258d355babc0b444ac64d959b51bf77186e9b982558c634f126ac19153e05cf0421755556fe7ef2ce7499987129e02fbe0c9c2744cf39b6be9f5acaffcbfdf5093d4153196c764d41f68719ea9d0ecca30985a1199a2018e9ab15e75dd8b4bb20c7a1df6ed780d2b81422670b72b6afeb7005371d16b131ef13e95b8c27d6e51ee692a9ca1e349f89bf5ba9e4e669a944dcaf614a25132e623117ace857366c3bb64fa38270c07dbb3604c218cdb57f78435ea30bcbef9f70993aaf9c625f95367cc090b02cffdf15b5ed45316875ba11ebdb16a273293fc023c9ea5530441eb185ced1d56382413f316dbb9f058318439924625eb7df9785�x������������������Xm#�gJj�K������;���������l��������������������r corrections in init script- fixed tls connection accepting when TLSVerifyClient = allow
- /etc/openldap/ldap.conf removed from files owned by openldap-servers
- minor changes in spec file to supress warnings
- some changes in init script, so it would be possible to use it when
  using old configuration style- rebased openldap to 2.4.19
- rebased bdb to 4.8.24- updated smbk5pwd patch to be linked with libldap (#526500)
- the last buffer overflow patch replaced with the one from upstream
- added /etc/openldap/slapd.d and /etc/openldap/slapd.conf.bak
  to files owned by openldap-servers- cleanup of previous patch fixing buffer overflow- changed configuration approach. Instead od slapd.conf slapd
  is using slapd.d directory now
- fix of some issues caused by renaming of init script
- fix of buffer overflow issue in ldif.c pointed out by new glibc- rebase of openldap to 2.4.18- updated documentation (hashing the cacert dir)- updated init script to be LSB-compliant (#523434)
- init script renamed to slapd- rebuilt with new openssl- updated %pre script to correctly install openldap group- Rebuilt for https://fedoraproject.org/wiki/Fedora_12_Mass_Rebuild- rebase of openldap to 2.4.16
- fixed minor issue in spec file (output looking interactive
  when installing servers)- added $SLAPD_URLS variable to init script (#504504)- extended previous patch (#481310) to remove options cfMP
  from some client tools
- correction of patch setugid (#494330)- removed -f option from some client tools (#481310)- new upstream release- new upstream release
- upgraded to db-4.7.25- rebuild with new openssl- rebuild for libltdl, i.e. copy config.sub|guess from new location- new upstream release- add SLAPD_SHUTDOWN_TIMEOUT to /etc/sysconfig/ldap, allowing admins
  to set non-default slapd shutdown timeout
- add checkpoint to default slapd.conf file (#458679)- provide ldif2ldbm functionality for migrationtools
- rediff all patches to get rid of patch fuzz- new upstream release
- apply official bdb-4.6.21 patches- fix CVE-2008-2952 (#453728)- new upstream release- use /sbin/nologin as shell of ldap user (#447919)- new upstream release
- removed unnecessary MigrationTools patches- bdb upgraded to 4.6.21
- reworked upgrade logic again to run db_upgrade when bdb version
  changes- reworked the upgrade logic, slapcat/slapadd of the whole database
  is needed only if minor version changes (2.3.x -> 2.4.y)
- do not try to save database in LDIF format, if openldap-servers package
  is  being removed (it's up to the admin to do so manually)- migration tools carved out to standalone package "migrationtools"
  (#236697)- new upstream release- fix CVE-2008-0658 (#432014)- init script fixes- init script made LSB-compliant (#247012)- fixed rpmlint warnings and errors
  - /etc/openldap/schema/README moved to /usr/share/doc/openldap- obsoleting compat-openldap properly again :)- obsoleting compat-openldap properly (#429591)- new upstream version (openldap-2.4.7)- new upstream version (openldap-2.4)
- deprecating compat- package- new upstream release- fixed multilib issues - all platform independent files have the
  same content now (#342791)- BDB downgraded back to 4.4.20 because 4.6.18 is not supported by
  openldap (#314821)- skeleton /etc/sysconfig/ldap added
- new SLAPD_LDAP option to turn off listening on ldap:/// (#292591)
- fixed checking of SSL (#292611)
- fixed upgrade with empty database- new upstream version
- added images to the guide.html (#273581)- just rebuild- do not use specific automake and autoconf
- do not distinguish between NPTL and non-NPTL platforms, we have NPTL
  everywhere
- db-4.6.18 integrated
- updated openldap-servers License: field to reference BDB license- new upstream version- MigrationTools-47 integrated- fix compat-slapcat compilation. Now it can be found in
  /usr/lib/compat-openldap/slapcat, because the tool checks argv[0]
  (#246581)- smbk5pwd added (#220895)
- correctly distribute modules between servers and servers-sql packages- Fix initscript retur�x�����������������X#gJj�B�����������r�����������������.0-14.0-15.2-14.11.3XF�@W ��U@�T}��Sہ@R�U�R��RΏ@R�k�R^�Q��@Q��@Q��Qh@Qs�P�P���P�N@P�6@PD��P	H@P
�O��O�P�O��@O�D@O�O�O}�@OL��O3�@O"��O�O�@N��N�N��Nؽ�Nσ@Nˎ�Nå�N�T@N�T@N�^�N�/�N|t�Nm�@Nf@NRD�NL��NL��M��@M��@MQ0@M4/@M
�L;�L5��Jj�I��@H�f@Hn�G��@G=�@F�l@E��@Ej�@D��@D`�@C�@C�C�q�Ca@B(M�B�@A���A���@��@`&�@Q�@@Dw@@,�@?t*@>��@>��@>.��>-6@=�@=��@=�k�=�@=��@=�@=@<��<�a�<>�;�\�;�@:݁�Petr Pisar <ppisar@redhat.com> - 8.32-17Petr Pisar <ppisar@redhat.com> - 8.32-16Petr Pisar <ppisar@redhat.com> - 8.32-15Petr Pisar <ppisar@redhat.com> - 8.32-14Petr Pisar <ppisar@redhat.com> - 8.32-13Daniel Mach <dmach@redhat.com> - 8.32-12Petr Pisar <ppisar@redhat.com> - 8.32-11Petr Pisar <ppisar@redhat.com> - 8.32-10Daniel Mach <dmach@redhat.com> - 8.32-9Petr Pisar <ppisar@redhat.com> - 8.33-8Petr Pisar <ppisar@redhat.com> - 8.32-7Petr Pisar <ppisar@redhat.com> - 8.32-6Petr Pisar <ppisar@redhat.com> - 8.32-5Petr Pisar <ppisar@redhat.com> - 8.32-4Peter Robinson <pbrobinson@fedoraproject.org> 8.32-3Petr Pisar <ppisar@redhat.com> - 8.32-2Petr Pisar <ppisar@redhat.com> - 8.32-1Petr Pisar <ppisar@redhat.com> - 8.32-0.2.RC1Petr Pisar <ppisar@redhat.com> - 8.32-0.1.RC1Petr Pisar <ppisar@redhat.com> - 8.31-2Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 8.31-1.1Petr Pisar <ppisar@redhat.com> - 8.31-1Petr Pisar <ppisar@redhat.com> - 8.31-0.1.RC1Tom Callaway <spot@fedoraproject.org> - 8.30-7Petr Pisar <ppisar@redhat.com> - 8.30-6Petr Pisar <ppisar@redhat.com> - 8.30-5Petr Pisar <ppisar@redhat.com> - 8.30-4Petr Pisar <ppisar@redhat.com> - 8.30-3Petr Pisar <ppisar@redhat.com> - 8.30-2Petr Pisar <ppisar@redhat.com> - 8.30-1Petr Pisar <ppisar@redhat.com> - 8.30-0.1.RC1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 8.21-2.1Petr Pisar <ppisar@redhat.com> - 8.21-2Petr Pisar <ppisar@redhat.com> - 8.21-1Karsten Hopp <karsten@redhat.com> 8.21-0.2.RC1Petr Pisar <ppisar@redhat.com> - 8.21-0.1.RC1Petr Pisar <ppisar@redhat.com> - 8.20-7Petr Pisar <ppisar@redhat.com> - 8.20-6Petr Pisar <ppisar@redhat.com> - 8.20-5Petr Pisar <ppisar@redhat.com> - 8.20-4Petr Pisar <ppisar@redhat.com> - 8.20-3Dan Horák <dan[at]danny.cz> - 8.20-2Petr Pisar <ppisar@redhat.com> - 8.20-1Petr Pisar <ppisar@redhat.com> - 8.20-0.1.RC3Petr Pisar <ppisar@redhat.com> - 8.20-0.1.RC2Petr Pisar <ppisar@redhat.com> - 8.20-0.1.RC1Petr Pisar <ppisar@redhat.com> - 8.13-4Petr Pisar <ppisar@redhat.com> - 8.13-3Petr Pisar <ppisar@redhat.com> - 8.13-2Petr Pisar <ppisar@redhat.com> - 8.13-1Petr Pisar <ppisar@redhat.com> - 8.12-4Petr Pisar <ppisar@redhat.com> - 8.12-3Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 8.12-2Petr Pisar <ppisar@redhat.com> - 8.12-1Petr Pisar <ppisar@redhat.com> - 8.11-1Petr Pisar <ppisar@redhat.com> - 8.10-1Petr Pisar <ppisar@redhat.com> - 7.8-4Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 7.8-3Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 7.8-2Lubomir Rintel <lkundrak@v3.sk> - 7.8-1Tomas Hoger <thoger@redhat.com> - 7.3-4Tomas Hoger <thoger@redhat.com> - 7.3-3Stepan Kasal <skasal@redhat.com> - 7.3-2Than Ngo <than@redhat.com> - 7.3-1Than Ngo <than@redhat.com> - 7.0-1Than Ngo <than@redhat.com> - 6.7-1Jesse Keating <jkeating@redhat.com> - 6.6-1.1Than Ngo <than@redhat.com> 6.6-1Jesse Keating <jkeating@redhat.com> - 6.3-1.2.1Jesse Keating <jkeating@redhat.com> - 6.3-1.2Jesse Keating <jkeating@redhat.com>Than Ngo <than@redhat.com> 6.3-1Joe Orton <jorton@redhat.com> 5.0-4Joe Orton <jorton@redhat.com> 5.0-3Joe Orton <jorton@redhat.com> 5.0-2Than Ngo <than@redhat.com> 5.0-1Elliot Lee <sopwith@redhat.com>Than Ngo <than@redhat.com> 4.5-2Than Ngo <than@redhat.com> 4.5-1Elliot Lee <sopwith@redhat.com>Elliot Lee <sopwith@redhat.com>Harald Hoyer <harald@redhat.de> 4.4-1Elliot Lee <sopwith@redhat.com>Than Ngo <than@redhat.com> 4.2-1Tim Powers <timp@redhat.com>Than Ngo <than@redhat.com> 3.9-9Elliot Lee <sopwith@redhat.com> 3.9-8Than Ngo <than@redhat.com> 3.9-7Than Ngo <t�x������������������X�#�fJj�����������`5������������q�������������������?����bԉ^��R$ƨ�����H,B���O��s���j�7��$�մ�X�b�B��8U��E�=*v�X`��1/A��LH ��7����'�F�1)O���/a��NJ?N��7E�+�
"'��@�,r��և����N���f�law�$_�ޜg�o�U�t�%��ILOe2U�a��	#K�˦�"��<Y��J��|�>��n���M�o^��L:�늊?v�F*s�-���V�VƽIƋ�҉�D���ς!f �F�:zF�Q����ȋ��;����
f���ů��4"@H���!T��2R�"��Vؿ�_-�4�%�&Ă8�w#��Ȓ7wf��V��
e`�
:������#$|[f��5�8<��F�
�saҌrMu�
8
'J�V�n[IKL�I�1 �����c�,_�k�*'[��}�4���t���8���?M}E����]��e�&�\���|«���x�q}�
���BDl�V��آ�a#�a���'�a�@��f�t���4�O
^͛c�SB��t���^��R$ƨ����&�>>h/�B�E�)���I����D�\d�	��‡xD��].|��?]�U�O0R����~K�D���R�5���wHuRYv��ea��j�d�s<�O1H�g�%:>�����-�?X_i��38��l����P����F�/~`R�Dxvu0"��)�"ɘxI�p�x�J�pH���N�=
�j�2<Ǭ93F��o�yq�t���U�3�o�~d�p���"r��/!���6����
g硻���d���W�T�����t�Ȉ���;����/ṿ�×��?5��/����z�3�ַ���;?92b�{��,'�1�V���;��Ǟ� ��yP5`�?~�h4q{��4TPać.=��p^���PK5|����oz��"Gc�G�9��u�uOu
�.{!��Bq�|�xi��ܣP�cޢM0�n{P@�.Q���轋��1�x����.@m�3��~;���/��EX0�|�tp"b%៿��`���j��|<F�{�Q>Weaf3f24fed6d261f7c21c33d6240aaadac4452e6bL��lbL��94]
- [netdrv] mlx5: Update flow table commands layout (Kamal Heib) [1456694]
- [netdrv] mlx5e: Support header re-write of partial fields in TC pedit offload (Kamal Heib) [1456687 1456694]
- [netdrv] mlx5e: Use modify header ID cache for offloaded TC NIC flows (Kamal Heib) [1456687 1456694]
- [netdrv] mlx5e: Use modify header ID cache for offloaded TC E-Switch flows (Kamal Heib) [1456687 1456694]
- [netdrv] mlx5e: Add cache for HW modify header IDs (Kamal Heib) [1456687 1456694]
- [netdrv] mlx5e: Use short attribute form when adding/deleting offloaded TC flows (Kamal Heib) [1456687 1456694]
- [netdrv] mlx5e: Offload TC matching on ip tos / traffic-class (Kamal Heib) [1456687 1456694]
- [netdrv] mlx5e: Offload TC matching on tcp flags (Kamal Heib) [1456687 1456694]
- [netdrv] mlx5e: Remove TC header re-write offloading of ip tos (Kamal Heib) [1456687 1456694]
- [netdrv] mlx5e: Fix warnings around parsing of TC pedit actions (Kamal Heib) [1456687 1456694]
- [netdrv] mlx5e: Properly enforce disallowing of partial field re-write offload (Kamal Heib) [1456687 1456694]
- [netdrv] mlx5e: Allow TC csum offload if applied together with pedit action (Kamal Heib) [1456687 1456694]
- [netdrv] mlx5e: Add offloading of NIC TC pedit (header re-write) actions (Kamal Heib) [1456687 1456694]
- [netdrv] mlx5e: Add parsing of TC pedit actions to HW format (Kamal Heib) [1456687 1456694]- [i2c] introduce helper function to get 8 bit address from a message (Gopal Tiwari) [1456705]
- [i2c] add a flag to mark clients as slaves (Gopal Tiwari) [1456705]
- [i2c] acpi / scan: fix enumeration (visited) flags for bus rescans (Gopal Tiwari) [1456705]
- [i2c] acpi: add support for ACPI reconfiguration notifiers (Gopal Tiwari) [1456705]
- [i2c] acpi / pm: allow child devices to ignore parent power state (Gopal Tiwari) [1456705]
- [i2c] designware: Find bus speed from ACPI (Gopal Tiwari) [1456705]
- [i2c] acpi / pm: Make messages in acpi_device_set_power() print device names (Gopal Tiwari) [1456705]
- [i2c] designware: Enable high speed mode (Gopal Tiwari) [1456705]
- [i2c] designware: set the common config before the if else (Gopal Tiwari) [1456705]
- [i2c] designware: Enable fast mode plus (Gopal Tiwari) [1456705]
- [i2c] designware: get fast plus and high speed *CNT configuration (Gopal Tiwari) [1456705]
- [i2c] designware: Move clk_freq into struct dw_i2c_dev (Gopal Tiwari) [1456705]
- [i2c] designware-pci: Make bus number allocation robust (Gopal Tiwari) [1456705]
- [i2c] designware: Do not calculate SCL timing parameters needlessly (Gopal Tiwari) [1456705]
- [i2c] core: fix NULL pointer dereference under race condition (Gopal Tiwari) [1456705]
- [i2c] export i2c_adapter_depth() (Gopal Tiwari) [1456705]
- [i2c] core: Add function for finding the bus speed from ACPI, take 2 (Gopal Tiwari) [1456705]
- [i2c] core: Cleanup I2C ACPI namespace, take 2 (Gopal Tiwari) [145�x�������������������X#hgJj������������h������������������,>�bc-client bump- Rebuild for openssl bump- update to 5.2.5- correct pcre BR version (#333021)
- restore metaphone fix (#205714)
- add READMEs to php-cli- update to 5.2.4- rebuild for fixed APR- add ldconfig post/postun for -embedded (Hans de Goede)- add php-embedded sub-package- fix build with new glibc
- fix License- define php_extdir in macros.php- obsolete php-dbase- add mcrypt, mhash, tidy, mssql subpackages (Dmitry Butskoy)
- enable dbase extension and package in -common- update to 5.2.3 (thanks to Jeff Sheltren)- fix php-pdo *_arg_force_ref global symbol abuse (#216125)- rebuild against uw-imap-devel- update to 5.2.2
- synch changes from upstream recommended php.ini- enable SASL support in LDAP extension (#205772)- drop mime_magic extension (deprecated by php-pecl-Fileinfo)- fix regression in str_{i,}replace (from upstream)- update to 5.2.1
- add Requires(pre) for httpd
- trim %changelog to versions >= 5.0.0- bump default memory_limit to 32M (#220821)
- mark config files noreplace again (#174251)
- drop trailing dots from Summary fields
- use standard BuildRoot
- drop libtool15 patch (#226294)- add php(api), php(zend-abi) provides (#221302)
- package /usr/share/php and append to default include_path (#225434)- fix filter.h installation path
- fix php-zend-abi version (Remi Collet, #212804)- rebuild again- rebuild for net-snmp soname bump- build json and zip shared, in -common (Remi Collet, #215966)
- obsolete php-json and php-pecl-zip
- build readline extension into /usr/bin/php* (#210585)
- change module subpackages to require php-common not php (#177821)- provide php-zend-abi (#212804)
- add /etc/rpm/macros.php exporting interface versions
- synch with upstream recommended php.ini- update to 5.2.0 (#213837)
- php-xml provides php-domxml (#215656)
- fix php-pdo-abi provide (#214281)- rebuild for curl soname bump
- add build fix for curl 7.16 API- from upstream: add safety checks against integer overflow in _ecalloc- update to 5.1.6 (security fixes)
- bump default memory_limit to 16M (#196802)- rebuild- Provide php-posix (#194583)
- only provide php-pcntl from -cli subpackage
- add missing defattr's (thanks to Matthias Saou)- move Obsoletes for php-openssl to -common (#194501)
- Provide: php-cgi from -cli subpackage- split out php-cli, php-common subpackages (#177821)
- add php-pdo-abi version export (#193202)- rebuilt for new libnetsnmp- provide mod_php (#187891)
- provide php-cli (#192196)
- use correct LDAP fix (#181518)
- define _GNU_SOURCE in php_config.h and leave it defined
- drop (circular) dependency on php-pear- update to 5.1.4- update to 5.1.3- provide php-api (#183227)
- add provides for all builtin modules (Tim Jackson, #173804)
- own %{_libdir}/php/pear for PEAR packages (per #176733)
- add obsoletes to allow upgrade from FE4 PDO packages (#181863)- bump again for double-long bug on ppc(64)- rebuilt for new gcc4.1 snapshot and glibc changes- rebuild for new libc-client soname- only build xmlreader and xmlwriter shared (#177810)- update to 5.1.2- rebuild again- rebuild for new net-snmp- enable short_open_tag in default php.ini again (#175381)- rebuilt- require net-snmp for php-snmp (#174800)- add /usr/share/pear back to hard-coded include_path (#174885)- rebuild for httpd 2.2- update to 5.1.1
- remove pear subpackage
- enable pdo extensions (php-pdo subpackage)
- remove non-standard conditional module builds
- enable xmlreader extension- rebuilt against new openssl- pear: update to XML_RPC 1.4.4, XML_Parser 1.2.7, Mail 1.1.9 (#172528)- rebuild for new libnetsnmp- update to 5.0.5
- add fix for upstream #34435
- devel: require autoconf, automake (#159283)
- pear: update to HTTP-1.3.6, Mail-1.1.8, Net_SMTP-1.2.7, XML_RPC-1.4.1
- fix imagettftext et al (upstream, #161001)- ldap: restore ldap_start_tls() function- disable RPATHs in shared extensions (#156974)- build simplexml_import_dom even with shared dom (#156434)
- prevent truncation of copied files to ~2Mb (#155916)
- install /usr/bin/php from CLI build alongside CGI
- �x�������������p�����X�#�gJj��������������p������������������pcre-devel (#147448)- update to 5.0.3 (thanks to Robert Scheck et al, #143101)
- enable xsl extension (#142174)
- package both the xsl and dom extensions in php-xml
- enable soap extension, shared (php-soap package) (#142901)
- add patches from upstream 5.0 branch:
 * Zend_strtod.c compile fixes
 * correct php_sprintf return value usage- update for db4-4.3 (Robert Scheck, #140167)
- build against mysql-devel
- run tests in %check- truncate changelog at 4.3.1-1
- merge from 4.3.x package:
 - enable mime_magic extension and Require: file (#130276)- fix dom/sqlite enable/without confusion- fix phpize installation for lib64 platforms
- add fix for segfault in variable parsing introduced in 5.0.2- update to 5.0.2 (#127980)
- build against mysqlclient10-devel
- use new RTLD_DEEPBIND to load extension modules
- drop explicit requirement for elfutils-devel
- use AddHandler in default conf.d/php.conf (#135664)
- "fix" round() fudging for recent gcc on x86
- disable sqlite pending audit of warnings and subpackage split- don't build dom extension into 2.0 SAPI- ExclusiveArch: x86 ppc x86_64 for the moment- fix default extension_dir and conf.d/php.conf- update to 5.0.1
- only build shared modules once
- put dom extension in php-dom subpackage again
- move extension modules into %{_libdir}/php/modules
- don't use --with-regex=system, it's ignored for the apache* SAPIs- Merge in some spec file changes from Jeff Stern (jastern@uci.edu)- bump to 5.0.0
- add patch to prevent clobbering struct re_registers from regex.h
- remove domxml references, replaced with dom now built-in
- fix php.ini to refer to php5 not php4hou-2 17768065435.5.38-64.65.14.cpanel5.5.38-64.65.14.cpanellsphp/opt/cpanel/ea-php55/root/usr/bin/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1  -m64 -mtune=genericobs://private/EA4-production/CentOS_7/e38ad767615740854ededd9f4cf2e315-scl-php55cpioxz2x86_64-redhat-linux-gnu��&4�^@��~p�?������i��#x��~�|$��af�[���*!b\�+w0j�+�*�4<%a8�B'�|H�A�k�*���\��no
;�Ӽ���߀�6P���5��w�ƸUT��JN�4H��UN�d�[������M��cT�M�;m��2�Y�"��q����|�;�ϻ+��X���fD�,C��$�&d��V��:.��gl͗�pq��e#���U/��9��N�+�&�%x5�&������
�� �SuQ��m��C��X�7�D�?W*�G#��᠟���蘫]:<����%%�q��՘J��0#�y�*�&l�~�2����2�k�Tl�η��Zy�L�,( �h��
��/��}:�ZBL4_Ghi�ݤ:t�� mu���c���:Pp"����xr��>'9�s���z��j�y�-�L���-
�����҄v��Œ�@�>��s5�.\"T ��sWN{���]gf*���35�4�����yq�s��"��E=�bN�*NOo�4�� ���ټ��Ѽ�-�/�i��#x��~�|D0�LT`�$�`��mi
b0F�A���@ E���j5)�@�����j�O�__吗�z�tךhqW�
���K�v�(	�Mkr+���U�d�%YN*��'��_5Lj=�ר&�߾[;��O�������w���dAms	^�������M|ic��}��"t����ȶ�8���">��j\ۺ_Y�;G��P�E���`�bc�_\j�z��t3�l�3�?�[F��R�ٗ�$I3z\�
Oa��H*�u����B�0��O���p.���8P镂�?�vc���ʜ�w�V��	��3;rF����t�pB3�����&�@�~=6�Q�҄湼.�|5K�}�<8���RՆ`�#YC9�ws�����K��;#KyK%5�n��Z[���O�v�S��p�7>�	U|��S�`�[�SJ��i��%HuEM�\3���hv"Rs(2D�%�5Q�������Ų&�'<���������-�\�s�c319dd7c326052a74030b5ffe439100ab93a741ei�M?�Di�Fa60e63ce6b03b55c9a1237fc506923401b3771a71985489cff7ec5fbf6bdefa8f3e99493bc91d215881c96e32e5e288a08733521da5a2f115c5591796661f36e39565425bc2993249b031f91145aba1380953cd6cc70d4fc90571946bdaa49abbb294a56f13714392f65ec150d164390b7e645add32d942c3aef6a204e30ffb37953df4e3582d52511d4557ea7deb77fbae447c7828dad00c515a6b55220ab44c5b16036dd621c6b1e7b1608c8af081799d8f4040ea29bfe27ef2b3fc0a525688aa90372eb9414b2d3efa9f0a71a0cff3c6990a2803a839e50a0bac56595275772db2628926e56a4aa3ef06130a873f3cef9b6eb9b1dc9a7c5baffe24e8650ea734127ffa2334779d1cf5bf7d9bfb33151edf6cfe117b644b310c2d326a48a842af2a3475fc853c0acb7251de8c107863ad8b6fb786786d54e3a3618d3cf4a71878a5e180ddf3eaae122ffd321c47f2fb704d86e4e1a2e12a21833e9cccca0daae3a1b671b8ba4e7efe94472d05b18fa913ff4271e94adeebca5847698610ed95e17bf99�x�������������������X2#�gJj���������������	)�����a����������������	))
)�BuildID[sha1]=fe3d854b4a49b9075c45941f4434fd1e943e8f51, strippedELF 64-bit LSB executable, x86-64, version 1 (SYSV), dynamically linked (uses shared libs), for GNU/Linux 2.6.32, BuildID[sha1]=e707586a3d0e0c0a97683635a5ab27f281aada4d, strippedELF 64-bit LSB executable, x86-64, version 1 (SYSV), dynamically linked (uses shared libs), for GNU/Linux 2.6.32, BuildID[sha1]=e6cf29a48f8e489673160e1d1f0fe51f2221cb71, strippedELF 64-bit LSB executable, x86-64, version 1 (SYSV), dynamically linked (uses shared libs), for GNU/Linux 2.6.32, BuildID[sha1]=9b816c0138019eae60cada24eb82c576be794411, strippedELF 64-bit LSB executable, x86-64, version 1 (SYSV), dynamically linked (uses shared libs), for GNU/Linux 2.6.32, BuildID[sha1]=440b15c30d60e219d6ec9b1e4b8fd6c067501da3, strippedELF 64-bit LSB executable, x86-64, version 1 (SYSV), dynamically linked (uses shared libs), for GNU/Linux 2.6.32, BuildID[sha1]=68a2fb7f7bbf84cbe4fda506a28dbc9f85b7a74c, strippedELF 64-bit LSB executable, x86-64, version 1 (SYSV), dynamically linked (uses shared libs), for GNU/Linux 2.6.32, BuildID[sha1]=e89650a469a6c613bff670fa0a25721a60348fbd, strippedELF 64-bit LSB executable, x86-64, version 1 (SYSV), dynamically linked (uses shared libs), for GNU/Linux 2.6.32, BuildID[sha1]=65f07391b7ba26da31a3ac502b19461271b922e6, strippedELF 64-bit LSB executable, x86-64, version 1 (SYSV), dynamically linked (uses shared libs), for GNU/Linux 2.6.32, BuildID[sha1]=6b05609a635321d8010ec49050e8dcdf9c9b12b6, strippedELF 64-bit LSB executable, x86-64, version 1 (SYSV), dynamically linked (uses shared libs), for GNU/Linux 2.6.32, BuildID[sha1]=c9195c06dcf9b6c3a4f01826a4ed4b01a03c2065, strippedELF 64-bit LSB executable, x86-64, version 1 (SYSV), dynamically linked (uses shared libs), for GNU/Linux 2.6.32, BuildID[sha1]=5192be36bea9d51ac24991904db7e216a12961fe, strippedELF 64-bit LSB executable, x86-64, version 1 (SYSV), dynamically linked (uses shared libs), for GNU/Linux 2.6.32, BuildID[sha1]=1e6e06c64a6691c17e5386ea6b2ea5ded8155ecf, strippedtroff or preprocessor input, ASCII text, with very long lines (gzip compressed data, from Unix, max compression)troff or preprocessor input, ASCII text (gzip compressed data, from Unix, max compression)/Rt����/@b����"Il���/#")%$""%$"-('#2##R2R>RAR7R5R-R*R.RRRRRRRRR'RR
RRR(RR&R#RRR!RR	R$RRR RR)R/R0RR;R3RR:R1RRRPR>R2R-R*RRRRRR8R5RRRR!R&RR#RR	R$RR R)R/R0RR;R3RR:R1RRRPR>R2R5R-R*RRRRRRRRR!R&RR#RR	R$RR R)R/R0RR;R3RR:R1RRRPR>R2R-R,R*R6R7R5RRRRRRRRRR!RR&RR#RR	R$R%RR R)R/R0RR;R3RR:R1RRRKRPRHR>RAR RRR*RRRR)R/R0RR;R3RR:R1RRRPR>R2R4R5R-R*RRRRRRRRR!R%R&RRR#RR	R$RR R)R/R0RR;R3RR:R1RRRPR>R2R7R5R-R*RRRRRRRRR!R%R&RR#RR	R$RR R)R/R0RR;R3RR:R1RRRPR>R2R5R-R*RRRRRRRRR!R&RR#RR	R$RR R)R/R0RR;R3RR:R1RRRPR*RRRR2R)R/R0RR;R3RR:R1RRRPR*RRRR2R)R/R0RR;R3RR:R1RRRPR>R2R5R-R*RRRRRRRRR!R&RR#RR	R$RR R)R/R0RR;R3RR:R1RRRPR2R>RHRAR5R-R+R*RRRRRRRRR!R&RR#RR	R$RR R)R/R0RR;R3RR:R�x�������������`�����X�#JgJj��������������������������������������
directoryASCII textELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=d4a5fb9030d67e540d08f4a5ded73668041caa55, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=ee557d85ab9d89e6ca9b9af623c09cf6f9ab23db, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=a45e8ac92a153f83922790c002f3221a65dc6b65, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=55688c8ca87f103879738cec52b5304e503200f9, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=6cb10bc8197247acb876c37f38ab6eca0138927c, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=3c62f16f6335155305d1df4be90ade702e5a9e79, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=7a2cec480986a411d86ce6d6915be5dae5ce4a9f, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=779381063daecc27e8480c8f79f0651162586478, strippedUTF-8 Unicode texttroff or preprocessor input, ASCII text (gzip compressed data, from Unix, max compression)
"3AWl�
R"R$RRRR)RR!R#R(RRR.PPPRR$R
R	RRRRR"R!RRR#RRR%RR.PPPRR	R
RRRRR!RRRR%RR.PP
P	R
R	RRRR$R#RR%RR.PP
PRRR"R$R	RRRRRR!RRR#RRR%RR.PPPRR$R	RRRR"R!RRR#RR%R'RR*RR.PPPR&RR$RR RR	RRRRRR
RRR#RR%RR.PPPRR
R	RRRRRRR%R'RRR.?�����ԉ3!�ׅ���s�z����{�P�fg��
	�{�P�f���_��Q������p��竱��B1帋'{(v�`��\/�J���n2�%��9o�*�x��n��[��*T��t���zU��EW�fFS
`���^3��9��2�9B�Z����y�tE{��`� O6��aim�At�;U��]�p(���O��(,�2������GI�����k�_Tu[�+��gWE>H�T�4�}��Y6����X�B�·��V�@�zKY���B�tζvC�z`�$�d��MlGm��]N���,��Μl,�H/��6	�vH^���a�����=��좨ʖ��#�t����Z��{��5�܋)r9-�o��t�5�v�Z�q[�z�,��*	��`7`�"�	�IwS�Ue�A3H�M,x:�Q���.S�9�[×���{D%��C�t��{#���qI`���UA!7�PZ� ��R�>k�̚�M�2������j
fa9w�k�r�m�>u�����^�;s;�6���W&�g�������3!�ׅ���s�z����{�P�fg��
	�{�P�f�m��$�5}���I�d�&j<u15 �C�*���V�d�M]�,����ց�U�k�
��v�9�u/מ��l׭Z���^]�E�+	�����EWn":����y �;;(�Xz�YԪ����?��r���&�Q�|�V޷2���W����=��>k�SG`�k���Fʑ f�~�R�����IL��ep�3��O���פ���Ǻrl�_#��o��)���J~�h�L�J-KX��"Ҷ6i=���s�wWl1�i�1\�_S
l�ɇ��hM��_�#md�Z`��bDW�%����].� ��G�����$n��i�ލ���%�J����)a5���)�V�`���V7�
�R�;��$�a�}�ρ˵춨;#��
.8�+����|>K]u\o�m�5�?l���Cx�]�Ovif��
<��%��@}�b��I
x�% ��E��)���sn��f���W����=k^�.B0�d����\:E��uegF��	V�52565a604f40a29f2a0bf3d0facc2a0a803c3441g���!�xg���7787094472631ca7d33e1c0db011a60c6bce4d285a15f83d9b489ba4415f9b76205a5f9f1ee401818b9717eb904712e4be2aee1f9e312860a4c68c8385e8693580c40dcd34c65f838e656185d7e7351df62fde52eb6eb4d2371c1da86f9507eee3a4666c16c2d4ce5ef76b7b6d11da7987e0fbaf63de385833370b97d2732a3d4e01060a7b0acb84eb4b5900c2f8f0b2b785025153640c84aa924a99da23d1a3de0f1e1826586dc59593c4f42bbdca6633e77e7c8c81bec7f66350819873c5249ffad52603a409bddb71cd0e60648b5a6a05949eda9730ff9bf11fb87d96f71540308f6c82a0a6a1c8983e6a5808a394a4234570ab18520e43ea4162eabcbcf82f838c2e5d8da36e32aa4418c13827a�x�������������ب����X�#rfJj�|x�������`,���������������������`,P
8	�?	dd���&�	2�	l���������	����
� 	$
(0�
�����	�	�	(�8�
9 
:
G�H�I�X�Y�\]$^;b�d	=e	Bf	El	G�	`	t	x
	��	�	�	�g	�h	�Ccpanel-perl-536-strictures2.0000061.cp108~el7CPAN module - Turn on strict and make most warnings fatalCpanel build perl module 'strictures'Turn on strict and make most warnings fatalb���bh-centos-7.dev.cpanel.net<�perlcpanel/perlhttps://metacpan.orglinuxnoarch9��$�$\���T΍O247ae9edf8b4ac740d94681d50351baab91b18b3177dfc018adcd206e7ff790e1a8f0eac126b8863a2e176b18634ab743354784ed59e66795c2f38455449ea36rootrootrootrootcpanel-perl-536-strictures-2.000006-1.cp108~el7.src.rpm��������cpanel-perl(strictures)cpanel-perl(strictures::extra)cpanel-perl-536-strictures-extracpanel-perl-stricturescpanel-perl-strictures-extracpanel-perl-536-strictures




cpanel-perl-536cpanel-perl-536-bareword-filehandlescpanel-perl-536-indirectcpanel-perl-536-multidimensionalrpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(CompressedFileNames)rpmlib(PayloadIsXz)rpmlib(TildeInVersions)4.6.0-14.0-13.0.4-15.2-14.10.0-14.11.1b�@`-@]��@[��@W��@VD@V<�@S>��Q��@Q+R@Busy Camels <bc@cpanel.net> - 2.000006-1.cp108Busy Camels <bc@cpanel.net> - 2.000006-1.cp1198Todd Rinaldo <toddr@cpanel.net> - 2.000006-1.cp1186Todd Rinaldo <toddr@cpan.org> - 2.000005-1.cp1178Todd Rinaldo <toddr@cpan.org> - 2.000003-1.cp1162Todd Rinaldo <toddr@cpan.org> - 2.000002-1.cp1156Todd Rinaldo <toddr@cpan.org> - 2.000001-1.cp1156Todd Rinaldo <toddr@cpanel.net> - 1.005004-1.cp1146Todd Rinaldo <toddr@cpanel.net> - 1.004004-1.cp1136Todd Rinaldo <toddr@cpanel.net> - 1.004001-1.cp1136- Bump to 1.cp108 for re-build- Bump to 1.cp1198 for debian re-build- Update from upstream: strictures 2.000006- Update from upstream: strictures 2.000005- Update from upstream: strictures 2.000003- Update from upstream: strictures 2.000002- Update from upstream: strictures 2.000001- Update from upstream: strictures 1.005004- Update from upstream: strictures 1.004004- Update from upstream: strictures 1.0040012.000006002.00000602.000006-1.cp108~el7strictures.pmextra.pm/usr/local/cpanel/3rdparty/perl/536/cpanel-lib//usr/local/cpanel/3rdparty/perl/536/cpanel-lib/strictures/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches   -m64 -mtune=genericcpioxz2noarch-redhat-linux-gnu?���$�+��[��R�A���oaeefe8610b01bb3b0d32076d30005dde5f97f739c�VC>�c�VAP`K@PY��PY��PY��PXb@PW�PS@P2&�P.2@P	H@O�@O�@O��O��@O�\@O�s@O��@O��@Ov�OtN�OpZ@OpZ@OP�@O?��O-�O�O�@O	�@N��N��N��@N��@N�@NoE�NS�@NL��N7@M���M��M���MT�Mt�Mk�@MfH@MR��M'@M�@M�@Mg�L�8�LΫ�Lʷ@L���LH2�K��@K��@K�C�K�@K
@K��K�@J��@JlE@J_@J_@J\s@JY�@J> �I�'@I��@I��I��@I��@I}��I|T@Iy�@IC��I>]�I:i@I9�I*�@I9@H˫@H�(�H{?�Hv@G��G�Z@Gt�@GV��GV��GV@F��Fڥ�F�@F�S@F�S@F�]�F��Fw�@FiD�FA��F@f@F; @F�@F@Eّ@E�K@E��E�3@Eu_@El$�El$�Ej�@E[@E[@EG:�E#�@D�,@D��@D�b�D�b�D�(@DtJ�Dla�D_2�DX�@D;@C�@C�C�Q@Cˊ�Cǖ@C�
@C��C�f@C�q�C� @C��@C�7@C��@Cs6@CoA�CgX�C(�B�i�B{\@Bwg�Bl�B]	�B]	�B]	�B[�@BZf�BQ,@BM7�BJ��BB��B�B	�@A�@A��A��A�_�A�_�A��x������f������P�����X�#1gJj��������ȼ���������G������������������(GM�7-23Nalin Dahyabhai <nalin@redhat.com> - 1.7-22Nalin Dahyabhai <nalin@redhat.com> - 1.7-21Nalin Dahyabhai <nalin@redhat.com> - 1.7-20Nalin Dahyabhai <nalin@redhat.com> - 1.7-19Nalin Dahyabhai <nalin@redhat.com> - 1.7-18Nalin Dahyabhai <nalin@redhat.com> - 1.7-17Nalin Dahyabhai <nalin@redhat.com> - 1.7-16Dennis Gregorovic <dgregor@redhat.com>Nalin Dahyabhai <nalin@redhat.com> - 1.7-15Nalin Dahyabhai <nalin@redhat.com> - 1.7-14Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> - 1.7-13Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> - 1.7-12Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> - 1.7-11Nalin Dahyabhai <nalin@redhat.com> - 1.7-10Nalin Dahyabhai <nalin@redhat.com> - 1.7-9Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> - 1.7-8Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> - 1.7-7Tomas Mraz <tmraz@redhat.com> - 1.7-6Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.7-5Nalin Dahyabhai <nalin@redhat.com> 1.7-5Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 1.7-4Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 1.7-3Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 1.7-2Nalin Dahyabhai <nalin@redhat.com> 1.7-1Nalin Dahyabhai <nalin@redhat.com> 1.6.3-106Nalin Dahyabhai <nalin@redhat.com> 1.6.3-105Nalin Dahyabhai <nalin@redhat.com> 1.6.3-104Nalin Dahyabhai <nalin@redhat.com> 1.6.3-103Nalin Dahyabhai <nalin@redhat.com> 1.6.3-102Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 1.6.3-101Nalin Dahyabhai <nalin@redhat.com> 1.6.3-100Nalin Dahyabhai <nalin@redhat.com> 1.6.3-19Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.6.3-18Nalin Dahyabhai <nalin@redhat.com> 1.6.3-17Nalin Dahyabhai <nalin@redhat.com>Tom "spot" Callaway <tcallawa@redhat.com> 1.6.3-16Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 1.6.3-15Tom "spot" Callaway <tcallawa@redhat.com> 1.6.3-14Nalin Dahyabhai <nalin@redhat.com> 1.6.3-13Nalin Dahyabhai <nalin@redhat.com> 1.6.3-12Nalin Dahyabhai <nalin@redhat.com> 1.6.3-11Nalin Dahyabhai <nalin@redhat.com> 1.6.3-10Nalin Dahyabhai <nalin@redhat.com> 1.6.3-9Nalin Dahyabhai <nalin@redhat.com> 1.6.3-8Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 1.6.3-7Nalin Dahyabhai <nalin@redhat.com> 1.6.3-6Nalin Dahyabhai <nalin@redhat.com> 1.6.3-5Nalin Dahyabhai <nalin@redhat.com> 1.6.3-4Nalin Dahyabhai <nalin@redhat.com> 1.6.3-3Nalin Dahyabhai <nalin@redhat.com> 1.6.3-2Nalin Dahyabhai <nalin@redhat.com> 1.6.3-1Nalin Dahyabhai <nalin@redhat.com> 1.6.2-10Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 1.6.2-9Nalin Dahyabhai <nalin@redhat.com> 1.6.2-8Nalin Dahyabhai <nalin@redhat.com> 1.6.2-7Nalin Dahyabhai <nalin@redhat.com> 1.6.2-6Nalin Dahyabhai <nalin@redhat.com> 1.6.2-5Nalin Dahyabhai <nalin@redhat.com> 1.6.2-4Nalin Dahyabhai <nalin@redhat.com> 1.6.2-3Nalin Dahyabhai <nalin@redhat.com> 1.6.2-2Nalin Dahyabhai <nalin@redhat.com> 1.6.2-1Nalin Dahyabhai <nalin@redhat.com> 1.6.1-8Nalin Dahyabhai <nalin@redhat.com> 1.6.1-7Nalin Dahyabhai <nalin@redhat.com> 1.6.1-6Nalin Dahyabhai <nalin@redhat.com> 1.6.1-5.1Nalin Dahyabhai <nalin@redhat.com> 1.6.1-5Nalin Dahyabhai <nalin@redhat.com> 1.6.1-4Nalin Dahyabhai <nalin@redhat.com> 1.6.1-3Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 1.6.1-2Nalin Dahyabhai <nalin@redhat.com> 1.6.1-1Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 1.6-6Nalin Dahyabhai <nalin@redhat.com> 1.6-5Nalin Dahyabhai <nalin@redhat.com> 1.6-4Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 1.5-24Nalin Dahyabhai <nalin@redhat.com> 1.6-3Nalin Dahyabhai <nalin@redhat.com�x�������������ȇ����X�#UgJj�!�������\������������������p
��)���*��G�Z�"�~"�����;An�m���g��4_��ph�qD8^��h�yKԼ	U���p�9�Ż�ւ�3۳�����(�A�8��/���U����5��ɺ�\���8� �C"m
���$<?P�C��S�qn��FژVT�6<g�X��D	�pK���C.Ć�{$k��ڀ���V6<s'<<P��(9	��9��>:Յ0lQ��ߪ܀�e�BN���wc,�7��+�ǥ����W��<�n�
�D�ףe���&�Ւ��� ���+��NY���L��;4�p~�A��kl/�xj�Jrs4��ctQ����J+�M�6�φ�r�n����jX��G{4T��|��1O��gQ$���I��I�;��0��=�����⹜S<̦��ܒ���u��p�G�:�@Q�&	�z�vD�ͺ�.��ϫX	9�L�BSM��L���L��Xy���QT��)I�y`�K�>F`8�UR��R
s!�MA�Yq��$ƨ�����*����՞��9��zۘ��D��C���?a��P*����
��X4m�_V��W�sx%���R��k!�.�K<o�h>Zb�aNt��XGc�݀�eU!d!�KW�^���os/ȥ5�O�a�O��:�,��T�5�%��sbբB���2����XM�:�ӎ�Ɵ7.\{���U�F�A�k�DGk@*w�I�7�&ǽL%J��o8
)OSר�ZjRM���)�X<�0΍l/>�G�%缶f�Iwk8��1wn��!���ob�[Y�й�A&G��X��,���Pb�7���mr�w�m���U�8-��Nׂ���I������IR>o�O�x�s�@��g�K]cxABJ��P3׬~d���
�H�)�a�q��g�—�}��E�좠S@�����"���&�$$$�46�k{G�}�y72��āˮ�b�ɘbE�|�%���m֛g�����Vݳ�b��RP���y�=@�+ʝW	199d8759fc830d676956eaedecf5c767d7409f3fbL���$bL�� read data into orig_page for prexor of cached data (Nigel Croxon) [1494474]
- [md] raid5-cache: delete meaningless code (Nigel Croxon) [1494474]
- [md] r5cache: fix spelling mistake on "recoverying" (Nigel Croxon) [1494474]
- [md] r5cache: assign conf->log before r5l_load_log() (Nigel Croxon) [1494474]
- [md] r5cache: simplify handling of sh->log_start in recovery (Nigel Croxon) [1494474]
- [md] raid5-cache: removes unnecessary write-through mode judgments (Nigel Croxon) [1494474]
- [md] raid10: Refactor raid10_make_request (Nigel Croxon) [1494474]
- [md] r5cache: handle FLUSH and FUA (Nigel Croxon) [1494474]
- [md] raid5-cache: use bio chaining (Nigel Croxon) [1494474]- [media] uvcvideo: Support realtek's UVC 1.5 device (Jarod Wilson) [1561502]
- [crypto] chelsio: Remove separate buffer used for DMA map B0 block in CCM (Arjun Vynipadath) [1595086]
- [crypto] chelsio - Send IV as Immediate for cipher algo (Arjun Vynipadath) [1595086]
- [crypto] chelsio: request to HW should wrap (Arjun Vynipadath) [1595086]
- [infiniband] iw_cxgb4: always set iw_cm_id.provider_data (Arjun Vynipadath) [1595085]
- [infiniband] iw_cxgb4: Fix an error handling path in 'c4iw_get_dma_mr()' (Arjun Vynipadath) [1595085]
- [infiniband] iw_cxgb4: Atomically flush per QP HW CQEs (Arjun Vynipadath) [1595085]
- [infiniband] rdma/cxgb4: release hw resources on device removal (Arjun Vynipadath) [1595085]
- [netdrv] bnxt_en: adding PCI ID for SMARTNIC VF support (Jonathan Toppins) [1520611]
- [netdrv] bnxt_en: Add PCIe device ID for bcm58804 (Jonathan Toppins) [1520611]
- [netdrv] bnxt: Add PCIe device IDs for bcm58802/bcm58808 (Jonathan Toppins) [1520611]
- [mm] shm_mnt is as longterm as it gets (Aaron Tomlin) [1597314]
- [block] blk-throttle: check stats_cpu before reading it from sysfs (Ming Lei) [1567748]
- [block] do not use interruptible wait anywhere (Ming Lei) [1580045]
- [md] dm thin: remove merge_bvec hooks (Mike Snitzer) [1595898]
- [md] dm thin: handle running out of data space vs concurrent discard (Mike Snitzer) [1563697]
- [md] dm thin metadata: remove needless work from __commit_transaction (Mike Snitzer) [1563697]
- [kernel] ftrace: Fix compilation warning about control_ops_free (Gustavo Duarte) [1597877]
- [kernel] alarmtimer: Do not signal SIGEV_NONE timers (Oleg Nesterov) [1524333]
- [x86] kvm: svm: Implement pause loop exit logic in SVM (Gary Hook) [1563718]
- [x86] kvm: svm: Add pause filter threshold (Gary Hook) [1563718]
- [x86] kvm: vmx: Bring the common code to header file (Gary Hook) [1563718]
- [x86] kvm: vmx: Remove ple_window_actual_max (Gary Hook) [1563718]
- [x86] kvm: vmx: Fix the module parameters for vmx (Gary Hook) [1563718]
- [s390] qeth: fix IPA command submission race (Hendrik Brueckner) [1594197]
- [s390] qeth: don't dump control cmd twice (Hendrik Brueckner) [1594197]
- [s390] qeth: fix SETIP command handling (Hendrik Brueckner) [1594197]
- [s390] archrandom: Rework arch �x�������������@w����X#�gJj����������������=�����q�����������������=�=�=� (RHBZ#1030330)
- firewall-config: fixed service and icmptype name dulications (RHBZ#1067639)
- allow router advertisements for IPv6 rpfilter (RHBZ#1067652)
- firewall-applet: allow to bind connections to the defaut zone (RHBZ#1068148)- firewall-config creates unloadable config; port forwarding broken
  (RHBZ#1057628)
- Network connection is lost after changing Zones Default Target to DROP
  (RHBZ#1057629)
- permanently adding rich rule with audit creates unloadable config XML
  (RHBZ#1057684)
- firewalld input_zones has default rule for public zone (RHBZ#1058339)
- firewall-cmd is not able to add and remove zones, services and icmptypes
  (RHBZ#1064386)
- firewall-config leaves deleted services shown if they were in use
  (RHBZ#1058853)
- firewall-cmd does not allow user to change zone default target (RHBZ#1058791)
- firewall-cmd man page has a typo in --help description (RHBZ#1064401)- fixed enforcing of trusted, drop and block zones (RHBZ#1054415)- fixed rich rules (RHBZ#1054270)
- fixed small defects in firewall-cmd and firewall-config (RHBZ#1054289)- rebase to 0.3.9 version:
- translation updates
- New IPv6_rpfilter setting to enable source address validation (RHBZ#847707)
- Do not mix original and customized zones in case of target changes,
  apply only used zones
- firewall-cmd: fix --*_lockdown_whitelist_uid to work with uid 0
- Don't show main window maximized. (RHBZ#1046811)
- Use rmmod instead of 'modprobe -r' (RHBZ#1031102)
- Deprecate 'enabled' attribute of 'masquerade' element
- firewall-config: new zone was added twice to the list
- firewalld.dbus(5)
- Enable python shebang fix again
- firewall/client: handle_exceptions: Use loop in decorator
- firewall-offline-cmd: Do not mask firewalld service with disabled option
- firewall-config: richRuleDialogActionRejectType Entry -> ComboBox
- Rich_Rule: fix parsing of reject element (RHBZ#1027373)
- Show combined zones in permanent configuration (RHBZ#1002016)
- firewall-cmd(1): document exit code 2 and colored output (RHBZ#1028507)
- firewall-config: fix RHBZ#1028853- Mass rebuild 2013-12-27- fix memory leaks
- New option --debug-gc
- Python3 compatibility
- Better non-ascii support
- several firewall-config & firewall-applet fixes
- New --remove-rules commands for firewall-cmd and removeRules methods for D-Bus
- Fixed FirewallDirect.get_rules to return proper list
- Fixed LastUpdatedOrderedDict.keys()
- Enable rich rule usage in trusted zone (RHBZ#994144)
- New error codes: INVALID_CONTEXT, INVALID_COMMAND, INVALID_USER and INVALID_UID- Don't fail on missing ip[6]tables/ebtables table. (RHBZ#967376)
- bash-completion: --permanent --direct options
- firewall/core/fw.py: fix checking for iptables & ip6tables (RHBZ#1017087)
- firewall-cmd: use client's exception_handler instead of catching exceptions ourselves
- FirewallClientZoneSettings: fix {add|remove|query}RichRule()
- Extend amanda-client service with 10080/tcp (RHBZ#1016867)
- Simplify Rich_Rule()_lexer() by using functions.splitArgs()
- Fix encoding problems in exception handling (RHBZ#1015941)- firewall-offline-cmd: --forward-port 'toaddr' is optional (RHBZ#1014958)
- firewall-cmd: fix variable name (RHBZ#1015011)- remove superfluous po files from archive- firewalld.richlanguage.xml: correct log levels (RHBZ#993740)
- firewall-config: Make sure that all zone settings are updated properly on firewalld restart
- Rich_Limit: Allow long representation for duration (RHBZ#994103
- firewall-config: Show "Changes applied." after changes (RHBZ#993643)
- Use own connection dialog to change zones for NM connections
- Rename service cluster-suite to high-availability (RHBZ#885257)
- Permanent direct support for firewall-config and firewall-cmd
- Try to avoid file descriptor leaking (RHBZ#951900)
- New functions to split and join args properly (honoring quotes)
- firewall-cmd(1): 2 simple examples
- Better IPv6 NAT checking.
- Ship firewalld.direct(5).- Only use one PK action for configuration (RHBZ#994729)
- firewall-cmd: indicate non-zero exit code with red color
- rich-rule: enab�x��������������f����X�#�gJj`������;<�����S����������������;<��
/bin/sh/bin/sh/bin/sh/bin/shhou-2 1776106516

 !"#$%&'()*+1.4.59-3.3.1.cpanel	



Analytics.pm999-analytics.inc.phpmixpanel_analyticsLICENSEcomposer.jsonmixpanel_analytics.phpmixpanel_analytics_include.jsui-analyticsui-analyticsgather_update_log_statsgather_update_logs_setupcrontabui-analyticssnapshot_plugin.postsnapshot_plugin.precpanel_jupiter_cp_analytics.html.ttcp_analytics_webmail.html.ttmixpanelSetup.jscp_analytics_whm.html.ttslideout.jsGatherer.pmLogReader.pmStd.pmAddonFeatures.pmCertificates.pmCustomizations.pmElevate.pmEmailStats.pmEximMainlog.pmLiveEngine.pmLocales.pmMailman.pmMalwareDetection.pmPanelINI.pmPlugins.pmRepos.pmSpamAssassin.pmVirtualUsers.pmWordPress.pmanalytics.json/usr/local/cpanel/Cpanel/Template/Plugin//usr/local/cpanel/base/3rdparty/roundcube/config/inc.d//usr/local/cpanel/base/3rdparty/roundcube/plugins//usr/local/cpanel/base/3rdparty/roundcube/plugins/mixpanel_analytics//usr/local/cpanel/base/frontend/jupiter/libraries//usr/local/cpanel/base/webmail/jupiter/libraries//usr/local/cpanel/scripts//usr/local/cpanel/whostmgr/docroot/libraries//var/cpanel/analytics/utils//var/cpanel/customizations/content_includes//var/cpanel/customizations/includes//var/cpanel/customizations/ui-analytics//var/cpanel/customizations/whm/includes//var/cpanel/perl/Cpanel/UpdateGatherer//var/cpanel/perl/Cpanel/UpdateGatherer/modules//var/cpanel/snapshot_prep.d/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches   -m64 -mtune=genericobs://private/cpanel-plugins-production/CentOS_7_standard/e509c2ede008584dc8a4896bf6cec558-cpanel-google-analyticscpioxz2noarch-redhat-linux-gnu�j�!v�'<U,YlIU�n?���`T�i�<&#x��~�|���j*@����‰b�&��/�1��ɶ����e��A��E`�$�aB��)	�P�-g�	R�8�$�8�Z�Ƅ���B���ӝ�u�ǘ%�!�;@-X0�X����h��$ʫ��6��~��G�o\���'���z�)V��{UYNu��э���зs���ms�l.&�#�]���(�?&k�BZ��S$Hn�ד�n�i�������/6��d(�x�g�ǃ����>g�`t��
>�r4����,�#	{CC	�c?v�1���Ľ:����C_o�#K�\��a�yjȤ�N��~�^ͫ�k�J�sk�jCrɠ¼�
� Xs�������\t<&L
#�|z�K2�����4��'��$E�������#w��BY�z��[���~l2��Rld��U��_�9�5��0_,x��2���c#u$%3���A��e�|�:���8lw����5�AU
�H�l�'r���$oـ�����'Ր^�ϵ���F�g��n��颹#& Rg��
y��vookB���;��G��i�<&#x��~�|(��}���S_s��D5,�1�(]�$��C�^�!8	H���J���&|��{$����;̛:.����+�=^ ���X�v�VNn�Š���A������"對o�-A���I��4�!l�(�:��
��*�#��(h�[����H����3��?�x�X6��\f�v5�`����ZPcqeP�,�$��w,��4���M���}��L�1�7��F(�F�"��f�Eh�_]=Nw�!�lKP��T�B��~���X�C�Q�rgy�5�о΄<	����i�1/ȧ��B�r4?ޫG�x�}�$�MҜIY�t�ē�ׯd��#���\���J^]
J0���|X���iH��e.�Lj�Z\FĬ�;f��*
�Qa9 -�9��G�oav끺�B}�2b%���Qۜ�{���F_/�3Nl%K$�S��xdp�i0a����*���r���fV�c1:y3T����p�ځ�QS�t&-<SJ�U�r-A��~�b<�;��ԗ��\;k�&ecd3092f3baa9443e0958ccce9823c70abb14fbai��;��i��9otrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootalt-openssl11-1.1.1w-3.1.el7.src.rpm�����������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������x������$������0V����X4#�fJjp�4�����d����������������4
4�F4P?/�d���
�	�	S�������������	���7�=D�H�	�
� 
2

D
�
�@\���
�(
�8
�H9�H:GH>)a?)iG)tH)�I*X*Y* \*@]*�^+b+�d,)e,.f,1l,3t,Lu,�v,�w.�x/y/d�/�/�/�1�1�
4�4,404Dg4Hh4LCbc1.06.9513.el7GNU's bc (a numeric processing language) and dc (a calculator)The bc package includes bc and dc. Bc is an arbitrary precision
numeric processing arithmetic language. Dc is an interactive
arbitrary precision stack based calculator, which can be used as a
text mode calculator.

Install the bc package if you need its number handling capabilities or
if you would like to use its text mode calculator.S�Zworker1.bsys.centos.orgZ�CentOSGPLv2+CentOS BuildSystem <http://bugs.centos.org>Applications/Engineeringhttp://www.gnu.org/software/bc/linuxx86_64if [ -e /usr/share/info/bc.info.gz -a -e /usr/share/info/dc.info.gz ]; then
  /sbin/install-info /usr/share/info/bc.info.gz /usr/share/info/dir \
  --entry="* bc: (bc).                      The GNU calculator language." || :
  /sbin/install-info /usr/share/info/dc.info.gz /usr/share/info/dir \
  --entry="* dc: (dc).                      The GNU RPN calculator." || :
fiif [ $1 = 0 -a -e /usr/share/info/bc.info.gz -a -e /usr/share/info/dc.info.gz ]; then
  /sbin/install-info --delete /usr/share/info/bc.info.gz /usr/share/info/dir \
  --entry="* bc: (bc).                      The GNU calculator language." || :
  /sbin/install-info --delete /usr/share/info/dc.info.gz /usr/share/info/dir \
  --entry="* dc: (dc).                      The GNU RPN calculator." || :
fiE��P�FMg�J�y�7
C
�10�/�x���A큤����A큤��������������������S�ZS�ZS�ZD�>nB�ԤB���D��v9fh�9fh�9fh�9fh�DH$�DH$�9n@S�ZS�ZS�ZS�Z5cce3f14cfe3d0f8a38ddcbaff5ac2209dcdc53c051fb0630fdcd7c3ac262bee24b09752f748d7775f0889e6db3a9474a161a319f3ad6d057f8da549f7b9c528743516881d5e0f02cfb60830b46e04156d2a58ebc3c5fa00a8cb63a4293a6dcd987f3e261f0fcf6eecb7831a3b7c19824c07b59fbafa168fbac7938f9b23704e43c7e548f3c26f855c72e8c8fff8dfa760d03561a9de2152734d92b4d1b9b0a4ddbdfd16d8ab5470b9638528c498d2e06e7f8af9c8996f71b025d622045b127f5d5e1c14d038d925876f34aabe10b643cbc47a3984c225e16b6862c9ed4ad9ad1cf587f63308502c8564cb22ae2a87cebdee8e8aa9102d9b601a3181ace37681ab19243153467903f4d6ba53aa27f64609a6a69743ff379022662525f04c977eaf86afc8c1e85a7128ae1b2663cafda4d545922972a0eb2cddc00e995006de1aaa75832376b573b78af1655c0fbded14d51ad257f84f358d127f1740c970ebb6c4b01fb884c75344cd60b59c05d534cbb42a9af6252894cb4df51bd79b0aca927e807d95737b1975a3c665e5d5fd6fb2f7c825b93249438536a37572d551833d2256c409ffdad48bda5afc40ba9264738ba1c010aae9e913d0713e3b684a278fce6796f36856f1f8d162d375bd21910da2f24a8e839b6d0590ec7c82f39346e253f1a1348ec9d7a279c83fde491ba6f4e3190150eb1ce252ba9ae811c4cb88e2rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootbc-1.06.95-13.el7.src.rpm�����������������������������������x��������������E����XB#zfJj����������;�����c�����������������;�;�;� !"#$%&'()*+afbebgcacsdadeelesetfifrglhrhuidisitltnbnlplptptrorusksrsvtruk0.12-0.37.pre6.el7.0.10.12-0.37.pre6.el7.0.10.12-0.37.pre6.el7.0.11:0.97-11:0.97	

 !"##$$elinks.confelinkslinkselinks-0.12COPYINGREADMESITESTODOelinks.moelinks.moelinks.moelinks.moelinks.moelinks.moelinks.moelinks.moelinks.moelinks.moelinks.moelinks.moelinks.moelinks.moelinks.moelinks.moelinks.moelinks.moelinks.moelinks.moelinks.moelinks.moelinks.moelinks.moelinks.moelinks.moelinks.moelinks.moelinks.moelinks.moelinks.moelinks.1.gzlinks.1.gzelinks.conf.5.gzelinkskeys.5.gz/etc//usr/bin//usr/share/doc//usr/share/doc/elinks-0.12//usr/share/locale/af/LC_MESSAGES//usr/share/locale/be/LC_MESSAGES//usr/share/locale/bg/LC_MESSAGES//usr/share/locale/ca/LC_MESSAGES//usr/share/locale/cs/LC_MESSAGES//usr/share/locale/da/LC_MESSAGES//usr/share/locale/de/LC_MESSAGES//usr/share/locale/el/LC_MESSAGES//usr/share/locale/es/LC_MESSAGES//usr/share/locale/et/LC_MESSAGES//usr/share/locale/fi/LC_MESSAGES//usr/share/locale/fr/LC_MESSAGES//usr/share/locale/gl/LC_MESSAGES//usr/share/locale/hr/LC_MESSAGES//usr/share/locale/hu/LC_MESSAGES//usr/share/locale/id/LC_MESSAGES//usr/share/locale/is/LC_MESSAGES//usr/share/locale/it/LC_MESSAGES//usr/share/locale/lt/LC_MESSAGES//usr/share/locale/nb/LC_MESSAGES//usr/share/locale/nl/LC_MESSAGES//usr/share/locale/pl/LC_MESSAGES//usr/share/locale/pt/LC_MESSAGES//usr/share/locale/pt_BR/LC_MESSAGES//usr/share/locale/ro/LC_MESSAGES//usr/share/locale/ru/LC_MESSAGES//usr/share/locale/sk/LC_MESSAGES//usr/share/locale/sr/LC_MESSAGES//usr/share/locale/sv/LC_MESSAGES//usr/share/locale/tr/LC_MESSAGES//usr/share/locale/uk/LC_MESSAGES//usr/share/man/man1//usr/share/man/man5/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches   -m64 -mtune=genericcpioxz2x86_64-redhat-linux-gnuASCII textELF 64-bit LSB executable, x86-64, version 1 (SYSV), dynamically linked (uses shared libs), for GNU/Linux 2.6.32, BuildID[sha1]=53819a0526e593cfe5561e0fb89203acacb05e98, strippedemptydirectoryUTF-8 Unicode texttroff or preprocessor input, ASCII text, with very long lines (gzip compressed data, from Unix, max compression)empty (gzip compressed data, from Unix, max compression)troff or preprocessor input, ASCII text (gzip compressed data, from Unix, max compression) RRR$RRRRRR
RRRRRRRRR'R	RRRR&R%RR R"R!RR#R
R+?����
��\7|�$ƨ����������-}����թ �Ĵ|�8�H��&��e��?�X�
�_&��e�5��ɛ���$}�4�7��S!ʏ[�ܿ~}m]��ҋ&��1=�CLx'��ק7P��
I��ˊ����Lz�E�	&�	�v�{��q1�FJ?�g�����9DDc�4q@H�8h)�n���u1Z�R��(��>
3%�cxm�.��-N�
a�u��zQbB#���v[��V|�\b@g��8W�r��3�\�[��j�\��k
�s
C�<Ή�|��&԰2_�播�Snl�(���]�^��i��(�.B,�@.^�	�-(,
e���u�@�ؾ�5�QKe�0����6pխ����c��Ѓ�f	_I���)r�w�
�N`���:!� ���#�Wp�.Vd�tQ�VĨ�������Gh\2�����#�J�$n�dzc[B�s�
�R
�'�_B��� Qz��[\�Ft7uڰ0#+:�PS�x���x������������� 5����X�#	gJj������������h������t�����������������ab75ced50fa4a5ff18445a3b3defd51471c306c55aff91a4d9c134dbe959cb30282ecf445e42442aced24470a7bcb16c2051aa04a787adfd8ed2913a35a0103384b502ad9dc9d218906e15aa562f0662d44a452d9b4b4e3e2bfd6d014ac026027aaa07b6cbddb99497b842b345f36c9b9fb2948c08de1865271c36227497c3e45f42995a8845f0cbbaf1991efacafc3bed00d9bd1433779e52c579fe9f9620942884b7a59cb6b994aca0719b07724b6d54c399679adc0799d0526fe595d3349d9bea009dabe2fab50fec33637ba5692c769ef9a004808cd0ea989018d0d92ed7464aa68976947ffd4152a0415de475a5ff25096368f2268dd958f665828cfb7276f51d5c65e6a1f81ea1b8c63bb262e557c0f362d438ade767695049359c210f2c1db9a54875a36ed211e0fce8d4c1a5f607c0e371cae3d10ac945b549c5789d13d8434259ef7472b405d74b89f1484e5e8fd70b74acd5c0193bec06eb1f9c615ce4dbb22a5f761d1480afdab62419130d2d4f127aed214d3a4fd330183f124928c64c00c00c4f2f694cd69eacc417a19c6b01f47a3d88cf2a8fcff345c6a80a49cbd65d25e2d0769de848309eafa1e4600bec0c955cc7ccb13d7df82a073b218eb1385bd3650b112838331a828e142c17591c1371dc8304b9f487bd2094e3737580aeb075a1484aef61e7a114b69d10a825ed5ff3d3cc5c81890570c25fc729e07cd1984a43c63b7a52aa3b486dd08786f506a361b16c5f5bde2a562d165839e640655159ca7966b89b0577cd563b0a4d565221060847979e8ba0c0c3a28a864c996c4c78e9d94818e8785d43cf9d4b9e66dc1ce76b53d3de4f74a65ae65dfae460b42d5bd4e87c306fe36a213cb8bba58c2b15543248cd0b030ed81da3a83092d2dcb392e67d57c5b0220cde4bd4b0d1d9b3bed3fb3f148d2dd018e12c05631a1a181ad5ce17a669649557b85f45f2ee391e5f2ee63db83b0015e68ac33ea75618a799d1d925713669d2cd6884de514f4ee64319c2077b7213a41e3e5c9b30a920601f285300a4dc1b45154afb24991a58343a6bb0c60e549368c01864c0b179efae142d36021a65dbe26834fca2530fdf0a94c69df8612e2275d3dff005d9d8636ef56e9ffee45a204f25ed741ae9e60dd7afb0a41b77cba58c29f4a0662342a9578e9db01f1cb2bcee00f054c2b830068cee137a7c8898cc514c8e8ece1367f6e27472f6b5e66dab45b50dd7003cb5d586b394d46295434aeb4eaf53ef215c30218e2c757fc538f5d7878a90bd5a0f5f14ef756bbb875805b83a7008a54b17085ec62c27ccb1783d017e297f6f8d8a2ca551a2586ae53412648fb99442a30e841f3eaf1e8f9d6a1724408aa8a8b6d52cf3da17f4f146ebb38bed7af05a1335f39cc56f7d256e8d94718c730c6ba622d662cb10d5ae3fb51a93cb72ce2e09b816d7e15ba582c942dab5b0140e2f861d41f340a9b16c5e0b19b069997d304ed19f74b639d73dcc995069a887b148cca8293c6ce872200de536f164cda044b36ab82052e30746827a94beeaafbca4060b51425e713338d725c01596210b7c4b4d491fc8afe21d7c2cd932b48eac42053827e1cf3e93456c650a227a35e5bf0470e167ee77e729732c521b09aab671fa01ec4776e84ae9d690d04d41afc301a56f6f81eb39c2699834ce86ae005d190995d9217a013bcd23e18b49ba916b9347ac0178380fc19ec7810dc512e2f2c2e6b9dd2f6afa695b54755a6a930abfa372764e298fd26f5bba73251e47378548db86b0068bae84dae5b5734a7e5573f7cfc4377ba734316f35da0c37518c249d31b0e66a87d4e873d48862a6ef93a8b784d78eaef1ba8a5124a50c43a4bfde3f4f3a1a82c129f732b39cd30ff7f937c289a0489f4d20a2e33a59e3e4e916576d761f6378be140878ac294a5f5bb15a5159267769bf708339f72d17ed65cea122d81fb774610e1f8c318e9cc4d22ff18acc794eb418d263c360a0393de8fb06eb28ec6bda372470058fe834d06aae06aeealibpcre.so.1.2.0libpcre16.so.0.2.0libpcre32.so.0.0.0libpcrecpp.so.0.0.0libpcreposix.so.0.0.1pcre_assign_jit_stack.3.gzpcre_compile.3.gzpcre_compile2.3.gzpcre_config.3.gzpcre_copy_named_substring.3.gzpcre_copy_substring.3.gzpcre_dfa_exec.3.gzpcre_exec.3.gzpcre_free_study.3.gzpcre_free_substring.3.gzpcre_free_substring_list.3.gzpcre_fullinfo.3.gzpcre_get_named_substring.3.gzpcre_get_stringnumber.3.gzpcre_get_stringtable_entries.3.gzpcre_get_substring.3.gzpcre_get_substring_list.3.gzpcre_jit_exec.3.gzpcre_jit_stack_alloc.3.gzpcre_jit_stack_free.3.gzpcre_maketables.3.gzpcre_pattern_to_host_byte_order.3.gzpcre_refcount.3.gzpcre_study.3.gzpcre_utf16_to_host_byte_order.3.gzpcre_version.3.gzpcre_assign_jit_stack.3.gzpcre_compile.3.gzpcre_compile2.3.gzpcre_config.3.gzpcre_copy_named_substring.3.gzpcre_copy_substring.3.gzpcre_dfa_exec.3.gzpcre_exec.3.gzpcre_free_study.3.gzpcre_free_substring.3.gzpcre_free_substring_list.3.gzpcre_fullinfo.3.gzpcre_get_named_substring.3.gzpcre�x��������������$����X0#�gJjȮpD����L�����r�����������������L
8�? d��"�+�	7�	^���������	��������	
I
LPUZ���
 

(U8\9l:1G�H�I�X�Y�\] ^+bcd�e�fl�04
D�ptxg|h�Ccpanel-perl-536-package-variant1.0030021.cp108~el7CPAN module - Parameterizable packagesCpanel build perl module 'Package::Variant'Parameterizable packagesb��"bh-centos-7.dev.cpanel.net9�perlcpanel/perlhttps://metacpan.orglinuxnoarch9́$U�ţ4343f1237ce4cad0e6c4b7813254bf831eede5ccc46b6746c74342da0acdc6f5rootrootcpanel-perl-536-package-variant-1.003002-1.cp108~el7.src.rpm����cpanel-perl(Package::Variant)cpanel-perl-package-variantcpanel-perl-536-package-variant




cpanel-perl-536cpanel-perl-536-carpcpanel-perl-536-import-intocpanel-perl-536-module-runtimecpanel-perl-536-stricturesrpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(CompressedFileNames)rpmlib(PayloadIsXz)rpmlib(TildeInVersions)1.0000000.0132.0000004.6.0-14.0-13.0.4-15.2-14.10.0-14.11.1b�@`-@V<�@S>��Busy Camels <bc@cpanel.net> - 1.003002-1.cp108Busy Camels <bc@cpanel.net> - 1.003002-1.cp1198Todd Rinaldo <toddr@cpan.org> - 1.003002-1.cp1156Todd Rinaldo <toddr@cpanel.net> - 1.002000-1.cp1146- Bump to 1.cp108 for re-build- Bump to 1.cp1198 for debian re-build- Update from upstream: Package-Variant 1.003002- Update from upstream: Package-Variant 1.0020001.0030021.0030021.003002-1.cp108~el7Variant.pm/usr/local/cpanel/3rdparty/perl/536/cpanel-lib/Package/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches   -m64 -mtune=genericcpioxz2noarch-redhat-linux-gnu?���衂uL8��%[i��d���1a83b11b511c20cbe359312a15d4264e9311461ec�VC:�c�VA via update_pkg.pl (EA-5252)- Force users on jailshell and noshell to be chrooted when using php-fpm- Changed php-fpm.d directory to 0710 (EA-5097)- Updated to version 5.6.25 via update_pkg.pl (EA-5081)- Update PHP 5.6 to release 5.6.24 (EA-4815)- Disallow php-fpm from loading .user.ini files outside the user's homedirectory- Updated to version 5.6.23 via update_pkg.pl (EA-4734)- EA-4383: Update Release value to OBS-proof versioning- Removed unused global wsdl and session cache directories (EA-4690)- Added EasyApache 3 backwards compatibility php.ini patch (EA-4665)- Enabled PHP-Litespeed package- Updated to version 5.6.22 via update_pkg.pl (EA-4637)- Updated to version 5.6.21 via update_pkg.pl (EA-4479)- Now uses bundled gd (ZC-1564)
- Updated descriptions to use scl_prefix macros (like php7)- Updated to version 5.6.20 via update_pkg.pl (EA-4416)- Updated to version 5.6.19 via update_pkg.pl (EA-4234)- mod_php adjusted to conflict with other mod_php versions, and
  not itself.  this lets the user reinstall the package without
  conflict. (ZC-1459)- Added imap extension for all CentOS versions.  It now depends on
  our internal SCL libc-client package.- Updated to version 5.6.18 via update_pkg.pl (EA-4151)- Improve DSO conflicts (EA-3751)- Updated to version 5.6.17 via update_pkg.pl (EA-4051)- mod_php requires a non-threaded Apache mpm (EA-3982)- Enabled short_open_tags (ZC-1283)- Disable ZTS Support (EA-3790)- make ea-php5x-php-fpm depend on ea-php5X�x�����������������X�#�eJj������������`
������5q�����]����������������5q>6q� only systemd units with systemd
- add trigger for restart on glibc, libselinux or pam upgrades (#699189)- new release 1.4.7- Rebuilt for https://fedoraproject.org/wiki/Fedora_15_Mass_Rebuild- enable crond even with systemctl- 663193 rewritten selinux support- apply selinux patch from dwalsh- do not lock jobs that fall out of allowed range - 661966- fix post (thanks plautrba for review)- systemd init script 617320- fix typos in man pages- update to 1.4.6- 623908 fix fd leak in anacron, which caused denail of prelink
  and others- remove sendmail from requirements. If it's not installed, it will
 log into (r)syslog.- update to new release- update to new release- 564894 FTBFS DSOLinking- 533189 pam needs add a line and selinux needs defined one function- 531963 and 532482 creating noanacron package- 529632 service crond stop returns appropriate value- new release- rebuilt with new audit- create the anacron timestamps in correct post script- update to 1.4.1
- create and own /var/spool/anacron/cron.{daily,weekly,monthly} to
 remove false warning about non existent files
- Resolves: 517398- 515762 move anacron provides and obsoletes to the anacron subpackage- Rebuilt for https://fedoraproject.org/wiki/Fedora_12_Mass_Rebuild- merge cronie and anacron in new release of cronie
- obsolete/provide anacron in spec- 506560 check return value of access- new release- 496973 close file descriptors after exec- rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_11_Mass_Rebuild- 477100 NO_FOLLOW was removed, reload after change in symlinked
  crontab is needed, man updated.- update init script- add sendmail file into requirement, cause it's needed some MTA- 462252  /etc/sysconfig/crond does not need to be executable- update to 1.2- fix setting keycreate context
- unify logging a bit
- cleanup some warnings and fix a typo in TZ code
- 450993 improve and fix inotify support- 49864 upgrade/update problem. Syntax error in spec.- release 1.1- 446360 check for lock didn't call chkconfig- upgrade from less than cronie-1.0-4 didn't add chkconfig- 431366 after reboot wasn't cron in chkconfig- 431366 trigger part => after update from vixie-cron on cronie will
	be daemon running.- change the provides on higher version than obsoletes- packaging cronie
- thank's for help with packaging to my reviewers/bin/shanacron	2.41.4.11-25.el7_91.4.11-25.el7_91.4.11-25.el7_9
2.3anacrontab0anacronanacronanacrontab.5.gzanacron.8.gzanacroncron.dailycron.monthlycron.weekly/etc//etc/cron.hourly//usr/sbin//usr/share/man/man5//usr/share/man/man8//var/spool//var/spool/anacron/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches   -m64 -mtune=genericcpioxz2x86_64-redhat-linux-gnuASCII textPOSIX shell script, ASCII text executableELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked (uses shared libs), for GNU/Linux 2.6.32, BuildID[sha1]=0a60faed71915ecd2f5d5e168bcb0504a8f5f642, strippedtroff or preprocessor input, UTF-8 Unicode text (gzip compressed data, from Unix, max compression)troff or preprocessor input, Non-ISO extended-ASCII text (gzip compressed data, from Unix, max compression)directoryempty
RR
RR	RRR
RRRR?���0���dd�:$ƨ����3�jLJA���
4���c>*������[35�}�(Lr��N���!�1-�����k��J�i��N �z�ަ�E��7��kXݱ�.�u��ƃ�� K�i0��A!�P���'P�j
i"j9Z�a�lo=v�yV�oL
�ڼӹk�O���Ysu�C
��[��?8�\-�+����Y*1��>�ɍ:��U)bA�~[[�	�GGc�{�35�
�j�
��F�C����6]C��:=�wB�F�1�w;��܇/�C*/!�ER�G�^Fx��"�0z����0��dw�K�<�,�ښ�,5cG�
�JAT
�=��*E�EJ�,5�ټ�0ƫ���B�
�h�,! ��)v_<�J�CU����-�L�񦐈x������������������X�#ZfJj����0c��������������������������������otrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootnewt-0.52.15-4.el7.src.rpm����������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������libnewt.so.0.52()(64bit)libnewt.so.0.52(NEWT_0.52)(64bit)libnewt.so.0.52(NEWT_0.52.11)(64bit)libnewt.so.0.52(NEWT_0.52.13)(64bit)libnewt.so.0.52(NEWT_0.52.6)(64bit)libnewt.so.0.52(NEWT_0.52.9)(64bit)newtnewt(x86-64)snack@@@@@@@@@@@@@


@
/sbin/ldconfig/sbin/ldconfiglibc.so.6()(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.15)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.3)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libnewt.so.0.52()(64bit)libnewt.so.0.52(NEWT_0.52)(64bit)libpopt.so.0()(64bit)libpopt.so.0(LIBPOPT_0)(64bit)libslang.so.2()(64bit)libslang.so.2(SLANG2)(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rtld(GNU_HASH)rpmlib(PayloadIsXz)3.0.4-14.6.0-14.0-15.2-14.11.1R�U�R�k�Q^��QP<@Q�P	H@O�N�@Np�MQ0@Lډ@L[�@LF�@KE�J�_@Jj�I�2�I1.�H�W�G�@G��G�,@FҼ�F�%@F��@Fr@F@F�@E��E���E��@Ex@E/�E�D�6�D��@D��D�@D}�@C�@C�C��@C��@C��@Cˊ�C�q�C��@C�@C=(�C1K@C>�B*�A�_�Ao��Anj@@��@Dw@@,�@?�7�?B@?B@>@��>?�@>@=��=��=[��= D@=��=	�=�@<��;�B�;��@;���;q)�;DV�;DV�;DV�;7'�; �@; �@;@;@:ɻ@:�i�:�i�:�u@:�~�:yO�:l �::�9��9�k@9�v�9��@9�^�9c#@9J�9	}@8��@8�n�8��8�V�8�m�8�y@8���8���8�@8^@8
��7�@7��7�}�7��7�7�7��@7��7�|�7��@7
�7
�6�@6��@6�;@6��6��@6�s�6���6-�5ھ@5I�@5Hg�4�*@4��@4�K�4;u�4:$@3���3�@3.��3�@Daniel Mach <dmach@redhat.com> - 0.52.15-4Daniel Mach <dmach@redhat.com> - 0.52.15-3Miroslav Lichvar <mlichvar@redhat.com> - 0.52.15-2Miroslav Lichvar <mlichvar@redhat.com> - 0.52.15-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 0.52.14-4Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 0.52.14-3Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 0.52.14-2Miroslav Lichvar <mlichvar@redhat.com> - 0.52.14-1Miroslav Lichvar <mlichvar@redhat.com> - 0.52.13-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 0.52.12-3Miroslav Lichvar <mlichvar@redhat.com> - 0.52.12-2Miroslav Lichvar <mlichvar@redhat.com> - 0.52.12-1David Malcolm <dmalcolm@redhat.com> - 0.52.11-3Hans de Goede <hdegoede@redhat.com> - 0.52.11-2Miroslav Lichvar <mlichvar@redhat.com> - 0.52.11-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 0.52.10-4Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 0.52.10-3Ignacio Vazquez-Abrams <ivazqueznet+rpm@gmail.com> - 0.52.10-2Miroslav Lichvar <mlichvar@redhat.com> - 0.52.10-1Miroslav Lichvar <mlichvar@redhat.com> - 0.52.9-1Fedora Release Engineering <rel-eng@fedoraproject.org> - 0.52.8-2Miroslav Lichvar <mlichvar@redhat.com> - 0.52.8-1Miroslav Lichvar <mlichvar@redhat.com> - 0.52.7-4Miroslav Lichvar <mlichvar@redhat.com> - 0.52.7-3Miroslav Lichvar <mlichvar@redhat.com> - 0.52.7-2Miroslav Lichvar <mlichvar@redhat.com> - 0.52.7-1Miroslav Lichvar <mlichvar@redhat.com> - 0.52.6-3Miroslav Lichvar <mlichvar@�x������������������X
#�gJj����hf������0���G������/����������������G�F�D�|6gU�o4�Z���A�ñ�ً�K�R����!��Q�O��n3[�C�3����/��ʜ#(5pv��[����uZx}N�?^O`�p�V�Ҧ�ɕ?ZV�D��q�v�w3�����x�6]��7Ł@��ro��_K�bܪ��~�m�Kg��Qq��f�2#(��g�Ȭ؞�L���	^Ҡ彸�w�6c1a0171412a914ed0f3f2ab9553998945545d27f�+L��f�+Kme UAS devices if streams are unavailable (Don Zickus) [1110939]
- [usb] xhci: Kill streams URBs when the host dies (Don Zickus) [1110939]
- [usb] xhci: Refactor command watchdog and fix split string (Don Zickus) [1110939]
- [usb] uas: Remove comment about registering a uas scsi controller for each usb bus (Don Zickus) [1110939]
- [usb] uas: Add Hans de Goede as uas maintainer (Don Zickus) [1110939]
- [usb] uas: remove BROKEN (Don Zickus) [1110939]
- [usb] uas: Make sure sg elements are properly aligned (Don Zickus) [1110939]
- [usb] uas: Add some data in/out ready iu sanity checks (Don Zickus) [1110939]
- [usb] uas: Improve error reporting (Don Zickus) [1110939]
- [usb] uas: Use the right error codes for different kinds of errors (Don Zickus) [1110939]
- [usb] uas: Clear cmdinfo on command queue-ing (Don Zickus) [1110939]
- [usb] uas: Fix memory management (Don Zickus) [1110939]
- [usb] uas: Fix command / task mgmt submission racing with disconnect (Don Zickus) [1110939]
- [usb] uas: cmdinfo - use only one list head (Don Zickus) [1110939]
- [usb] uas: add uas_mark_cmd_dead helper function (Don Zickus) [1110939]
- [usb] uas: Properly complete inflight commands on bus-reset or disconnect (Don Zickus) [1110939]
- [usb] uas: uas_alloc_data_urb - Remove unnecessary use_streams check (Don Zickus) [1110939]
- [usb] uas: Fix task-management not working when connected over USB-2 (Don Zickus) [1110939]
- [usb] uas: Reset device on reboot (Don Zickus) [1110939]
- [usb] uas: Add suspend/resume support (Don Zickus) [1110939]
- [usb] uas: Use GFP_NOIO rather then GFP_ATOMIC where possible (Don Zickus) [1110939]
- [usb] uas: Don't allow more then one task to run at the same time (Don Zickus) [1110939]
- [usb] uas: task_mgmt - Kill the sense-urb if we fail to submit the cmd urb (Don Zickus) [1110939]
- [usb] uas: Not being able to alloc streams when connected through usb-3 is an error (Don Zickus) [1110939]
- [usb] uas: Verify endpoint descriptors from uas_use_uas_driver() (Don Zickus) [1110939]
- [usb] uas: Drop fixed endpoint config handling (Don Zickus) [1110939]
- [usb] uas: Move uas_find_endpoints to uas-detect.h (Don Zickus) [1110939]
- [usb] uas: Fix bounds check in uas_find_endpoints (Don Zickus) [1110939]
- [usb] uas: Add uas_find_endpoints() helper function (Don Zickus) [1110939]
- [usb] uas: Honor no-uas quirk set in usb-storage's quirks module parameter (Don Zickus) [1110939]
- [usb] storage: Modify and export adjust_quirks so that it can be used by uas (Don Zickus) [1110939]
- [usb] storage: Don't bind to uas devices if the uas driver is enabled (Don Zickus) [1110939]
- [usb] uas: Add the posibilty to blacklist uas devices from using the uas driver (Don Zickus) [1110939]
- [usb] Reset USB-3 devices on USB-3 link bounce (Don Zickus) [1110939]
- [usb] Clear host_endpoint->streams when implicitly freeing streams (Don Zickus) [1110939]
- [usb] xhci: Handle MaxPSASize == 0 (Don Zickus) [1110939]
- [usb] xhci: The trb_address_map radix tree expects 1KB segment memory aligment (Don Zickus) [1110939]
- [usb] xhci: xhci_mem_cleanup - make sure cmd_ring_reserved_trbs really is 0 (Don Zickus) [1110939]
- [usb] uas: Move uas detect code to uas-detect.h (Don Zickus) [1110939]
- [usb] uas: Add a uas_find_uas_alt_setting helper function (Don Zickus) [1110939]
- [usb] uas: Use all available stream ids (Don Zickus) [1110939]
- [usb] uas: Pack iu struct definitions (Don Zickus) [1110939]
- [usb] uas: Fix response iu struct definition (Don Zickus) [1110939]
- [usb] uas: s/response_ui/response_iu/ (Don Zickus) [1110939]
- [usb] uas: Fix reset handling for externally triggered reset (Don Zickus) [1110939]
- [usb] uas: Fix reset locking (Don Zickus) [1110939]
- [usb] uas: Fix uas not working when plugged into an ehci port (Don Zickus) [1110939]
- [�x�������������x�����X�#�gJj��������������������>����������������������>�>�G,p?'�d��	��	�	G����������	;�X������	�
���
�4<��f���(�8�P9�P:>P>%�@%�G%�H%�I%�X%�Y%�\&]&^&0b&<d&�e&�f&�l&�t&�u'v'w'�x'�y'��'�'�'�**
,0�,\,`,dg,hh,lClibacl2.2.5115.el7Dynamic library for access control list supportThis package contains the libacl.so dynamic library which contains
the POSIX 1003.1e draft standard 17 functions for manipulating access
control lists.^��qx86-02.bsys.centos.org��CentOSLGPLv2+CentOS BuildSystem <http://bugs.centos.org>System Environment/Librarieshttps://savannah.nongnu.org/projects/acllinuxx86_64�ȡ���^��l^��me4e61e1321e5d76e9dd77fff84ef0a3f5dc186db4eeca7b730b62b6b5dbb5fealibacl.so.1.1.0rootrootrootrootacl-2.2.51-15.el7.src.rpm��������libacllibacl(x86-64)libacl.so.1()(64bit)libacl.so.1(ACL_1.0)(64bit)libacl.so.1(ACL_1.1)(64bit)libacl.so.1(ACL_1.2)(64bit)@@@@@@@


@
/sbin/ldconfig/sbin/ldconfig/sbin/ldconfig/sbin/ldconfiglibattr.so.1()(64bit)libattr.so.1(ATTR_1.0)(64bit)libc.so.6()(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rtld(GNU_HASH)rpmlib(PayloadIsXz)3.0.4-14.6.0-14.0-15.2-1filesystem34.11.3]Ik�Y��W=��R�R�k�Rs��Q�@P<��P�@O�!�O�O�O�@M��M�@M�y@M�U�M��MO�L5��K���K���K���KU��KC)�K5��K.�Ji�@I���H��@H{?�G��@G��G1��G(n@F�`�F��Fֱ@F�_�F�_�FҼ�F���F�;@F@E��@E݅�D��@D���D���C�@C�C�E�C�q�C�}@C�}@Cm�@C:��C:��B	�@AI�@AA�@AA�@A$�@A$�@A�@��@j��@ia@@Dw@@,�@?/�@>܍�>��@>6p�>�=�'�=�'�=0@=R]@=	�Kamil Dudka <kdudka@redhat.com> 2.2.51-15Kamil Dudka <dkdudka@redhat.com> - 2.2.51-14Kamil Dudka <dkdudka@redhat.com> - 2.2.51-13Daniel Mach <dmach@redhat.com> - 2.2.51-12Daniel Mach <dmach@redhat.com> - 2.2.51-11Kamil Dudka <kdudka@redhat.com> 2.2.51-10Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2.2.51-9Kamil Dudka <kdudka@redhat.com> 2.2.51-8Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2.2.51-7Kamil Dudka <kdudka@redhat.com> 2.2.51-6Harald Hoyer <harald@redhat.com> 2.2.51-5Harald Hoyer <harald@redhat.com> 2.2.51-4Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2.2.51-3Kamil Dudka <kdudka@redhat.com> 2.2.51-2Kamil Dudka <kdudka@redhat.com> 2.2.51-1Kamil Dudka <kdudka@redhat.com> 2.2.50-1Kamil Dudka <kdudka@redhat.com> 2.2.49-11Kamil Dudka <kdudka@redhat.com> 2.2.49-10Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2.2.49-9Kamil Dudka <kdudka@redhat.com> 2.2.49-8Kamil Dudka <kdudka@redhat.com> 2.2.49-7Kamil Dudka <kdudka@redhat.com> 2.2.49-6Kamil Dudka <kdudka@redhat.com> 2.2.49-5Kamil Dudka <kdudka@redhat.com> 2.2.49-4Kamil Dudka <kdudka@redhat.com> 2.2.49-3Kamil Dudka <kdudka@redhat.com> 2.2.49-2Kamil Dudka <kdudka@redhat.com> 2.2.49-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2.2.47-5Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2.2.47-4Jiri Moskovcak <jmosk�x�������������������X�#�gJj�����������8����<�����T����������������<;�pytest_internals.pytest_memleak.pytest_multi.pytest_multi2.pytest_multi3.pytest_multi4.pytest_multi5.pytest_multi6.pytest_multi_socket.pytest_multi_socket_select.pytest_multi_timer.pytest_multi_vs_thread.pytest_post.pytest_post2.pytest_post3.pytest_reset.pytest_share.pytest_socketopen.pytest_stringio.pytest_write_abort.pytest_xmlrpc.pyutil.pyutil.pyc/usr/lib64/python2.7/site-packages//usr/lib64/python2.7/site-packages/curl//usr/share/doc//usr/share/doc/python-pycurl-7.19.0//usr/share/doc/python-pycurl-7.19.0/doc//usr/share/doc/python-pycurl-7.19.0/examples//usr/share/doc/python-pycurl-7.19.0/tests/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches   -m64 -mtune=genericcpioxz2x86_64-redhat-linux-gnudirectoryPython script, ASCII text executablepython 2.7 byte-compiledASCII textELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=83a5c79b8685bbb074d2ba04a8884a794c6e98c7, strippedPascal source, ASCII textXHTML document text (version 1.0), ASCII text
R
R
R
RRRRRR	RRRR
?����<t�X2�$ƨ���vt�$���	��N���O<��5f,QQ���T���)��1M�y0������
0F�4��_*��n�!��C&��b���eQ�g�=W?;
�*<�ˬzƊ�6�|�A|���I��3�FY��I渳���\Z[�VH���G��4���s��
���B>g��9���f9�z���ޟ�֢��u�b0�/^<�X���^�Y��X3A�U2�Ԏ�(H�$H��g���?��������r^�I�R�}؆Z��|�`���t���`�M0���W&�w�;
�L��JH7�BRXx���!�"껤�'0�m���x��p�a
i�a�D���IBW��"r��Z�F��y��`���4' !�E�GO_{Rr3t��;���wu��0��W';l~�C0ӵk�솧���.m����#+�0}�o
1&��wCw�oS��Smf��Q4uҍ�Ƭj�^�@\��q��
w<��jF�X���4�h�W��[on��#՛�����N�X2�$ƨ���|Y�	wZ�/:�WE]�51��e$����$o�(�B��LUj�-fP�V�,�*s�:^Ҟ[ O�ER����x\,ebLX�sJ|d�o�~y�nR�H��|��~�r7�i$��h�W��6��2��T�k��	&G�1�N�Q,R�":l���<G`�#0�߮Q�V�!����^�ƹ��:�2��	�_E�8	1��5\��*�����lt�_�!����q�up�.f��1f�G��
	"(p�
�"��X̟���ܛ��N��^�k��/����D�<�Ւ��rE#~)�pOW��	�y1�����֡r�
`��q6�kς�U+�A��K,�X�����$(�4N�I��3S����1��r~: `@dՍ��Ԙ*����-׫��\`�]wY��vTM�b�X{�9��~�ٚռ6.#O��r�+��ŋj�>�Q�I v-<V�ʑz�J l�D:�h�C�U�R�>�z�$Ż�s4�i
뒘�2�z�U�,}b��u
:'�a6fcb3123a25d76def0056f4824d21d6e9f0411ebL��ԨbL���3JIS_X0201.gzn�5JIS_C6229-1984-KANA.gzn7x�JIS_C6229-1984-HAND.gzma�nJIS_C6229-1984-HAND-ADD.gzxm�aJIS_C6229-1984-B.gzn7�JIS_C6229-1984-B-ADD.gzan�1JIS_C6229-1984-A.gz3�JIS_C6220-1969-RO.gza�nJIS_C6220-1969-JP.gzPmJIS7.pmm0��9��Istanbul|�Israel�8�Isle_of_Man��Irkutsk{�Iran��a;Iqaluitis��`�Inuviki�0����W_SIndianapolis7`�/Indiana-Starke�x�������������h�����X�#�gJj�����������������=�����~�����������������=�=�=�ll-applet
- remove cockpit service definition, cockpit package still ships their own
- remove testsuite force of LC_ALL=C.UTF-8. RHEL-7 doesn't have C.UTF-8
- remove nftables support- even if startup failed, reapply non-permanent interface to zone assignments- backport patches to enter failed state if startup fails- backport patches to avoid NM for generated connections- backport patches for --check-config option- rebase package to v0.5.3- services/high-availability: Add port 9929 (RHBZ#1486143)- firewalld: also reload dbus config interface for global options
  (RHBZ#1514043)- Fix and improve firewalld-sysctls.conf (RHBZ#1516881)- core: Log unsupported ICMP types as informational only (RHBZ#1479951)
- doc: firewall-cmd: Document --query-* options return codes (RHBZ#1372716)
- doc: firewall-cmd: Document quirk in --reload option (RHBZ#1452137)
- firewall-cmd: Use colors only if output is a TTY (RHBZ#1368544)
- firewall-offline-cmd: Don't require root for help output (RHBZ#1445214)- Add missing ports to RH-Satellite-6 service (RHBZ#1422149)- Reload nf_conntrack sysctls after the module is loaded (RHBZ#1462977)- Add NFSv3 service (a127d697177b) (RHBZ#1462088)- firewall.functions: New function get_nf_nat_helpers (RHBZ#1452681)
- firewall.core.fw: Get NAT helpers and store them internally. (RHBZ#1452681)
- firewall.core.fw_zone: Load NAT helpers with conntrack helpers (RHBZ#1452681)
- firewalld.dbus: Add missing properties nf_conntrach_helper_setting and
  nf_conntrack_helpers (RHBZ#1452681)
- D-Bus interfaces: Fix GetAll for interfaces without properties (RHBZ#1452017)
- firewall.server.firewalld: New property for NAT helpers supported by the
  kernel (RHBZ#1452681)- IPv6 ICMP type only rich-rule fix (cf50bd0) (RHBZ#1459921)- Translation update for japanese (RHBZ#1382652)- Add services for oVirt: ovirt-imageio, ovirt-vmconsole, ovirt-storageconsole,
  ctbc and nrpe (RHBZ#1449158)
- Fix policy issue with the choice policies by using the .policy.choice
  extension (RHBZ#1449754)- Fix --{set,get}-{short,description} for zones (RHBZ#1416325)
- Man pages: Add sctp and dccp for ports, ... (RHBZ#1429808)
- Add support for new wait option in restore commands (RHBZ#1446162)- Add support for sctp and dccp in ports, source-ports and forward-ports
  (RHBZ#1429808)
- Fix firewall-offline-cmd --remove-service-from-zone= option (RHBZ#1438127)- Rebase to firewalld-0.4.4.4
  http://www.firewalld.org/2017/03/firewalld-0-4-4-4-release
- Drop references to fedorahosted.org from spec file and Makefile.am, use
  archive from github
- Fix inconsistent ordering of rules in INPUT_ZONE_SOURCE (issue#166)
  (RHBZ#1421222)
- Fix ipset overloading from /etc/firewalld/ipsets (RHBZ#1423941)
- Fix permanent rich rules using icmp-type elements (RHBZ#1434763)
- firewall-config: Deactivate edit, remove, .. buttons if there are no items
- Check if ICMP types are supported by kernel before trying to use them
  (RHBZ#1401978)
- firewall-config: Show invalid ipset type in the ipset configuration dialog
  in a special label (RHBZ#1419058)- Drop ghost flag on policy file again- Rebase to firewalld-0.4.4.3 (RHBZ#1414584)
- Support disabled automatic helper assignment in firewalld (RHBZ#1006225)
- Fix masquerade rules to be created always the same (RHBZ#1374001)
- Properly handle quoted ifcfg file values (RHBZ#1395348)
- Fix extension of ifcfg backup files (RHBZ#1400478)
- Complete icmp types list (RHBZ#1401978)
- Fix LOG rule placement for LogDenied (RHBZ#1402932)
- Show error messages from NM and do not trace back (RHBZ#1405562)
- Support icmp-type usage in rich rules (RHBZ#1409544)
- New service file for freeipa-trust (RHBZ#1411650)
- Fix --{set,get}-{short,description} for ipset in commands (RHBZ#1416325)
- Speed up large ipset file loading and import (RHBZ#1416817)
- Improve support for ipsets in firewalld (RHBZ#1419058)
- ALREADY_ errors should result in warnings and zero exit code (RHBZ#1420457)- Fix LOG rule placement for LogDenied (RHBZ#1402932)- Fix ZONE being blanked in ifcfg on reboot (RHBZ#1381314)- Exclu�x������������������X<#gJj�����\�������������������}�����������������RRRRRRPRPRPRPRPRR?����y��Y��H$ƨ���.�h3��#����H�*��6�8�!��ٍZ���ULp�c�x�%id-쯖E������gס���'�S3�sF��*b"�)������myF�ّכ��ՐWD�hO���=�g)���Lm
����xdmź)͊�}*Z�d*-2��i��8��U��<�
6�oZB��L�!����e�Me�7���0&C�Bk�-麍V����I�V�ew�oHN�A�����Y돿B�qyʞ$x8sĊ�	Z%����h
�'��h��ӗ���5ʺ�=�[:�Nh�����d�#�2����ӣ\UDY���;ۤ�~�8�Q�<��#�"�K��dK���Ϋյ�¹~\
�].���S�j'�",�Wջ�8k�7�����Xe)�t@��k���%�]���	ejG�(�vtx�� g�Vት���t�$d$��Os�d�>�'��P4+�v�uY��'2U"�ߠ:�?�C��5��qD:�	:���;ʐCh�F��0���1��i�L:�Y��H$ƨ�����`43{�1���W�5Sfd�1T~�����d�C�Z��*��]��R�}0U���?C���y&�kO:]��f�:Ƣ�#��`D
��iХ$i5�J���w8�;kuC��]V��'�_���7��@?��	��.̲�|���2�!>��`�@��"s��G���]�����o0�tT(���H�O�jS&����<6$��c�{b�/w_ZƒH���?Ʉ��6������7�X]��OtS�O>�?&�� k�ύ=�\�7���|�"�Dc>��j+�AX{&��-Iz���4�
�(^P��w>	����	�8�ʾ�M{�%)>�o~�8f�����Nu�+;�2k�n,�g/�~!#K%��㙱�ļ�q
e4Qφ
&�â{\��$���!,�B��\Q!\E�[ה��eRJ��������<s2�m����q��|ۍ�t���,�h<��w�g��{T'��@�v3�M!�(��aC�̘��3�hA|�#�z&@��&�H��=Vbc0a9fde1f116e5bf60822e3a3b2e7396500c5dabL��l�bL��y: Add driver for xhci debug capability (Torez Smith) [1540721]
- [usb] host: Allow to build ehci orion with mvebu SoCs (Torez Smith) [1540721]
- [usb] misc: sisusb_con: fix coccinelle warning (Torez Smith) [1540721]
- [usb] storage: karma: remove useless variable (Torez Smith) [1540721]
- [usb] misc: ldusb: changed '*' location to fit coding Style (Torez Smith) [1540721]
- [usb] misc: ldusb: Added Space after ', ' to fit the coding style (Torez Smith) [1540721]
- [usb] misc: ldusb: fixed decimal permission coding issue (Torez Smith) [1540721]
- [usb] misc: remove unnecessary code (Torez Smith) [1540721]
- [usb] of: add functions to bind a companion controller (Torez Smith) [1540721]
- [usb] add CONFIG_USB_PCI for system have both PCI HW and non-PCI based USB HW (Torez Smith) [1540721]
- [usb] r8152: simply the arguments (Torez Smith) [1540721]
- [usb] serial: whiteheat: simplify endpoint check (Torez Smith) [1540721]
- [usb] serial: symbolserial: simplify endpoint check (Torez Smith) [1540721]
- [usb] serial: spcp8x5: simplify endpoint check (Torez Smith) [1540721]
- [usb] serial: pl2303: simplify endpoint check (Torez Smith) [1540721]
- [usb] serial: oti6858: simplify endpoint check (Torez Smith) [1540721]
- [usb] serial: opticon: simplify endpoint check (Torez Smith) [1540721]
- [usb] serial: omninet: simplify endpoint check (Torez Smith) [1540721]
- [usb] serial: mos7720: simplify endpoint check (Torez Smith) [1540721]
- [usb] serial: kobil_sct: simplify endpoint check (Torez Smith) [1540721]
- [usb] serial: keyspan_pda: simplify endpoint check (Torez Smith) [1540721]
- [usb] serial: iuu_phoenix: simplify endpoint check (Torez Smith) [1540721]
- [usb] serial: io_edgeport: simplify and tighten endpoint check (Torez Smith) [1540721]
- [usb] ser�x�������������X�����X�#GfJj�����B�����������������������������|	8�?�d��%�*�	6�	��������	!�-�B�HPT	V
X\�
������Tp(A8H9T:�GTHXI\X`Yl\�]�^�b�dienfqls����
�����g�h�Ccpanel-perl-536-math-fibonacci-phi0.021.cp108~el7CPAN module - Perl extension for calculating Phi and phi for Fibonacci numbers.Cpanel build perl module 'Math::Fibonacci::Phi'Perl extension for calculating Phi and phi for Fibonacci numbers.b�ܐbh-centos-7.dev.cpanel.netrperlcpanel/perlhttps://metacpan.orglinuxnoarchr�$C�'efe3d8ff60c8b9de13379ac0c0b265ec54e8a7e847da11aabf6ad0025a63423arootrootcpanel-perl-536-math-fibonacci-phi-0.02-1.cp108~el7.src.rpm����cpanel-perl(Math::Fibonacci::Phi)cpanel-perl-math-fibonacci-phicpanel-perl-536-math-fibonacci-phi




cpanel-perl-536cpanel-perl-536-math-fibonaccirpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(CompressedFileNames)rpmlib(PayloadIsXz)rpmlib(TildeInVersions)4.6.0-14.0-13.0.4-15.2-14.10.0-14.11.1b�@`-@Q+R@Busy Camels <bc@cpanel.net> - 0.02-1.cp108Busy Camels <bc@cpanel.net> - 0.02-1.cp1198Todd Rinaldo <toddr@cpanel.net> - 0.02-1.cp1136- Bump to 1.cp108 for re-build- Bump to 1.cp1198 for debian re-build- Update from upstream: Math-Fibonacci-Phi 0.020.020.020.02-1.cp108~el7Phi.pm/usr/local/cpanel/3rdparty/perl/536/cpanel-lib/Math/Fibonacci/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches   -m64 -mtune=genericcpioxz2noarch-redhat-linux-gnu?�����YMe�+�h���In4d822ae98bf8a8f371a92940b5807dfc8d8a243dc�VC�c�VAp/build
- add patch to redirect mysql.sock (in mysqlnd)- update to 5.3.8
  http://www.php.net/ChangeLog-5.php#5.3.8- update to 5.3.7
  http://www.php.net/ChangeLog-5.php#5.3.7
- merge php-zts into php (#698084)- rebuild for net-snmp SONAME bump- enable mhash extension (emulated by hash extension)- rebuild for new MySQL client library- update to 5.3.6
  http://www.php.net/ChangeLog-5.php#5.3.6
- fix php-pdo arch specific requires- disable zip extension per "No Bundled Libraries" policy (#551513)- rebuild for icu 4.6- fix systemd-units requires- add tmpfiles.d configuration for php-fpm
- add Arch specific requires/provides- Rebuilt for https://fedoraproject.org/wiki/Fedora_15_Mass_Rebuild- update to 5.3.5
  http://www.php.net/ChangeLog-5.php#5.3.5
- clean duplicate configure options- rebuild against MySQL 5.5.8
- remove all RPM_SOURCE_DIR- security patch from upstream for #660517- update to 5.3.4
  http://www.php.net/ChangeLog-5.php#5.3.4
- move phpize to php-cli (see #657812)- ghost /var/run/php-fpm (see #656660)
- add filter_setup to not provides extensions as .so- use mysql_config in libdir directly to avoid biarch build failures- rebuild for new net-snmp- add php-fpm sub-package- PHP 5.3.3 released- garbage collector upstream  patches (#580236)- rebuild for icu 4.4- PHP 5.3.2 Released!
- remove mime_magic option (now provided by fileinfo, by emu)
- add patch for http://bugs.php.net/50578
- remove patch for libedit (upstream)
- add runselftest option to allow build without test suite- update to v7 of systzdata patch- fix build with autoconf 2.6x- update to 5.3.1
- remove openssl patch (me�x����� ^������Џ����Xq#�gJj�Z������xD�������=�����t�����������������=�=�=�ources family agnostic
- Better defaults for lockdown white list
- Use auth_admin_keep for allow_any and allow_inactive also
- New D-Bus API for lockdown policies
- Use IPv4, IPv6 and BRIDGE for FirewallD properties
- Use rich rule action as audit type
- Prototype of string-only D-Bus interface for rich language
- Fixed wrongly merged source family check in firewall/core/io/zone.py
- handle_cmr: report errors, cleanup modules in error case only, mark handling
- Use audit type from rule action, fixed rule output
- Fixed lockdown whitelist D-Bus handling method names
- New rich rule handling in runtime D-Bus interface
- Added interface, source and rich rule handling (runtime and permanent)
- Fixed dbus_obj in FirewallClientConfigPolicies, added queryLockdown
- Write changes in setLockdownWhitelist
- Fixed typo in policies log message in method calls
- firewall-cmd: Added rich rule, lockdown and lockdown whitelist handling
- Don't check access in query/getLockdownWhitelist*()
- firewall-cmd: Also output masquerade flag in --list-all
- firewall-cmd: argparse is able to convert argument to desired type itself
- firewall-cmd_test.sh: tests for permanent interfaces/sources and lockdown whitelist
- Makefile.am: add missing files
- firewall-cmd_test.sh: tests for rich rules
- Added lockdown, source, interface and rich rule docs to firewall-cmd
- Do not masquerade lo if masquerade is enabled in the default zone (RHBZ#904098)
- Use <rule> in metavar for firewall-cmd parser- removed unintentional en_US.po from tarball- Fix signal handling for SIGTERM
- Additional service files (RHBZ#914859)
- Updated po files
- s/persistent/permanent/ (Trac Ticket #7)
- Better behaviour when running without valid DISPLAY (RHBZ#955414)
- client.handle_exceptions(): do not loop forever
- Set Zone.defaults in zone_reader (RHBZ#951747)
- client: do not pass the dbus exception name to handler
- IO_Object_XMLGenerator: make it work with Python 2.7.4 (RHBZ#951741)
- firewall-cmd: do not use deprecated BaseException.message
- client.py: fix handle_exceptions() (RHBZ#951314)
- firewall-config: check zone/service/icmptype name (RHBZ#947820)
- Allow 3121/tcp (pacemaker_remote) in cluster-suite service. (RHBZ#885257)
- firewall-applet: fix default zone hangling in 'shields-up' (RHBZ#947230)
- FirewallError.get_code(): check for unknown error- Make permanenent changes work with Python 2.7.4 (RHBZ#951741)- Use explicit file lists for make dist
- New rich rule validation check code
- New global check_port and check_address functions
- Allow source white and black listing with the rich rule
- Fix error handling in case of unsupported family in rich rule
- Enable ip_forwarding in masquerade and forward-port
- New functions to read and write simple files using filename and content
- Add --enable-sysconfig to install Fedora-specific sysconfig config file.
- Add chains for security table (RHBZ#927015)
- firewalld.spec: no need to specify --with-systemd-unitdir
- firewalld.service: remove syslog.target and dbus.target
- firewalld.service: replace hard-coded paths
- Move bash-completion to new location.
- Revert "Added configure for new build env"
- Revert "Added Makefile.in files"
- Revert "Added po/Makefile.in.in"
- Revert "Added po/LINGUAS"
- Revert "Added aclocal.m4"
- Amend zone XML Schema- Added rich language support
- Added lockdown feature
- Allow to bind interfaces and sources to zones permanently
- Enabled IPv6 NAT support
  masquerading and port/packet forwarding for IPv6 only with rich language
- Handle polkit errors in client class and firewall-config
- Added priority description for --direct --add-rule in firewall-cmd man page
- Add XML Schemas for zones/services/icmptypes XMLs
- Don't keep file descriptors open when forking
- Introduce --nopid option for firewalld
- New FORWARD_IN_ZONES and FORWARD_OUT_ZONES chains (RHBZ#912782)
- Update cluster-suite service (RHBZ#885257)
- firewall-cmd: rename --enable/disable-panic to --panic-on/off (RHBZ#874912)
- Fix interaction problem of changed event of gtk combobox with polkit-kde
  �x�������������H����X%#�gJj��������P�����s�����\�����������������s:k�s�ficate "Sectigo Public Server Authentication Root R46"
-     # Certificate "SSL.com Client ECC Root CA 2022"
-     # Certificate "SSL.com Client RSA Root CA 2022"
-     # Certificate "SSL.com TLS ECC Root CA 2022"
-     # Certificate "SSL.com TLS RSA Root CA 2022"
-     # Certificate "TrustAsia Global Root CA G3"
-     # Certificate "TrustAsia Global Root CA G4"
- Update test certificates
- Tests were activated
- dbtests.sh waiting time was increased to pass the test on slow VM- fix EMS bug
- disbale ECH
- fix gtests in spec file
- restore missing test case- Rebase to NSS 3.90- fix CVE-2023-0767- fix regression for pkcs12.- fix crash in curl. better fix for the regression below- fix regressions found in test suite- Rebase to NSS 3.79
- Set FIPS Module ID- fix CVE-2021-43527- revert sql default language in man pages
- fix SEC_PKCS12EnableCipher so python-nss tests will still work.- fix sdb timeout issue
- fix incorrect ssl alerts in Signature scheme processing- Rebase to NSS 3.67- restore pkcs12 defaults- Rebase to NSS 3.66- Fix HSM load failure because of CKO_Profile
- Allow builds with strict-proto- Update to CVE 2020-256423 TLS flood DOS attack patch.- Fix CVE 2020-256423 TLS flood DOS Attack.- Fix deadlock issue
- Fix 3 FTBS issues, 2 expired certs, one semantic change in nss-softokn.- Disable dh timing test because it's unreliable on s390 (from Bob Relyea)
- Explicitly enable upgradedb/sharedb test cycles- Disable TLS 1.3 by default- Rebase to NSS 3.53.1- Increase timeout on ssl_gtest so that slow platforms can complete when
   running on a busy system.- back out out-of-bounds patch (patch for nss-softokn).
- Fix segfault on empty or malformed ecdh keys (#1777712)- Fix out-of-bounds write in NSC_EncryptUpdate (#1775911,#1775910)- Fix pkix name constraints processing to only process the common name if the
  certusage you are checking is IPSEC or SSL Server.- Fix certutil man page
- Fix extracting a public key from a private key for dh, ec, and dsa- Disable TLS 1.3 under FIPS mode
- Disable RSASSA-PKCS1-v1_5 in TLS 1.3
- Fix post-handshake auth transcript calculation if
  SSL_ENABLE_SESSION_TICKETS is set- Skip sysinit gtests properly
- Fix shell syntax error in tests/ssl/ssl.sh
- Regenerate manual pages- Rebase to NSS 3.44
- Restore fix-min-library-version-in-SSLVersionRange.patch to keep
  SSL3 supported in the code level while it is disabled by policy
- Skip TLS 1.3 tests under FIPS mode- Ignore system policy when running %check- Fix policy string- Don't override date in man-pages
- Revert the change to use XDG basedirs (mozilla#818686)
- Enable SSL2 compatible ClientHello by default
- Disable SSL3 and RC4 by default- Make "-V ssl3:" option work with tools- Fix regression in MD5 disablement- add certutil documentation- Restore complete removal of SSLv2
- Disable SSLv3
- Move signtool to unsupported directory- Expand IPSEC usage to include ssl and email certs. Remove special
  processing of the usage based on the critical flag- Rebase to NSS 3.43- move key on unwrap failure and retry.- Update the cert verify code to allow a new ipsec usage and follow RFC 4945- Backport upstream fix for CVE-2018-12384
- Remove nss-lockcert-api-change.patch, which turned out to be a
  mistake (the symbol was not exported from libnss)- Exercise SSL tests which only run under non-FIPS setting- Restore CERT_LockCertTrust and CERT_UnlockCertTrust back in cert.h- Work around modutil -changepw error if the old and new passwords are
  both empty in FIPS mode- Decrease the iteration count of PKCS#12 for compatibility with Windows
- Fix deadlock when a token is re-inserted while a client process is running- Set NSS_FORCE_FIPS=1 in %build
- Revert the changes to tests assuming the default DB type- Rebase to NSS 3.36- Re-enable nss-is-token-present-race.patch- Temporarily disable nss-is-token-present-race.patch- Backport necessary changes from 3.35- Rebase to NSS 3.34- Rebase to NSS 3.34.BETA1- Disable TLS 1.3- Enable TLS 1.3- Rebase to NSS 3.33
- Disable TLS 1.3, tem�x��������������n����X,#&fJj�������������K1�����#����������������K1��L1�0ea8c96c7723cc42bef0af39f8485eca6b33be7bbb7cb0646b44d4cb8f674dcf0715a51ec2186643925635a44a9ea8dd3fa5e170c839d5d132d18f83bece130908535697c2350f8c44befc0a3a6cb4c70c5ceaad2980082a21cc2cf839c91308854b57940a9ebfe9c27306283af0f1abc9a7391427f79ab617b25306be54fa0e39e3036615a95d466bc51749bb06b847c227afb8fc84c311eb121bd0b8dbc44e0c728c5cb4f3bdaf076c456d40f22a4db12514cae4acf94a04bcbd105c2ff2228c00c14848d9a1f8af68326e69e2578e0849d8ac7b2c782b3ce00510libidn2.so.0.3.7����rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootalt-libidn2-2.3.0-2.el7.src.rpm������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������alt-libidn2alt-libidn2(x86-64)


@@@@
rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(CompressedFileNames)libc.so.6()(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libunistring.so.0()(64bit)rpmlib(PayloadIsXz)4.6.0-14.0-13.0.4-15.2-14.11.3h0c@bγ�Sergey Fokin <sfokin@cloudlinux.com> - 2.3.0-2Ilya Voyskovsky <ivoyskovsky@cloudlinux.com> - 2.3.0-1- add alt_default_filter macros
- add rpath to pkgconfig- ALTPHP-1297: Initial build	

 !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQ2.3.0-2.el72.3.0-2.el7	

 !"#$%&'()*+,-./01234libidn2.so.0libidn2.so.0.3.7alt-libidn2-2.3.0AUTHORSNEWSREADME.mdalt-libidn2-2.3.0COPYINGCOPYING.LESSERv3COPYING.unicodeCOPYINGv2localecsLC_MESSAGESlibidn2.modaLC_MESSAGESlibidn2.modeLC_MESSAGESlibidn2.moeoLC_MESSAGESlibidn2.moesLC_MESSAGESlibidn2.mofiLC_MESSAGESlibidn2.mofrLC_MESSAGESlibidn2.mofurLC_MESSAGESlibidn2.mohrLC_MESSAGESlibidn2.mohuLC_MESSAGESlibidn2.moidLC_MESSAGESlibid�x�������������8^����X�#PgJj0�`x����6�����X�����������������6�D�?d���!�	-�	f�������	"�8�^�dk���	�
���
?b���
�
�
(�8�9�:�>�@�BGH8ITX\Y`Zt[x\|]�^�b	�d
Ie
Nf
Ql
St
lu
�v
�w
�x
��,0
@�lpxg|h�Ccpanel-php81-mail-mime1.10.111.cp110~el7PEAR: Mail_Mime provides classes to create MIME messagesMail_Mime provides classes to deal with the creation and manipulation of
MIME messages.
It allows people to create e-mail messages consisting of:
* Text Parts
* HTML Parts
* Inline HTML Images
* Attachments
* Attached messages

It supports big messages, base64 and quoted-printable encodings and
non-ASCII characters in filenames, subjects, recipients, etc. encoded
using RFC2047 and/or RFC2231.ci|�bh-centos-7.dev.cpanel.net �BSD StyleDevelopment/Librarieshttp://pear.php.net/package/Mail_Mimelinuxnoarchecho /usr/local/cpanel/3rdparty/php/81/lib/pear/Mail_Mime.xml >> /var/cpanel/.pending_pear_registrations# Only remove PEAR registry entry if this is a plain uninstall. For upgrades, leave it in place.
if [ x$1 = x0 ]; then echo pear.php.net/Mail_Mime >> /var/cpanel/.pending_pear_deregistrations ; fi��(֬�J��A큤��A�A큤a4�)ci|�ci|�ci|�ci|�ci|�ci|�609eb03f053a076528c40ac150b597e898d910b5a98316946c390d38c54ec52c5a7ab1cf2652ba8545fcc12e9eaf1a552af3563bc8cf1cd1fd189a153c03dd79aae3edd638e5dda435d9d9cac857bc587436ebbdaf6f4125618a82a6ed47215ee3b0c44298fc1c149afbf4c8996fb92427ae41e4649b934ca495991b7852b855rootrootrootrootrootrootrootrootrootrootrootrootrootrootcpanel-php81-mail-mime-1.10.11-1.cp110~el7.src.rpm����������������������������cpanel-php81-mail-mime




/bin/sh/bin/shcpanel-php81cpanel-php81cpanel-php81rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rpmlib(TildeInVersions)3.0.4-14.6.0-14.0-15.2-14.10.0-14.11.1c_��a��`OL@B. McMahon <b.mcmahon@cpanel.net> - 1.10.11-1.cp110~el7B. McMahon <b.mcmahon@cpanel.net> - 1.10.2-1.cp11102Nicolas Rochelemagne <nicolas.rochelemagne@cpanel.net> - 1.10.2-1.cp1198- Packaging for PHP v8.1- Packaging for PHP v7.4- Rename package and add Ubuntu support/bin/sh/bin/shcpanel-php74-mail-mime1.10.11-1.cp110~el7Mail_Mime.xmlMailmime.phpmimePart.phpdocscpanel-php81-mail-mime-1.10.11nodocs/usr/local/cpanel/3rdparty/php/81/lib/pear//usr/local/cpanel/3rdparty/php/81/lib/php//usr/local/cpanel/3rdparty/php/81/lib/php/Mail//usr/share/doc//usr/share/doc/cpanel-php81-mail-mime-1.10.11/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches   -m64 -mtune=genericcpioxz2noarch-redhat-linux-gnuXML document textdirectoryC++ source, ASCII textempty?���@u�uk	��̬�7����x�4ab0fd67dc6f8ff7c593e38d93d2751766f375f0d6A=%�d6A;[1480522]
- [tools] perf p�x��������������M����Xh�eJj��������@u}������������������}�|�~��chmod_i360deploy_log.py065_remove_capture_csf_lock_from_config.py066_eula_table.py067_drop_fields_from_modsec_conf.py068_remove_rules_check_interval_from_config.py069_incidents_domain_field.py070_modsec_incident_names.py071_malware_hits_hash_size_fields.py072_add_malware_history_table.py072_captcha_stat.py072_extend_last_synclist.py073_drop_dos_expiration.py074_ip_as_int.py075_ips_as_int.py076_hash_model.py077_alter_malware_scan.py078_fix_signatures_permissions.py079_add_uid_gid_fields.py080_populate_uid_gid_size_hash_fields.py081_fix_clamscan_broken_symlink.py082_add_cl_on_premise_backup_option.py082_add_manual_flag.py083_drop_no_captcha_field.py084_country_subnets_fields.py085_country_subnets_fields.py086_ignored_by_port_fields.py087_ignored_by_port_fields.py088_add_malware_i360_clamd_scan_option.py089_proactive_tables.py090_safe_user_config.py091_compress_old_logs.py092_ignore_proc_sys_dirs.py092_remove_old_disabled_rules.py093_make_quarantined_files_immutable.py094_ignore_cagefs_proc.py095_add_total_malicious_field.py096_populate_total_malicious_field.py097_remove_uid_and_gid.py098_remote_proxy_tables.py099_remove_old_disabled_rules.py100_remove_captcha_ports_from_csf.py101_remove_unneeded_acronis_ports_from_csf.py102_proactive_ignore_list.py102_replace_comodo.py103_remove_vd_license.py104_add_feature_management_permissions.py105_populate_default_feature_management_permissions.py106_add_malware_cleanup_in_config.py106_malware_hit_status_field_add.py107_add_bruteforce_rule_33339.py107_malware_hit_status_field_populate.py108_feature_management_cleanup_add.py108_validate_config.py109_dos_detector.py110_ignore_list_ip_as_int.py111_ignore_list_ip_as_int.py112_hardened_php.py113_move_quarantined_files.py114_disable_auto-quarantine.py115_feature_management_fields.py116_feature_management_fields.py117_remove_incorrect_fields.py118_add_malware_user_infected.py118_remove_country_subnets.py119_populate_malware_user_infected.py120_scheduled_scan.py121_drop_captcha_stat.py122_cagefs_unmount.py123_add_last_user_scan.py123_disable_scheduled_scan.py123_rename_plesk_vendor.py124_add_hook_management_functionality.py124_add_infected_domains_vendor.py125_rescan_scan_type.py126_add_malware_scan_modified_files_option.py126_move_malware_hits_list.py127_remove_malware_hit_mode.py128_move_cleanup_storage_files.py129_fixed_cagefs_unmount.py130_add_messages_to_send.py131_incident_timestamp_index.py132_add_timestamp_field.py133_add_scope_field_to_iplist.py134_change_default_of_intensity_ram.py135_export_proactive.py135_make_completed_nullable.py136_drop_proactive.py137_swap_initiator_and_cause.py138_move_rapid_scan_dir.py139_generic_modsec_config.py140_cast_malware_hit_orig_file_as_blob.py141_drop_last_user_scans.py143_malware_hit_cascade_delete.py144_remove_clamav_config_options.py144_remove_hash_table.py145_move_quarantine.py146_malware_user_infected_cascade_delete.py147_remove_vendor_field.py147_user_scan_type.py148_reconstruct_pickled_scan_queue.py148_remove_malware_user_infected.py149_add_captcha_passed_field_to_iplist.py149_make_config_inactive.py150_update_captcha_passed_field_for_iplist_entries.py151_change_constraint_for_iplist.py152_add_listname_to_primary_key.py153_migrate_config_default_action.py153_update_incident_name.py154_migrate_config_user_override_malware_actions.py155_migrate_config_user_override_proactive_defense.py156_remove_default_values_from_config.py157_move_i360_modsec_disable_conf.py158_move_i360_modsec_disable_conf_symlink.py159_remove_defaults_from_local_config.py160_remove_quarantine.py160_unmount_sigs_v1.py161_remove_ea4_main_local_conf.py162_add_resource_type.py163_drop_malware_scanned_stat.py164_add_resource_type_to_ignore.py165_add_db_fields_to_malware_history.py166_add_id_field_to_malware_ignore_path.py167_remote_iplist.py168_add_icontact_throttle.py169_add_record_to_throttle_scan_not_schedule_events.py170_add_db_fields_to_malware_history.py180_move_captcha_co�x�������������(=����X#�fJj�������������Y���t�����c����������������t
t�H�|?��d��
��	$�	K�������������4�	b������<��	
(.
D\z���l	C(	o8	xl9(l:�l>�I?�Q@�YG�hH��I��X��Y��\�H]�`^��b�d��e��f��l��t��u��v��w�x�y�0�������6���6
�8��d�h�pg�th�xClibgomp4.8.544.el7.tuxcare.els1GCC OpenMP v3.0 shared support libraryThis package contains GCC shared support library which is needed
for OpenMP v3.0 support.g���buildfarm06-new.corp.cloudlinux.com<�CentOSTuxCareGPLv3+ and GPLv3+ with exceptions and GPLv2+ with exceptions and LGPLv2+ and BSDTuxCare Packaging Team <packager@tuxcare.com>System Environment/Librarieshttp://gcc.gnu.orglinuxx86_64/sbin/ldconfig
if [ -f /usr/share/info/libgomp.info.gz ]; then
  /sbin/install-info \
    --info-dir=/usr/share/info /usr/share/info/libgomp.info.gz || :
fiif [ $1 = 0 -a -f /usr/share/info/libgomp.info.gz ]; then
  /sbin/install-info --delete \
    --info-dir=/usr/share/info /usr/share/info/libgomp.info.gz || :
fi\�`�[}~����A큤����g���g���g���U�PɬNg���a34b323345bf3adaaf328c7b59be88cd8b197718c318847ed4be7e7b473747d0a0b61f4e014131680a85d16da7fd44539f4f679ae394ff2f87bfb374bc3f9250d5809c6fc2e0e6c0b88e820f70ded3daa84aa99361eb5db8924dbd02caa9d5ff0c66b7472acaafd76952b725195e75c06e695673b717f5e4047e998eafd6d42flibgomp.so.1.0.0rootrootrootrootrootrootrootrootrootrootrootrootgcc-4.8.5-44.el7.tuxcare.els1.src.rpm������������������������libgomplibgomplibgomp(x86-64)libgomp.so.1()(64bit)libgomp.so.1(GOACC_2.0)(64bit)libgomp.so.1(GOACC_2.0.1)(64bit)libgomp.so.1(GOMP_1.0)(64bit)libgomp.so.1(GOMP_2.0)(64bit)libgomp.so.1(GOMP_3.0)(64bit)libgomp.so.1(GOMP_4.0)(64bit)libgomp.so.1(GOMP_4.0.1)(64bit)libgomp.so.1(GOMP_4.5)(64bit)libgomp.so.1(GOMP_PLUGIN_1.0)(64bit)libgomp.so.1(GOMP_PLUGIN_1.1)(64bit)libgomp.so.1(OACC_2.0)(64bit)libgomp.so.1(OMP_1.0)(64bit)libgomp.so.1(OMP_2.0)(64bit)libgomp.so.1(OMP_3.0)(64bit)libgomp.so.1(OMP_3.1)(64bit)libgomp.so.1(OMP_4.0)(64bit)libgomp.so.1(OMP_4.5)(64bit)	@@@@@@@@@@


@
/bin/sh/bin/sh/sbin/install-info/sbin/install-info/sbin/ldconfiglibc.so.6()(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.17)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.3)(64bit)libc.so.6(GLIBC_2.4)(64bit)libc.so.6(GLIBC_2.6)(64bit)libpthread.so.0()(64bit)libpthread.so.0(GLIBC_2.2.5)(64bit)libpthread.so.0(GLIBC_2.3.4)(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rtld(GNU_HASH)rpmlib(PayloadIsXz)3.0.4-14.6.0-14.0-15.2-14.11.3g�@^{G�^y�@^[�]�B�]6��\u*@\s�\?�[��[{@Z�@Z�m�Z؄�Z̧@Zľ@Z�2@Za�ZWQ�ZN@Z
�ZN�Y��Y�Y�B@Y�Y@Y�@Y�p@Y�o@Y0�Y.�@XƉ�X•@X���W��W�@W��@WaC@WYZ@WUe�W1�@U�K@U�'�U��@U�J@Te�T%U@T��T=@S��@Sہ@S��@SǺ�S�h@St�@SG�@Sn�S�@S��R�a@R��R�x@R�&�R��R��@R��@R�S�R���R��Rz/@Rc�R_�@RV��RL
�R<8�R5�@R-�@R7�Rq@Q�@Q��@Q�z�Q�b�Q��@Q��@Q�V@Q��Q��@Q��Qq1�Qg�@QLG�QI��QD^�Q8�@Q4��Q$��Q#@Q�@Q�@Q�QE�Q
\�Q��Q"@P�@P�-�P�g@Azat Nurgaliev <anurgaliev@cloudlinux.com> - 4.8.5-44.�x��������������,����X#�gJj�����'���pG����s�����[�����������������s�s?K�porarily disable failing gtests (Skip13Variants)
- Temporarily disable race.patch and nss-3.16-token-init-race.patch,
  which causes a deadlock in newly added test cases
- Remove upstreamed patches: moz-1320932.patch,
  nss-tstclnt-optspec.patch,
  nss-1334976-1336487-1345083-ca-2.14.patch, nss-alert-handler.patch,
  nss-tools-sha256-default.patch, nss-is-token-present-race.patch,
  nss-pk12util.patch, nss-ssl3gthr.patch, and nss-transcript.patch- Add backward compatibility to pk12util regarding faulty PBES2 AES encryption- Update iquote.patch to prefer nss.h from the source- Add backward compatibility to pk12util regarding password encoding- Backport patch to simplify transcript calculation for CertificateVerify
- Enable TLS 1.3 and RSA-PSS
- Disable some upstream tests failing due to downstream ciphersuites changes- Work around yum crash due to new NSPR symbol being used in nss-sysinit,
  patch by Kai Engert- Fix typo in nss-sni-c-v-fix.patch- Include CKBI 2.14 and updated CA constraints from NSS 3.28.5- Update nss-pk12util.patch to include fix from mozbz#1353724.- Update nss-alert-handler.patch with the upstream fix from mozbz#1360207.- Fix zero-length record treatment for stream ciphers and SSLv2- Correctly set policy file location when building- Reorder ChaCha20-Poly1305 cipher suites, as suggested in:
  https://bugzilla.redhat.com/show_bug.cgi?id=1373158#c9- Rebase to NSS 3.28.4
- Update nss-pk12util.patch with backport of mozbz#1353325- Switch default hash algorithm used by tools from SHA-1 to SHA-256
- Avoid race condition in nssSlot_IsTokenPresent()
- Enable SHA-2 and AES in pk12util
- Disable RSA-PSS for now- Utilize CKA_NSS_MOZILLA_CA_POLICY attribute, patch by Kai Engert
- Backport changes adding SSL alert callbacks from upstream
- Add nss-check-policy-file.patch from Fedora
- Install policy config in /etc/pki/nss-legacy/nss-rhel7.config- Make sure 32bit nss-pem always be installed with 32bit nss in
  multlib environment, patch by Kamil Dudka
- Enable new algorithms supported by the new nss-softokn- Rebase to NSS 3.28.3
- Bump required version of nss-softokn- Remove %nss_cycles setting, which was also mistakenly added
- Re-enable BUILD_OPT, mistakenly disabled in the previous build
- Prevent ABI incompatibilty of SECKEYECPublicKey
- Disable TLS_ECDHE_{RSA,ECDSA}_WITH_AES_128_CBC_SHA256 by default
- Enable 4 AES_256_GCM_SHA384 ciphersuites, enabled by the downstream
  patch in the previous release
- Fix crash with tstclnt -W
- Always enable gtests for supported features
- Add patch to fix bash syntax error in tests/ssl.sh
- Build with support for SSLKEYLOGFILE
- Disable the use of RSA-PSS with SSL/TLS- Decouple nss-pem from the nss package
- Resolves: #1316546- Remove mistakenly added R: nss-pem- Rebase to NSS 3.28.2
- Remove NSS_ENABLE_ECC and NSS_ECC_MORE_THAN_SUITE_B setting, which
  is no-op now
- Enable gtests when requested
- Remove nss-646045.patch and fix-nss-test-filtering.patch, which are
  not necessary
- Remove sslauth-no-v2.patch and
  nss-sslstress-txt-ssl3-lower-value-in-range.patch, as SSLv2 is
  already disabled in upstream
- Remove ssl-server-min-key-sizes.patch, as we decided to support DH
  key size greater than 1023 bits
- Remove local patches for SHA384 cipher suites (now supported in
  upstream): dhe-sha384-dss-support.patch,
  client_auth_for_sha384_prf_support.patch,
  nss-fix-client-auth-init-hashes.patch, nss-map-oid-to-hashalg.patch,
  nss-enable-384-cipher-tests.patch, nss-fix-signature-and-hash.patch,
  fix-allowed-sig-alg.patch, tests-extra.patch
- Remove upstreamed patches: rh1238290.patch,
  fix-reuse-of-session-cache-entry.patch, flexible-certverify.patch,
  call-restartmodules-in-nssinit.patch- Rebase to NSS 3.21.3
- Resolves: #1383887- remove additional false duplicates from sha384 downstream patches- enable ssl_gtests (without extended master secret tests), Bug 1298692
- call SECMOD_RestartModules in nss_Init, Bug 1317691- escape all percent characters in all changelog comments- Support TLS 1.2 certificate_verify hashes ot�x�����������������X#�gJj M������H;���)�����o����������������)))�sutil3.since nss-util is untagged at the moment
- preserve time stamps when installing various files- dont install libnssutil3.so since its now in nss-util- Fix spec file problems uncovered by Fedora_12_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_12_Mass_Rebuild- removed two patch files which are no longer needed and fixed previous change log number- updated pem module incorporates various patches
- fix off-by-one error when computing size to reduce memory leak. (483855)
- fix data type to work on x86_64 systems. (429175)
- fix various memory leaks and free internal objects on module unload. (501080)
- fix to not clone internal objects in collect_objects().  (501118)
- fix to not bypass initialization if module arguments are omitted. (501058)
- fix numerous gcc warnings. (500815)
- fix to support arbitrarily long password while loading a private key. (500180) 
- fix memory leak in make_key and memory leaks and return values in pem_mdSession_Login (501191)- add patch for bug 502133 upstream bug 496997- rebuild with higher release number for upgrade sanity- updated to NSS_3_12_4_FIPS1_WITH_CKBI_1_75- re-enable test suite
- add patch for upstream bug 488646 and add newer paypal
  certs in order to make the test suite pass- add conflicts info in order to fix bug 499436- ship .chk files instead of running shlibsign at install time
- include .chk file in softokn-freebl subpackage
- add patch for upstream nss bug 488350- Update to NSS 3.12.3- temporarily disable the test suite because of bug 494266- fix softokn-freebl dependency for multilib (bug 494122)- introduce separate nss-softokn-freebl package- disable execstack when building freebl- add upstream patch to fix bug 483855- build nspr-less freebl library- Update to NSS_3_12_3_BETA4- Rebuilt for https://fedoraproject.org/wiki/Fedora_11_Mass_Rebuild- update to NSS_3_12_2_RC1
- use system zlib- add sparc64 to the list of 64 bit arches- bug 456847, move pkgconfig requirement to devel package- Update to NSS_3_12_1_RC2- NSS 3.12.1 RC1- fix bug bug 429175 in libpem module- bug 456847, add Requires: pkgconfig- nss package should own /etc/prelink.conf.d folder, rhbz#452062
- use upstream patch to fix test suite abort- Update to NSS_3_12_RC4- Update to NSS_3_12_RC2- Zapping old Obsoletes/Provides.  No longer needed, causes multilib headache.- Update to NSS_3_12_BETA3- NSS 3.12 Beta 2
- Use /usr/lib{64} as devel libdir, create symbolic links.- Apply upstream patch for bug 417664, enable test suite on pcc.- Support concurrent runs of the test suite on a single build host.- disable test suite on ppc- disable test suite on ppc64- Build against gcc 4.3.0, use workaround for bug 432146
- Run the test suite after the build and abort on failures.* NSS 3.12 Beta 1- move .so files to /lib- NSS 3.12 alpha 2b- upstream patches to avoid calling netstat for random data- NSS 3.12 alpha 2- Add /etc/prelink.conf.d/nss-prelink.conf in order to blacklist
  our signed libraries and protect them from modification.- Fix off-by-one error in the PEM module- fix a C++ mode compilation error- Add 3.12 ckfw and libnsspem- Updated license tag- Ensure the workaround for mozilla bug 51429 really get's built.- Better approach to ship freebl/softokn based on 3.11.5
- Remove link time dependency on softokn- Fix unowned directories, rhbz#233890- Update to 3.11.7, but freebl/softokn remain at 3.11.5.
- Use a workaround to avoid mozilla bug 51429.- Fix rhbz#230545, failure to enable FIPS mode
- Fix rhbz#220542, make NSS more tolerant of resets when in the 
  middle of prompting for a user password.- Update to 3.11.5
- This update fixes two security vulnerabilities with SSL 2
- Do not use -rpath link option
- Added several unsupported tools to tools package- disable ECC, cleanout dead code- Update to 3.11.4- Revert the attempt to require latest NSPR, as it is not yet available
  in the build infrastructure.- Update to 3.11.3- Add /etc/pki/nssdb- rebuild- Update to 3.11.2
- Enable executable bit on shared libs, also�x������������������X�#'fJj���������B���L1�����$����������������L1K1Ln2.moitLC_MESSAGESlibidn2.mojaLC_MESSAGESlibidn2.monlLC_MESSAGESlibidn2.moplLC_MESSAGESlibidn2.mopt_BRLC_MESSAGESlibidn2.moroLC_MESSAGESlibidn2.moruLC_MESSAGESlibidn2.mosrLC_MESSAGESlibidn2.mosvLC_MESSAGESlibidn2.moukLC_MESSAGESlibidn2.moviLC_MESSAGESlibidn2.mozh_CNLC_MESSAGESlibidn2.mo/opt/alt/libidn2/lib64//opt/alt/libidn2/share/doc//opt/alt/libidn2/share/doc/alt-libidn2-2.3.0//opt/alt/libidn2/share/licenses//opt/alt/libidn2/share/licenses/alt-libidn2-2.3.0//opt/alt/libidn2/share//opt/alt/libidn2/share/locale//opt/alt/libidn2/share/locale/cs//opt/alt/libidn2/share/locale/cs/LC_MESSAGES//opt/alt/libidn2/share/locale/da//opt/alt/libidn2/share/locale/da/LC_MESSAGES//opt/alt/libidn2/share/locale/de//opt/alt/libidn2/share/locale/de/LC_MESSAGES//opt/alt/libidn2/share/locale/eo//opt/alt/libidn2/share/locale/eo/LC_MESSAGES//opt/alt/libidn2/share/locale/es//opt/alt/libidn2/share/locale/es/LC_MESSAGES//opt/alt/libidn2/share/locale/fi//opt/alt/libidn2/share/locale/fi/LC_MESSAGES//opt/alt/libidn2/share/locale/fr//opt/alt/libidn2/share/locale/fr/LC_MESSAGES//opt/alt/libidn2/share/locale/fur//opt/alt/libidn2/share/locale/fur/LC_MESSAGES//opt/alt/libidn2/share/locale/hr//opt/alt/libidn2/share/locale/hr/LC_MESSAGES//opt/alt/libidn2/share/locale/hu//opt/alt/libidn2/share/locale/hu/LC_MESSAGES//opt/alt/libidn2/share/locale/id//opt/alt/libidn2/share/locale/id/LC_MESSAGES//opt/alt/libidn2/share/locale/it//opt/alt/libidn2/share/locale/it/LC_MESSAGES//opt/alt/libidn2/share/locale/ja//opt/alt/libidn2/share/locale/ja/LC_MESSAGES//opt/alt/libidn2/share/locale/nl//opt/alt/libidn2/share/locale/nl/LC_MESSAGES//opt/alt/libidn2/share/locale/pl//opt/alt/libidn2/share/locale/pl/LC_MESSAGES//opt/alt/libidn2/share/locale/pt_BR//opt/alt/libidn2/share/locale/pt_BR/LC_MESSAGES//opt/alt/libidn2/share/locale/ro//opt/alt/libidn2/share/locale/ro/LC_MESSAGES//opt/alt/libidn2/share/locale/ru//opt/alt/libidn2/share/locale/ru/LC_MESSAGES//opt/alt/libidn2/share/locale/sr//opt/alt/libidn2/share/locale/sr/LC_MESSAGES//opt/alt/libidn2/share/locale/sv//opt/alt/libidn2/share/locale/sv/LC_MESSAGES//opt/alt/libidn2/share/locale/uk//opt/alt/libidn2/share/locale/uk/LC_MESSAGES//opt/alt/libidn2/share/locale/vi//opt/alt/libidn2/share/locale/vi/LC_MESSAGES//opt/alt/libidn2/share/locale/zh_CN//opt/alt/libidn2/share/locale/zh_CN/LC_MESSAGES/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches   -m64 -mtune=genericcpioxz2x86_64-redhat-linux-gnu?����#��3!�ׅ���s�z����{�P�fh0�H
	�{�P�fP�:D�m)}�B$�?�;Is�M��[]���L����ԾBFW)�<���ª���F��{�j�۵�c�~ļF:ֵN4�|��n*7�>	R�a7L�>�����e�FСs�.!�XF�֑�sonnu�n�	rt�ʱg������s KX$�o���쌂�Va5T|zp�}�=S<A`6D_{��-���K��K��/���A��ٯ��If�`��w������D{e�S4_�G���j�´�J{��@^'2�H�Y�����]n*SO�<���`1p4�߇�R�M�c]$׌uY���們�R�n��dW��ٌW�� t��8?M[,�u�!8���$�K�g��Z��U�m��Ӥ��t\O�W���ͯ)o�K;XU{k�������5b~MF��*M�b�c�n�V�O?,Z�\/�^�3u�Z�|�a��h���*e0��Y��0�����n�pa{�U���H�ڎ���-�zP#R������n�~��V��T]4�We"m5��w`��W�|�J*����Pl��p��F}�3!�ׅ���s�z����{�P�fh0�H
	�{�P�f�h�`�{�ݡ������ݻ�rP��_����
�K�a�Nõ�x�T$�Yq���v��J{������72��=N���Ra��&�?�/�:�@Y����뵍Ð0���j=|�YI@�[(�:��*���Sw���ˣOh��	ib��`�0��bp>�>hL�l��a�{6��(<+j$�̬��o�4�xϏ���s0�f�z?�'��
S�Z��J�X���w�$I��K�e�H;w������֒���UX7��3��1��:��F�.��VgFͺ7Sh��m��h=.�9�n���_6�x�Xo���b7gҋ�.�����;;h坢OY4<�z?�
i7�ꩠ���xߣ�%9\;�\�[%�oxv_ m�e�Z0��u����5�����nlÊ^��\ٞ�I�,��W�2���I�ץ$�����]�+r��-���L!��"��GyI�(��l�[A�I�_���i�q�7]��46NbU���&�eS��+B�Sw^	�3<�9278ed8ed1593325171670315fb3e04691fc4493hd�:|hd�96a9440c31f00a964a1376e505b12eae3b0c44298fc1c149afbf4c8996fb92427ae41e4649b934ca495991b7852b855b27d4fe59e746ae2da363273c16c5f4fd10a3c0fde82c08f1816dd55f7�x�����X�����������X�#�fJj������������%v�����M����������������%v�
8
X?	�d��#�)�	5�	u���������	��	��$,<	D
L\`
dt������1(g8p9�:9G�H�IXY4\�]�^�b	7d	�e	�f	�l	��	�



�
D
H
Lg
Ph
TCcpanel-perl-536-extutils-helpers0.0261.cp108~el7CPAN module - Various portability utilities for module buildersCpanel build perl module 'ExtUtils::Helpers'Various portability utilities for module buildersb�ebh-centos-7.dev.cpanel.net�perlcpanel/perlhttps://metacpan.orglinuxnoarch
�"	n��$�$�$�$W���W���W���W���ca3a62bb09366a07924d59ced257e4f5427b238c766953b4bde4a328f750ac3b9ad1815332b9173772936793ce4901f8ea603b5bf19c876953fe4e7d1897bd22c03c03b146ae409c1799c036667708cc55096f66fcba6f6f1a3bf734bb0aab309fcf9f7258eef3720ae37de61d5c6ef5d59911935010b587e1af669a121231barootrootrootrootrootrootrootrootcpanel-perl-536-extutils-helpers-0.026-1.cp108~el7.src.rpm����������������cpanel-perl(ExtUtils::Helpers)cpanel-perl(ExtUtils::Helpers::Unix)cpanel-perl(ExtUtils::Helpers::VMS)cpanel-perl(ExtUtils::Helpers::Windows)cpanel-perl-536-extutils-helpers-unixcpanel-perl-536-extutils-helpers-vmscpanel-perl-536-extutils-helpers-windowscpanel-perl-extutils-helperscpanel-perl-extutils-helpers-unixcpanel-perl-extutils-helpers-vmscpanel-perl-extutils-helpers-windowscpanel-perl-536-extutils-helpers




cpanel-perl-536cpanel-perl-536-carpcpanel-perl-536-exportercpanel-perl-536-file-basenamecpanel-perl-536-file-copycpanel-perl-536-file-spec-functionscpanel-perl-536-strictcpanel-perl-536-text-parsewordscpanel-perl-536-warningsrpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(CompressedFileNames)rpmlib(PayloadIsXz)rpmlib(TildeInVersions)5.573.244.6.0-14.0-13.0.4-15.2-14.10.0-14.11.1b�@`-@W��@S>��Busy Camels <bc@cpanel.net> - 0.026-1.cp108Busy Camels <bc@cpanel.net> - 0.026-1.cp1198Todd Rinaldo <toddr@cpan.org> - 0.026-1.cp1162Todd Rinaldo <toddr@cpanel.net> - 0.022-1.cp1146- Bump to 1.cp108 for re-build- Bump to 1.cp1198 for debian re-build- Update from upstream: ExtUtils-Helpers 0.026- Update from upstream: ExtUtils-Helpers 0.0220.0260.0260.0260.0260.0260.0260.0260.0260.0260.0260.0260.026-1.cp108~el7Helpers.pmUnix.pmVMS.pmWindows.pm/usr/local/cpanel/3rdparty/perl/536/cpanel-lib/ExtUtils//usr/local/cpanel/3rdparty/perl/536/cpanel-lib/ExtUtils/Helpers/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches   -m64 -mtune=genericcpioxz2noarch-redhat-linux-gnu?���T�Ԗc_��������9Z66be340526c0c29622b1fab22201102de31b07b7c�VC#\c�VAon- rebuilt against new openssl- pear: update to XML_RPC 1.4.4, XML_Parser 1.2.7, Mail 1.1.9 (#172528)- rebuild for new libnetsnmp- update to 5.0.5
- add fix for upstream #34435
- devel: require autoconf, automake (#159283)
- pear: update to HTTP-1.3.6, Mail-1.1.8, Net_SMTP-1.2.7, XML_RPC-1.4.1
- fix imagettftext et al (upstream, #161001)- ldap: restore ldap_start_tls() function- disable RPATHs in shared extensions (#156974)- build simplexml_import_dom even with shared dom (#156434)
- prevent truncation of�x�������������������X�#�fJj�������������Nq�����&����������������NqOq�o�om v7.2.20 to v7.2.21- EA-8576: Update litespeed from upstream to 7.5- EA-8558: Update litespeed from upstream to 7.4.2- EA-8560: Update scl-php72 from v7.2.19 to v7.2.20- EA-8538: Update litespeed from upstream to 7.4- EA-8514: Update scl-php72 from v7.2.18 to v7.2.19- ZC-5062: Add PLESK signal management to PHP-FPM- EA-8427: Update scl-php72 from v7.2.17 to v7.2.18- ZC-5036: Add find-latest-version (assumes PHP is checked out next ro ea-tools)- EA-8342: Update litespeed to new upstream update of 7.3- EA-8342: Update litespeed to 7.3- Updated to version 7.2.17 via update_pkg.pl (EA-8320)- EA-8280: Update opache.ini blacklist file location to match PHP version- Updated to version 7.2.16 via update_pkg.pl (EA-8271)- Updated to version 7.2.15 via update_pkg.pl (EA-8209)- EA-7397: Compile with Argon2 support- EA-8170: Update litespeed to the latest version (7.2)- Updated to version 7.2.14 via update_pkg.pl (EA-8129)- Updated to version 7.2.13 via update_pkg.pl (EA-8044)- Updated to version 7.2.12 via update_pkg.pl (EA-7999)- EA-7957: Added ea-apache24-mod_proxy_fcgi as a dependency of php-fpm.- Updated to version 7.2.11 via update_pkg.pl (EA-7908)- Updated to version 7.2.10 via update_pkg.pl (EA-7837)- Updated to version 7.2.9 via update_pkg.pl (EA-7781)- Fixed php-fpm installing directories it does not own (EA-7526)- Updated to version 7.2.8 via update_pkg.pl (EA-7703)- Updated to version 7.2.7 via update_pkg.pl (EA-7595)- EA-7359: Ensure ea-libxml2 is listed as a requirement for the php-xml package.- Updated to version 7.2.6 via update_pkg.pl (EA-7510)- Updated to version 7.2.5 via update_pkg.pl (EA-7430)- ZC-3605: Update litespeed to the latest version (7.1).- EA-7382: Update dependency on ea-openssl to require the latest version with versioned symbols.- EA-7343: Update to v7.2.4, drop v7.2.3- ZC-3552: Added versioning to ea-openssl and ea-libcurl requirements.- ZC-3475: Update for ea-openssl shared object- Updated to version 7.2.3 via update_pkg.pl (EA-7289)- Updated to version 7.2.2 via update_pkg.pl (EA-7208)- HB-3287: Increase open file limit for php-fpm by default- HB-3263: Ensure securetmp is done before starting FPM- EA-7044: Adjust PHPs to use ea-libxml2- HB-3061: Fix epoll bug.- Updated to version 7.2.1 via update_pkg.pl (EA-7074)- EA-6764: Add back systzdata now that they have a 7.2 version- EA-6992: Update 7.2.0 dropping from RC status- EA-3099: Update 7.2.0 from RC5 to RC6- EA-6812: build PHP against ea-openssl like Apache- EA-6923: Update 7.2.0 from RC3 to RC5- EA-6866: Update mail-header patch for segfaults under Apache- EA-4653: Update mail header patch for PHP 7.2- HB-2873: Added network-online.target to "After" in the service file- EA-6819: Patch to support libtidy 5.4.0- EA-6857: Update 7.2.0 from RC1 to RC3- EA-6757: Update 7.2.0 from beta3 to RC1
- fix version specific symlinks
- remove TZ patch for now (EA-6764 may re-add a version of it)
- Add patch to fix RC1 bug  https://bugs.php.net/bug.php?id=75149 until the next version- ZC-2827: Fix SRPM scl definition (thank you to JoyceBabu for bringing this to our attention)- ZC-2785: Initial packaginghou-2 17768067357.2.34-11.13.13.cpanel7.2.34-11.13.13.cpanel7.2.34-11.13.13.cpanel7.2.34-11.13.13.cpanel20-pgsql.ini30-pdo_pgsql.inipdo_pgsql.sopgsql.so/opt/cpanel/ea-php72/root/etc/php.d//opt/cpanel/ea-php72/root/usr/lib64/php/modules/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1  -m64 -mtune=genericobs://private/EA4-production/CentOS_7/c6e55f27579a1e6cfe622dedb5b27205-scl-php72cpioxz2x86_64-redhat-linux-gnu�gж��r+��[s�p=?����W��i��#x��~�|4��*Сg��.�F�����~h1���7mK{k���"��1���8|?3��0��:�Z�d��y�	4:N�y���vc�?��^��f�Ta����C�-�vM�����S7�9|�=�;3X��B�Z����� _8�3l�w�Ĭy$��f��n^<�$��@����J�Xs��xs���:��lFC}#*�?^�˅"�"�x�������������������X�#�gJj������������������h����������������a	�,+�����=�e
�эh^�)ww�x�������������p�����X:#�fJj�������������������������r��������������������l- fix install_info
- add gcc-java build requirement- move java stuff to gettext-devel (#132239)
- add BuildRequires: gcc-c++ (#132518)
- add some missing install-info and ldconfig (#131272)
- fix dir ownership (#133696)
- run autotools for 1.9- rebuilt- use --without-included-gettext to avoid the need of libintl.so (#125497)
- remove preloadable_libintl.so- moved some of the shared lib to main pkg
- added more build requires- add conditionals for patch and requires auto* (#125216)- packaged lib files for devel
- moved some of the files to different sub-pkg
- fix problem on x86_64 build- rebuilt- rebuilt- rebuilt to 0.14.1- rebuilt 0.12.1
- fix including files and excludes some patches- rebuilt- 0.11.5- rebuilt- add online help for msghack replacement- add patch to fix gettextize (#78720)- remove unpackaged files from the buildroot- Use %{_libdir} instead of /usr/lib (#72524)- install ulonglong.m4, which is required by uintmax_t.m4, which is already
  being installed- 0.11.4- automated rebuild- automated rebuild- 0.11.2
- include some new files- Add patch to make it compile with C99 compilers (#62313)- 0.11.1- update gettext to 0.11
- disable patch4- automated rebuild- improve automake handling- Add URL
- Add automake workaround (#56081)- 0.10.40 - libintl is now LGPLed (it was GPLed). Note that RHL
  uses the glibc version, and don't include libintl from gettext.
- include new man pages
- don't include the elisp mode - bundle it into the main emacs package,
  like we do for XEmacs.
- README-alpha no longer exists, so don't list it as a doc file- Rebuild - this should fix #52463- Fix handling of multiline entries (rest of #50065)
- don't use the references of the last entry in a po file
- remove duplicates when inverting
- Own the en@quot and en@boldquot locale dirs (#52164)
- Handle entries with a first line of "" as identical to those
  without- Added "--append" and "-o" to msghack, which should address 
  initial concerns in #50065- New msghack - from scratch, in python- msghack is back- Include some docfiles- 0.10.38
- do not include charset.alias- Build statically.- 0.10.37
- Disable all but two patches- Initialize proper fonts when entering po-mode (#29152)- More fix about msgmerge.- Fix for msgmerge not to break multibyte strings
  at Japanese locale.- fixed the %lang generator to not have "./" in the lang- add an init file for the emacs po-mode
- update source URL- put gettext in /bin for initscripts use
- %langify- prereq /sbin/install-info- Added patch from Ulrich Drepper- update DESTDIR patch (#12072)- automatic rebuild- fix problems wrt to DESTDIR (#12072)- use FHS paths
- add buildroot patch for .../intl/Makefile.in, was using abs. install path- minor configure tweaks for ia64- add --comments to msghack- fix bug #9240 - gettextize has the right aclocal patch- add the --diff and --dummy options- add the --missing option to msghack- updated msghack not to merge in fuzzies in the master catalogs- updated msghack to understand --append- updated msghack to correctly deal with sorting files- msghack updates- auto rebuild in the new build environment (release 8)- added patch for misc hacks to facilitate rpm translations- patch to allow to build on ARM- add Emacs po-mode.el files.- include the aclocal support files- remove devel package (functionality is in glibc)- update to 0.10.35.- add gettextize.
- create devel package for libintl.a and libgettext.h.- translations modified for de, fr, tr- added info handling
- added misc-patch (skip emacs-lisp modofications)- removed locale.aliases as we get it from glibc now
- uses a buildroot- Built against glibc0.19.8.1-3.el7archive.dir.tar.xz/usr/share/gettext/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches   -m32 -march=x86-64 -mtune=generic -mfpmath=sse -fasynchronous-unwind-tablescpioxz2i686-redhat-linux-gnuPOSIX tar archive (GNU) (XZ compressed data)�x������������������X�#�gJj (Bi�8��������;�����S����������������;:<�neering <rel-eng@lists.fedoraproject.org> - 7.19.0-4Stepan Kasal <skasal@redhat.com> - 7.19.0-3Stepan Kasal <skasal@redhat.com> - 7.19.0-2Jeffrey C. Ollie <jeff@ocjtech.us> - 7.19.0-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 7.18.2-3Ignacio Vazquez-Abrams <ivazqueznet+rpm@gmail.com> - 7.18.2-2Jeffrey C. Ollie <jeff@ocjtech.us> - 7.18.2-1Jeffrey C. Ollie <jeff@ocjtech.us> - 7.18.1-1Fedora Release Engineering <rel-eng@fedoraproject.org> - 7.16.4-3Jeffrey C. Ollie <jeff@ocjtech.us> - 7.16.4-2Jeffrey C. Ollie <jeff@ocjtech.us> - 7.16.4-1Jeffrey C. Ollie <jeff@ocjtech.us> - 7.16.2.1-1Jeffrey C. Ollie <jeff@ocjtech.us> - 7.16.0-0.1.20061207Jeffrey C. Ollie <jeff@ocjtech.us> - 7.15.5.1-4Jeffrey C. Ollie <jeff@ocjtech.us> - 7.15.5.1-3Jeffrey C. Ollie <jeff@ocjtech.us> - 7.15.5.1-2Jeffrey C. Ollie <jeff@ocjtech.us> - 7.15.5.1-1- introduce SSLVERSION_TLSv1_[0-2] (#1260407)- fix a use-after-free bug in handling pycurl.POSTFIELDS (#1153321)- Mass rebuild 2014-01-24- Mass rebuild 2013-12-27- add the GLOBAL_ACK_EINTR constant to the list of exported symbols (#920589)- allow to return -1 from the write callback (#857875) 
- remove the patch for curl-config --static-libs no longer needed
- run the tests against the just built pycurl, not the system one- apply bug-fixes committed to upstream CVS since 7.19.0 (fixes #896025)- Rebuilt for https://fedoraproject.org/wiki/Fedora_19_Mass_Rebuild- Improve spec- Rebuilt for https://fedoraproject.org/wiki/Fedora_18_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_17_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_15_Mass_Rebuild- add Missing Requires on keyutils-libs- Add patch developed by David Malcolm to fix segfaults caused by a missing incref- Rebuilt for https://fedoraproject.org/wiki/Features/Python_2.7/MassRebuild- Package COPYING2 file
- Added MIT as a package license- Rebuilt for https://fedoraproject.org/wiki/Fedora_12_Mass_Rebuild- fix typo in the previous change- add a require to reflect a dependency on libcurl version (#496308)- Update to 7.19.0- Rebuilt for https://fedoraproject.org/wiki/Fedora_11_Mass_Rebuild- Rebuild for Python 2.6- Update to 7.18.2
- Thanks to Ville Skyttä re-enable the tests and fix a minor problem
  with the setup.py. (Bug # 45400)- Update to 7.18.1
- Disable tests because it's not testing the built library, it's trying to
  test an installed library.- Autorebuild for GCC 4.3- BR openssl-devel- Update to 7.16.4
- Update license tag.- Update to released version.- Update to a CVS snapshot since development has a newer version of curl than is in FC <= 6- Add -DHAVE_CURL_OPENSSL to fix PPC build problem.- Don't forget to Provide: pycurl!!!- Remove INSTALL from the list of documentation
- Use python_sitearch for all of the files- First version for Fedora Extras	

 !"#$%&'()*+,-./0123456787.19.0-19.el77.19.0-19.el77.19.0-19.el7curl__init__.py__init__.pyc__init__.pyopycurl-7.19.0-py2.7.egg-infopycurl.sopython-pycurl-7.19.0COPYINGCOPYING2ChangeLogREADMETODOdoccallbacks.htmlcurlmultiobject.htmlcurlobject.htmlcurlshareobject.htmlpycurl.htmlexamplesbasicfirst.pyfile_upload.pylinksys.pyretriever-multi.pyretriever.pysfquery.pyxmlrpc_curl.pyteststest.pytest_cb.pytest_debug.pytest_ftp.pytest_getinfo.pytest_gtk.�x�������������`�����X+#ofJj������������8����Zx�����2����������������Zx�0ment of ea-libtidy instead of .so from BuildRequires ea-libtidy-devel- EA-5839: Add opcache.validate_permission to opcache ini- EA-5807: enable php-tidy on rhel 6 and above- Updated to version 7.1.1 via update_pkg.pl (EA-5876)- EA-5784: Remove no longer unused rcver- Update for final PHP 7.1.0- EA-3685: do not create apache user/group since we use nobody- Fix erronous getpwnam message in php-fpm jailshell code- Ensure the same extensions are compiled statically across all
  SAPI types (EA-5587)- Make php-cli require php-litespeed- Updated to PHP 7.1 (release candidate 6) sources- Updated to PHP 7.1 (release candidate 3) sources- Set register_argc_argv default on to match EasyApache 3- Updated to PHP 7.1 (release candidate 2) sources- Changed php-fpm.d directory to 0710 (EA-5097)- Updated to PHP 7.1 (beta3) sources- Updated to PHP 7.1 (beta) sources
- Added php imap support
- Applied fpm and updated mail header patches* Mon Jun 27 2016 Daniel Muey <dan@cpanel.net> - 7.0.8-1
- Updated to version 7.0.8 via update_pkg.pl (EA-4738)
- Remove opcache check since it was removed in d41920c (EA-4755)hou-2 17768067447.1.33-19.20.13.cpanel7.1.33-19.20.13.cpanel20-gettext.inigettext.so/opt/cpanel/ea-php71/root/etc/php.d//opt/cpanel/ea-php71/root/usr/lib64/php/modules/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1  -m64 -mtune=genericobs://private/EA4-production/CentOS_7/4e423398dde7813bc4c93e06e592f28e-scl-php71cpioxz2x86_64-redhat-linux-gnu�pH���u���@�J��?����|��i��#x��~�|�\�I��2:�"�)m�wf�ljG��� yp&�����ѕ��H�E��yg��D~j�#��ͣ�P��;�y���,���D�ܧ�j1d�M*�u4s���+�$�`&�E	������k���`֯]��+=k0�i�����կ���׻	�׼�S�(Ȁ�e��b����̮o���<ܩÈ��a��m�V��M��S71�-ع��j���}�ez ��qD^`
=��gL\\�������4��~��
�Bp���E��7��a⽢*h&k9�믤o&��>�k��8��vQ�����`i�9-�=��.p�\���c���di�t��0O��7���W(B=����mۊ��;r�j��Fr˗�>��E-���3F}�H��I��4�Clkg��E�:��Ye�$ҏ{��D�пS�O�� �(cZI|�#��BL��J��V�%
�>�x@5��O��+�2� 2���Ǩ������E\	�ŗ8��`�G��d�7'�}-�놿0��Xb�=Pzyc����S�_��H�.:Ӊi��#x��~�|q��!Av��\���p��nP�����T~��S?���Lf<3�W<���$pF�֬CD��[�u��]��a���5�n���Ɓs��������)��<��f�uvs�uP��0�բJ�>������-�]đ6��ZLf��؃�$�k�0����[ͷ�?W���h;D�[�h���\Ych��hD�Go:����!ѧ�$N����1&Q�z����Bɳ�ܬb�x����{>�%9��,e�
�sj�����h�=��6,��Qď{ $_̳�p"P������O�[Ī�O�3/�'����\����??'�d[��?�N�����|}�,���u�u��;��K��Y:�u��L��DM�8 �T,m�b6�/ٞ����&�i�h=k����о�q��1
ܦ`��U�"��A�^60�=���:�:
�����=��< h�!���4G��(7&Tp?q(�$�:�7wOu�םYt)�;,O8Y�����m��<$A]f9ae5802674d1b48bdd6ad2db7e7090c8915832di�Y�i�F]
- [kernel] livepatch: Remove reliable stacktrace check in klp_try_switch_task() (Joe Lawrence) [1719948]
- [documentation] livepatch: Remove not longer valid limitations from the documentation (Joe Lawrence) [1719948]
- [documentation] Doc: Fix double words in Documentation (Joe Lawrence) [1719948]
- [documentation] Documentation: livepatch: add section about arch-specific code (Joe Lawrence) [1719948]
- [documentation] Documentation: livepatch: outline Elf format and requirements for patch modules (Joe Lawrence) [1719948]
- [ipc] ipc: drop non-RCU allocation (Vladis Dronov) [1733016]
- [ipc] ipc/util.c: use kvfree() in ipc_rcu_free() (Vladis Dronov) [1733016]
- [ipc] tree wide: use kvfree() than conditional kfree()/vfree() (Vladis Dronov) [1733016]
- [ipc] do cyclic id allocation for the ipc object (Waiman Long) [1373519]
- [ipc] conserve sequence numbers in ipcmni_extend mode (Waiman Long) [1373519]
- [ipc] allow boot time extension of IPCMNI from 32k to 16M (Waiman Long) [1373519]
- [ipc] IPCMNI limit check for semmni (Waiman Long) [1373519]
- [ipc] IPCMNI limit check for msgmni and shmmni (Waiman Long) [1373519]
- [ipc] util.c: further variable name cleanups (Waiman Long) [1373519]
- [ipc] reorganize in�x�������������ؗ����X�#�fJjo 1.Q����
4�����e����������������
444���������������������������������������bcbc(x86-64)	@@@@@@@@@


@
/bin/sh/bin/sh/sbin/install-info/sbin/install-infolibc.so.6()(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.3)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libncurses.so.5()(64bit)libreadline.so.6()(64bit)libtinfo.so.5()(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rtld(GNU_HASH)rpmlib(PayloadIsXz)3.0.4-14.6.0-14.0-15.2-14.11.1R�U�R�k�RL
�Q��Q�@P��@P�@O�@N��@Nh�@MO�M�@J�_@J�:�Ji�@I���G�@G~�Gbp@GY5�F�F�%@F���E��E��E��@E���E��@D��@D�n@C�@C�C�q�C���A�@Af�@@��@,�@?;y�>��>��@>.��=�(�=@<��<{x�<^w�<<0�;�Y�:��@:��@:'��:��9x;@9l]�9<�9O@8�|@8�A�8�X�8���6��@6��5��5z��5v�@5@~�5<�@5'r@4D�@4�@3���Daniel Mach <dmach@redhat.com> - 1.06.95-13Daniel Mach <dmach@redhat.com> - 1.06.95-12Frantisek Kluknavsky <fkluknav@redhat.com> - 1.06.95-11Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.06.95-10Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.06.95-9Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.06.95-8Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.06.95-7Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.06.95-6Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.06.95-5Ondrej Vasik <ovasik@redhat.com> 1.06.95-4Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.06.95-3Ondrej Vasik <ovasik@redhat.com> 1.06.95-2Ondrej Vasik <ovasik@redhat.com> 1.06.95-1Zdenek Prikryl <zprikryl@redhat.com> 1.06-36Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.06-35Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.06-34Fedora Release Engineering <rel-eng@fedoraproject.org> - 1.06-33Zdenek Prikryl <zprikryl@redhat.com> 1.06-32Stepan Kasal <skasal@redhat.com> 1.06-31Zdenek Prikryl <zprikryl@redhat.com> 1.06-30Zdenek Prikryl <zprikryl@redhat.com> 1.06-29Zdenek Prikryl <zprikryl@redhat.com> 1.06-28Zdenek Prikryl <zprikryl@redhat.com> 1.06-27Thomas Woerner <twoerner@redhat.com> 1.06-26Karsten Hopp <karsten@redhat.com> 1.06-25Karsten Hopp <karsten@redhat.com> 1.06-24Florian La Roche <laroche@redhat.com>Thomas Woerner <twoerner@redhat.com> 1.06-22Jesse Keating <jkeating@redhat.com> - 1.06-21Thomas Woerner <twoerner@redhat.com> 1.06-20Jesse Keating <jkeating@redhat.com> - 1.06-19.2.1Jesse Keating <jkeating@redhat.com> - 1.06-19.2Jesse Keating <jkeating@redhat.com>Thomas Woerner <twoerner@redhat.com> 1.06-19Tim Waugh <twaugh@redhat.com> 1.06-18Thomas Woerner <twoerner@redhat.com> 1.06-17.1Elliot Lee <sopwith@redhat.com>Elliot Lee <sopwith@redhat.com>Thomas Woerner <twoerner@redhat.com> 1.06-15Thomas Woerner <twoerner@redhat.com> 1.06-14Elliot Lee <sopwith@redhat.com>Tim Powers <timp@redhat.com>Tim Powers <timp@redhat.com> 1.06-11Tim Powers <timp@redhat.com>Tim Powers <timp@redhat.com>Trond Eivind Glomsrød <teg@redhat.com> 1.06-8Trond Eivind Glomsrød <teg@redhat.com> 1.06-7Tim Powers <timp@redhat.com>Phil Knirsch <phil@redhat.de> 1.06-5Preston Brown <pbrown@redhat.com> 1.06-4Bernhard Rosenkraenzer <bero@redhat.com> 1.06-3Trond Eivind Glomsrød <teg@redhat.com>Florian La Roche <Florian.LaRoche@redhat.de>Trond Eivind Glomsrød <teg@redhat.com>Prospector <bugzilla@redhat.com>Trond Eivind Glomsrød <teg@redhat.com>Trond Eivind Glomsrød <teg@redhat.com>Trond Eivind Glomsrød <teg@redhat.com>Bernhard Rosenkraenzer <bero@redhat.com>Bernhard Rosenkraenzer <bero@redhat.com>Bill Nottingham <notting@redhat.com>Cristian Gafton <gafton@redhat.com> Jeff Johnson <jbj@redhat.com>Jeff Johnson <jbj@redhat.com>Prospector System <bugs@redhat.com>Jeff Johnson <jbj@redhat.com>Prospector System <bugs@redhat.com>Erik Troan <ewt@redhat.com>Erik Troan <ewt@redhat.com>Donnie Barnes <djb@redhat.com>Donald Barnes <djb@redhat.com>Erik Troan <ewt@redhat.com>- Mass rebuild 2014-01-24- M�x�������������P�����X�#�gJj����������������r�����#�����������������r�T[�� functionality since CentOS does not provide dtrace via repos.- EA-6203: Correct OpCache blacklist directory- EA-6031: Enable mssql option and use our ea-freetds instead of freetds- ZC-2475: PHPs need build reqs when building for libcurl- EA-2422: Have PHPs use our ea-libcurl- EA-5946: force requirement of ea-libtidy instead of .so from BuildRequires ea-libtidy-devel- EA-5839: Add opcache.validate_permission to opcache ini- EA-5807: enable php-tidy on rhel 6 and above- EA-3685: do not create apache user/group since we use nobody- Fix erronous getpwnam message in php-fpm jailshell code- Ensure the same extensions are compiled statically across all
  SAPI types (EA-5587)- Make php-cli require php-litespeed- Set register_argc_argv default on to match EasyApache 3- Force users on jailshell and noshell to be chrooted when using php-fpm- Changed php-fpm.d directory to 0710 (EA-5097)- update PHP 5.5 to release 5.5.38 (EA-4886)- Apply previous patch code in spec file- PHP-FPM + .user.ini allows code execution as other users- Updated to version 5.5.37 via update_pkg.pl (EA-4730)- EA-4383: Update Release value to OBS-proof versioning- Removed unused global wsdl and session cache directories (EA-4691)- Added EasyApache 3 backwards compatibility php.ini patch (EA-4664)- Enabled PHP-Litespeed package- Updated to version 5.5.36 via update_pkg.pl (EA-4624)- Updated to version 5.5.35 via update_pkg.pl (EA-4483)- Now uses bundled gd (ZC-1563)
- Updated descriptions to use scl_prefix macros (like php7)- Updated to version 5.5.34 via update_pkg.pl (EA-4397)- Updated to version 5.5.33 via update_pkg.pl (EA-4218)- mod_php adjusted to conflict with other mod_php versions, and
  not itself.  this lets the user reinstall the package without
  conflict. (ZC-1459)- Added imap extension for all CentOS versions.  It now depends on
  our internal SCL libc-client package.- Updated to version 5.5.32 via update_pkg.pl (EA-4127)- Improve DSO conflicts (EA-3751)- Updated to version 5.5.31 via update_pkg.pl (EA-4050)- mod_php requires a non-threaded Apache mpm (EA-3982)- Enabled short_open_tags (ZC-1284)- Disable ZTS support (EA-3791)- make ea-php5x-php-fpm depend on ea-php5X-php-cli (EA-3836)- Rename www.conf to www.conf.example (ZC-1205)- Use libphp5.so as module name for simplicity/consistency (EA-3750)- Updated to version 5.5.30 via update_pkg.pl- Updated to version 5.5.29 via update_pkg.pl- Updated to version 5.5.28 via update_pkg.pl- Enabled mcrypt for all builds- Moved "ea-php-cli" to correct package- Added ea-php-cli requirement- Fix macros.php syntax error- Change ea-apache2 to ea-apache24- Set imap and recode to be incompatible
- developer version of opcache.ini is distributed instead of auto-gen- Updated to PHP 5.5.22
- Made compatible with EA web server namespace- Added back in the upstream archive, replaced the excised JSON- fileinfo: fix out-of-bounds read in elf note headers. CVE-2014-3710- xmlrpc: fix out-of-bounds read flaw in mkgmtime() CVE-2014-3668
- core: fix integer overflow in unserialize() CVE-2014-3669
- exif: fix heap corruption issue in exif_thumbnail() CVE-2014-3670- gd: fix NULL pointer dereference in gdImageCreateFromXpm().
  CVE-2014-2497
- gd: fix NUL byte injection in file names. CVE-2014-5120
- core: fix heap-based buffer overflow in DNS TXT record
  parsing. CVE-2014-4049
- network: fix segfault in dns_get_record
  (incomplete fix for CVE-2014-4049). CVE-2014-3597
- core: unserialize() SPL ArrayObject / SPLObjectStorage
  type confusion flaw. CVE-2014-3515
- core: type confusion issue in phpinfo(). CVE-2014-4721
- spl: fix use-after-free in ArrayIterator due to object
  change during sorting. CVE-2014-4698
- spl: fix use-after-free in SPL Iterators. CVE-2014-4670
- fileinfo: cdf_unpack_summary_info() excessive looping
  DoS. CVE-2014-0237
- fileinfo: CDF property info parsing nelements infinite
  loop. CVE-2014-0238
- fileinfo: cdf_read_short_sector insufficient boundary
  check. CVE-2014-0207
- fileinfo: fix extensive backtracking in regular e�x��������������v����X8#�gJj ������� ������������������������������������ai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 2.2.13-1Nalin Dahyabhai <nalin@redhat.com> 2.2.13-0Nalin Dahyabhai <nalin@redhat.com> 2.1.30-1Elliot Lee <sopwith@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 2.1.30-0Thomas Woerner <twoerner@redhat.com> 2.1.29-3Nalin Dahyabhai <nalin@redhat.com> 2.1.29-2Nalin Dahyabhai <nalin@redhat.com> 2.1.29-1Nalin Dahyabhai <nalin@redhat.com> 2.1.29-0Nalin Dahyabhai <nalin@redhat.com>Elliot Lee <sopwith@redhat.com> 2.1.25-5.1Tim Waugh <twaugh@redhat.com> 2.1.25-5Elliot Lee <sopwith@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 2.1.25-4Nalin Dahyabhai <nalin@redhat.com> 2.1.25-3Nalin Dahyabhai <nalin@redhat.com> 2.1.25-2Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 2.1.25-1Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Jeff Johnson <jbj@jbj.org> 2.1.22-9Nalin Dahyabhai <nalin@redhat.com> 2.1.22-8Nalin Dahyabhai <nalin@redhat.com> 2.1.22-7Nalin Dahyabhai <nalin@redhat.com>Jeff Johnson <jbj@jbj.org> 2.1.22-6.1Nalin Dahyabhai <nalin@redhat.com> 2.1.22-6Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 2.1.22-5Nalin Dahyabhai <nalin@redhat.com> 2.1.22-4Nalin Dahyabhai <nalin@redhat.com> 2.1.22-3Nalin Dahyabhai <nalin@redhat.com> 2.1.22-2Nalin Dahyabhai <nalin@redhat.com> 2.1.22-1Nalin Dahyabhai <nalin@redhat.com> 2.1.22-0Nalin Dahyabhai <nalin@redhat.com>Elliot Lee <sopwith@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 2.1.21-1Nalin Dahyabhai <nalin@redhat.com> 2.1.20-1Nalin Dahyabhai <nalin@redhat.com> 2.1.19-1Nalin Dahyabhai <nalin@redhat.com> 2.1.17-1Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 2.0.27-8Tim Powers <timp@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 2.0.27-6Nalin Dahyabhai <nalin@redhat.com> 2.0.27-5Nalin Dahyabhai <nalin@redhat.com> 2.0.27-4Nalin Dahyabhai <nalin@redhat.com> 2.0.27-3Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 2.0.27-2Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 2.0.27-1Nalin Dahyabhai <nalin@redhat.com> 2.0.26-1Nalin Dahyabhai <nalin@redhat.com> 2.0.25-2Nalin Dahyabhai <nalin@redhat.com> 2.0.25-1Nalin Dahyabhai <nalin@redhat.com> 2.0.23-5Nalin Dahyabhai <nalin@redhat.com> 2.0.23-3Nalin Dahyabhai <nalin@redhat.com> 2.0.23-2Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 2.0.23-1Nalin Dahyabhai <nalin@redhat.com> 2.0.22-2Nalin Dahyabhai <nalin@redhat.com> 2.0.22-1Florian La Roche <Florian.LaRoche@redhat.de> 2.0.21-5Nalin Dahyabhai <nalin@redhat.com> 2.0.21-4Nalin Dahyabhai <nalin@redhat.com> 2.0.21-3Nalin Dahyabhai <nalin@redhat.com> 2.0.21-2Nalin Dahyabhai <nalin@redhat.com> 2.0.20-2Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 2.0.20-0.7Nalin Dahyabhai <nalin@redhat.com> 2.0.20-1Nalin Dahyabhai <nalin@redhat.com> 2.0.19-1Nalin Dahyabhai <nalin@redhat.com> 2.0.18-2Nalin Dahyabhai <nalin@redhat.com> 2.0.18-1Nalin Dahyabhai <nalin@redhat.com> 2.0.17-1Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com> 2.0.15-2Nalin Dahyabhai <nalin@redhat.com> 2.0.15-1Nalin Dahyabhai <nalin@redhat.com> 2.0.14-1Nalin Dahyabhai <nalin@redhat.com> 2.0.12-1Nalin Dahyabhai <nalin@redhat.com> 2.0.11-13Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Than Ngo <than@redhat.com> 2.0.11-6Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <n�x�������������@f����X�#gJjppc Ȯ��������������\�������������������E��� support, fix huge memory consumption #1075201- fix patch name
- fix memory leak introduce in patch for CVE-2014-1943
- fix heap-based buffer over-read in DateInterval CVE-2013-6712- fix infinite recursion in fileinfo CVE-2014-1943- fix heap overflow vulnerability in imagecrop CVE-2013-7226- allow multiple paths in ini_scan_dir #1058161- add security fix for CVE-2013-6420- rebuild- rebuild with test enabled
- add dependency on php-pecl-jsonc- update to PHP 5.5.6
- buildstrap build- update to PHP 5.5.5
- mod_php only for httpd24- update to PHP 5.5.4
- improve security, use specific soap.wsdl_cache_dir
  use /var/lib/php/wsdlcache for mod_php and php-fpm
- sync short_tag comments in php.ini with upstream
- relocate RPM macro- update to PHP 5.5.3
- improve system libzip patch
- fix typo and add missing entries in php.ini- update to PHP 5.5.1 for php55 SCL- rebuild for new httpd-mmn value- remove ZTS conditional stuf for ligibility
- add mod_php for apache 2.4 (from httpd24 collection)- improve mod_php, pgsql and ldap description
- add missing man pages (phar, php-cgi)
- add provides php(pdo-abi) for consistency with php(api) and php(zend-abi)
- use %__isa_bits instead of %__isa in ABI suffix #985350- add security fix for CVE-2013-4113
- add missing ASL 1.0 license- run tests during build- rebase to 5.4.16
- fix hang in FindTishriMolad(), #965144
- patch for upstream Bug #64915 error_log ignored when daemonize=0
- patch for upstream Bug #64949 Buffer overflow in _pdo_pgsql_error, #969103
- patch for upstream bug #64960 Segfault in gc_zval_possible_root- remove wrappers in /usr/bin (#966407)- rebuild for libjpeg (instead of libjpeg_turbo)
- fix unowned dir %{_datadir}/fpm and %{_libdir}/httpd (#956221)- update to 5.4.14
- clean old deprecated options- update to 5.4.13
- security fixes for CVE-2013-1635 and CVE-2013-1643
- make php-mysql package optional (and disabled)
- make ZTS build optional (and disabled)
- always try to load mod_php (apache warning is usefull)
- Hardened build (links with -z now option)
- Remove %config from /etc/rpm/macros.php- update to 5.4.11
- fix php.conf to allow MultiViews managed by php scripts- update to 5.4.10
- remove patches merged upstream
- drop "Configure Command" from phpinfo output
- prevent php_config.h changes across (otherwise identical)
  rebuilds- update to 5.4.9- fix php.conf- filter private shared in _httpd_modir
- improve system libzip patch to use pkg-config
- use _httpd_contentdir macro and fix php.gif path
- switch back to upstream generated scanner/parser
- use system pcre only when recent enough- improves php.conf, no need to be relocated- clarify Licenses
- missing provides xmlreader and xmlwriter
- change php embedded library soname version to 5.4- fix mysql_sock macro definition- fix standard build (non scl)- fix installed headers- use libldap_r for ldap extension- add missing scl_prefix in some provides/requires- make php-enchant optionnal, not available on RHEL-5
- make php-recode optionnal, not available on RHEL-5
- disable t1lib on RHEL-5- enable tidy on RHEL-6 only
- re-enable unit tests- minor macro fixes for RHEL-5 build
- update autotools workaround for RHEL-5
- use readline when libedit not available (RHEL-5)- update to 5.4.8
- define both session.save_handler and session.save_path
- fix possible segfault in libxml (#828526)
- use SKIP_ONLINE_TEST during make test
- php-devel requires pcre-devel and php-cli (instead of php)
- provides php-phar
- update systzdata patch to v10, timezone are case insensitive- php-fpm: create apache user if needed
- php-cli: provides cli command in standard root (scl)- add configtest option to init script
- test configuration before service reload
- fix php-fpm service relocation
- fix php-fpm config relocation
- drop embdded subpackage for scl- missing requires on scl-runtime
- relocate /var/lib/session
- fix php-devel requires
- rename, but don't relocate macros.php- initial spec rewrite for scl build- fix typo in systemd macro- php-fpm: enable PrivateTmp
- php-fp�x��������������U����X1#KeJj�����������������wV���������������������wVvVxV� rhbz#1361636
- Allow modemmanager chat with systemd_logind via dbus
Resolves: rhbz#1362273
- Allow NetworkManager chat with puppetagent via dbus
Resolves: rhbz#1363989
- Allow NetworkManager chat with kdumpctl via dbus
Resolves: rhbz#1363977
- Allow sbd send msgs to syslog Allow sbd create dgram sockets. Allow sbd to communicate with kernel via dgram socket Allow sbd r/w kernel sysctls.
Resolves: rhbz#1322725
- Allow ipmievd_t domain to re-create ipmi devices Label /usr/libexec/openipmi-helper as ipmievd_exec_t
Resolves: rhbz#1349058
- Allow rasdaemon to use tracefs filesystem.
Resolves: rhbz#1364380
- Fix typo bug in dirsrv policy
- Some logrotate scripts run su and then su runs unix_chkpwd. Allow logrotate_t domain to check passwd.
Resolves: rhbz#1283134
- Add ipc_lock capability to sssd domain. Allow sssd connect to http_cache_t
Resolves: rhbz#1362688
- Allow dirsrv to read dirsrv_share_t content
Resolves: rhbz#1363662
- Allow virtlogd_t to append svirt_image_t files.
Resolves: rhbz#1358140
- Allow hypervkvp domain to read hugetlbfs dir/files.
Resolves: rhbz#1349356
- Allow mdadm daemon to read nvme_device_t blk files
Resolves: rhbz#1362564
- Allow selinuxusers and unconfineduser to run oddjob_request
Resolves: rhbz#1361636
- Allow sshd server to acces to Crypto Express 4 (CEX4) devices.
Resolves: rhbz#1362539
- Fix labeling issue in init.fc file. Path /usr/lib/systemd/fedora-* changed to /usr/lib/systemd/rhel-*.
Resolves: rhbz#1363769
- Fix typo in device interfaces
Resolves: rhbz#1349058
- Add interfaces for managing ipmi devices
Resolves: rhbz#1349058
- Add interfaces to allow mounting/umounting tracefs filesystem
Resolves: rhbz#1364380
- Add interfaces to allow rw tracefs filesystem
Resolves: rhbz#1364380
- Add interface dev_read_nvme() to allow reading Non-Volatile Memory Host Controller devices.
Resolves: rhbz#1362564
- Label /sys/kernel/debug/tracing filesystem
Resolves: rhbz#1364380
- Allow sshd setcap capability. This is needed due to latest changes in sshd
Resolves: rhbz#1357857- Dontaudit mock_build_t can list all ptys.
Resolves: rhbz#1271209
- Allow ftpd_t to mamange userhome data without any boolean.
Resolves: rhbz#1097775
- Add logrotate permissions for creating netlink selinux sockets.
Resolves: rhbz#1283134
- Allow lsmd_plugin_t to exec ldconfig.
Resolves: rhbz#1238066
- Allow vnstatd domain to read /sys/class/net/ files
Resolves: rhbz#1358243
- Remove duplicate allow rules in spamassassin SELinux module
Resolves:rhbz#1358175
- Allow spamc_t and spamd_t domains create .spamassassin file in user homedirs
Resolves:rhbz#1358175
- Allow sshd setcap capability. This is needed due to latest changes in sshd
Resolves: rhbz#1357857
- Add new MLS attribute to allow relabeling objects higher than system low. This exception is needed for package managers when processing sensitive data.
Resolves: rhbz#1330464
- Allow gnome-keyring also manage user_tmp_t sockets.
Resolves: rhbz#1257057
- corecmd: Remove fcontext for /etc/sysconfig/libvirtd
Resolves:rhbz#1351382- Allow ipa_dnskey domain to search cache dirs
Resolves: rhbz#1350957- Allow ipa-dnskey read system state.
Reasolves: rhbz#1350957
- Allow dogtag-ipa-ca-renew-agent-submit labeled as certmonger_t to create /var/log/ipa/renew.log file
Resolves: rhbz#1350957- Allow firewalld to manage net_conf_t files.
Resolves:rhbz#1304723
- Allow logrotate read logs inside containers.
Resolves: rhbz#1303514
- Allow sssd to getattr on fs_t
Resolves: rhbz#1356082
- Allow opendnssec domain to manage bind chace files
Resolves: rhbz#1350957
- Fix typo in rhsmcertd  policy module
Resolves: rhbz#1329475
- Allow systemd to get status of systemd-logind daemon
Resolves: rhbz#1356141
- Label more ndctl devices not just ndctl0
Resolves: rhbz#1355809- Allow rhsmcertd to copy certs into /etc/docker/cert.d
- Add interface docker_rw_config()
Resolves: rhbz#1344500
- Fix logrotate fc file to label also /var/lib/logrotate/ dir as logrotate_var_lib_t
Resolves: rhbz#1355632
- Allow rhsmcertd to read network sysctls
Resolves: rhbz#1329475
- Label /var/log/graphite-w�x�������������0E����X�#�gJj��������U���AJ�����)����������������AJ@J9J�re <cory@cpanel.net> - 8.0.24-1Julian Brown <julian.brown@cpanel.net> - 8.0.23-3Dan Muey <dan@cpanel.net> - 8.0.23-2Cory McIntire <cory@cpanel.net> - 8.0.23-1Cory McIntire <cory@cpanel.net> - 8.0.22-1Cory McIntire <cory@cpanel.net> - 8.0.21-1Cory McIntire <cory@cpanel.net> - 8.0.20-1Cory McIntire <cory@cpanel.net> - 8.0.19-1Cory McIntire <cory@cpanel.net> - 8.0.18-1Cory McIntire <cory@cpanel.net> - 8.0.17-1Travis Holloway <t.holloway@cpanel.net> - 8.0.16-2Cory McIntire <cory@cpanel.net> - 8.0.16-1Cory McIntire <cory@cpanel.net> - 8.0.15-1Julian Brown <julian.brown@cpanel.net> - 8.0.14-5Dan Muey <dan@cpanel.net> - 8.0.14-4Julian Brown <julian.brown@cpanel.net> - 8.0.14-3Julian Brown <julian.brown@cpanel.net> - 8.0.14-2Cory McIntire <cory@cpanel.net> - 8.0.14-1Cory McIntire <cory@cpanel.net> - 8.0.13-1Dan Muey <dan@cpanel.net> - 8.0.12-2Cory McIntire <cory@cpanel.net> - 8.0.12-1Tim Mullin <tim@cpanel.net> - 8.0.11-4Julian Brown <julian.brown@cpanel.net> - 8.0.11-3Cory McIntire <cory@cpanel.net> - 8.0.11-2Cory McIntire <cory@cpanel.net> - 8.0.11-1Travis Holloway <t.holloway@cpanel.net> - 8.0.10-1Cory McIntire <cory@cpanel.net> - 8.0.9-1Julian Brown <julian.brown@webpros.com> - 8.0.8-2Travis Holloway <t.holloway@cpanel.net> - 8.0.8-1Travis Holloway <t.holloway@cpanel.net> - 8.0.7-2Cory McIntire <cory@cpanel.net> - 8.0.7-1Cory McIntire <cory@cpanel.net> - 8.0.6-1Cory McIntire <cory@cpanel.net> - 8.0.5-1Cory McIntire <cory@cpanel.net> - 8.0.3-2Cory McIntire <cory@cpanel.net> - 8.0.3-1Cory McIntire <cory@cpanel.net> - 8.0.2-1Tim Mullin <tim@cpanel.net> - 8.0.1-1Daniel Muey <dan@cpanel.net> - 8.0.0-2Daniel Muey <dan@cpanel.net> - 8.0.0-1Julian Brown <julian.brown@cpanel.net> - 8.0.0rc4-5Daniel Muey <dan@cpanel.net> - 8.0.0rc4-4Daniel Muey <dan@cpanel.net> - 8.0.0rc4-3Daniel Muey <dan@cpanel.net> - 8.0.0rc4-2Daniel Muey <dan@cpanel.net> - 8.0.0rc4-1Daniel Muey <dan@cpanel.net> - 8.0.0rc3-5Tim Mullin <tim@cpanel.net> - 8.0.0rc3-3Daniel Muey <dan@cpanel.net> - 8.0.0rc3-2Daniel Muey <dan@cpanel.net> - 8.0.0rc3-1Daniel Muey <dan@cpanel.net> - 8.0.0beta4-2Daniel Muey <dan@cpanel.net> - 8.0.0beta4-1Julian Brown <julian.brown@cpanel.net> - 8.0.0alpha3-2Julian Brown <julian.brown@cpanel.net> - 8.0.0alpha3-1- EA4-230: Use system libxml2 in PHP 8.0- EA4-136: Fix libxml2 v2.15.0 compatibility- ZC-12495: Do gcc like newer PHPs so that the libicu update won’t break the build- ZC-12246: Correct conffiles for Ubuntu- ZC-12153: make opcache INI a configfile for debs- ZC-12114: Apply fix for libxml2- EA-10753: Have snmp module require 'snmp-mibs-downloader' for deb- EA-11821: Patch to build with the latest ea-libxml2- ZC-11419: Correct Ubuntu Build issues- EA-11590: Update ea-php80 from v8.0.29 to v8.0.30
	- Libxml:
		Fixed bug GHSA-3qrf-m4j2-pcrr (Security issue with external entity loading in XML without enabling it). (CVE-2023-3823)
	- Phar:
		Fixed bug GHSA-jqcx-ccgc-xwhv (Buffer mismanagement in phar_dir_read()). (CVE-2023-3824)- EA-11475: Update ea-php80 from v8.0.28 to v8.0.29
    - Fixed bug GHSA-76gg-c692-v2mw
        (Missing error check and insufficient random bytes in HTTP Digest authentication for SOAP).- EA-11447: Increase default php memory_limit for new installs from 32M to 128M- ZC-10931: Link statically with libc-client- ZC-10950: Fix build problems- ZC-10936: Clean up Makefile and remove debug-package-nil- ZC-10873: Simplify the libidn deps, for building on Ubunut 20 and 22- EA-11227: Update ea-php80 from v8.0.27 to v8.0.28
- Fixed bug #81744 (Password_verify() always return true with some hash). (CVE-2023-0567)
- Fixed bug #81746 (1-byte array overrun in common path resolve code). (CVE-2023-0568)
- Fixed bug GHSA-54hq-v5wp-fqgv (DOS vulnerability when parsing multipart request body). (CVE-2023-0662)- EA-11075: Correct default value description for log_errors in php.ini- EA-11137: Update ea-php80 from v8.0.26 to v8.0.27
- PDO::quote() may return unquoted string). (CVE-2022-31631)- EA-11074: Update ea-php80 from v8.0.25 to v8.0.26�x��������������4����Xb#�eJj�������������}����L����������������������L0?�ython38	

1.6.0-2.el7distrodistro.cpython-38.opt-1.pycdistro.cpython-38.pycdistro-1.6.0-py3.8.egg-infoPKG-INFOSOURCES.txtdependency_links.txtentry_points.txttop_level.txtdistro.pyalt-python38-distro-1.6.0CHANGELOG.mdCONTRIBUTORS.mdREADME.mdalt-python38-distro-1.6.0LICENSE/opt/alt/python38/bin//opt/alt/python38/lib/python3.8/site-packages/__pycache__//opt/alt/python38/lib/python3.8/site-packages//opt/alt/python38/lib/python3.8/site-packages/distro-1.6.0-py3.8.egg-info//opt/alt/python38/share/doc//opt/alt/python38/share/doc/alt-python38-distro-1.6.0//opt/alt/python38/share/licenses//opt/alt/python38/share/licenses/alt-python38-distro-1.6.0/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches   -m64 -mtune=genericcpioxz2noarch-redhat-linux-gnuPython script, ASCII text executabledirectoryASCII textR?���pPo�K����f0;�ޯ�k�]!��gdcW&���K�U�b��qf{�#
	�U�b��qSI�Hʪ��f[�'_�\����	�Rޱ����gu�C�cX��]!��gdcW&���K�U�b��qf{�#
	�U�b��q���l!�|T@��T��j�]#��2�U�2b��w��P����PE969c3c5a6d635391bdf70a0b3e98c7ea5103fdc5f��6�(f��6-toolkit/plib/vendor/aws/aws-sdk-php/src/data/ssm-incidents//usr/local/cpanel/3rdparty/wp-toolkit/plib/vendor/aws/aws-sdk-php/src/data/ssm-incidents/2018-05-10//usr/local/cpanel/3rdparty/wp-toolkit/plib/vendor/aws/aws-sdk-php/src/data/ssm-sap//usr/local/cpanel/3rdparty/wp-toolkit/plib/vendor/aws/aws-sdk-php/src/data/ssm-sap/2018-05-10//usr/local/cpanel/3rdparty/wp-toolkit/plib/vendor/aws/aws-sdk-php/src/data/ssm//usr/local/cpanel/3rdparty/wp-toolkit/plib/vendor/aws/aws-sdk-php/src/data/ssm/2014-11-06//usr/local/cpanel/3rdparty/wp-toolkit/plib/vendor/aws/aws-sdk-php/src/data/sso-admin//usr/local/cpanel/3rdparty/wp-toolkit/plib/vendor/aws/aws-sdk-php/src/data/sso-admin/2020-07-20//usr/local/cpanel/3rdparty/wp-toolkit/plib/vendor/aws/aws-sdk-php/src/data/sso-oidc//usr/local/cpanel/3rdparty/wp-toolkit/plib/vendor/aws/aws-sdk-php/src/data/sso-oidc/2019-06-10//usr/local/cpanel/3rdparty/wp-toolkit/plib/vendor/aws/aws-sdk-php/src/data/sso//usr/local/cpanel/3rdparty/wp-toolkit/plib/vendor/aws/aws-sdk-php/src/data/sso/2019-06-10//usr/local/cpanel/3rdparty/wp-toolkit/plib/vendor/aws/aws-sdk-php/src/data/states//usr/local/cpanel/3rdparty/wp-toolkit/plib/vendor/aws/aws-sdk-php/src/data/states/2016-11-23//usr/local/cpanel/3rdparty/wp-toolkit/plib/vendor/aws/aws-sdk-php/src/data/storagegateway//usr/local/cpanel/3rdparty/wp-toolkit/plib/vendor/aws/aws-sdk-php/src/data/storagegateway/2013-06-30//usr/local/cpanel/3rdparty/wp-toolkit/plib/vendor/aws/aws-sdk-php/src/data/streams.dynamodb//usr/local/cpanel/3rdparty/wp-toolkit/plib/vendor/aws/aws-sdk-php/src/data/streams.dynamodb/2012-08-10//usr/local/cpanel/3rdparty/wp-toolkit/plib/vendor/aws/aws-sdk-php/src/data/sts//usr/local/cpanel/3rdparty/wp-toolkit/plib/vendor/aws/aws-sdk-php/src/data/sts/2011-06-15//usr/local/cpanel/3rdparty/wp-toolkit/plib/vendor/aws/aws-sdk-php/src/data/supplychain//usr/local/cpanel/3rdparty/wp-toolkit/plib/vendor/aws/aws-sdk-php/src/data/supplychain/2024-01-01//usr/local/cpanel/3rdparty/wp-toolkit/plib/vendor/aws/aws-sdk-php/src/data/support-app//usr/local/cpanel/3rdparty/wp-toolkit/plib/vendor/aws/aws-sdk-php/src/data/support-app/2021-08-20//usr/local/cpanel/3rdparty/wp-toolkit/plib/vendor/aws/aws-sdk-php/src/data/support//usr/local/cpanel/3rdparty/wp-toolkit/plib/vendor/aws/aws-sdk-php/src/data/support/2013-04-15//usr/local/cpanel/3rdparty/wp-toolkit/�x������������� $����XA#�gJj(9�������A���������h���������������������xcrypt- Fix issues in MozNSS compatibility layer (#1400570)
  + Force write file with fsync to avoid race conditions
  + Always filestamp both sql and dbm NSS DB variants to not rely on default DB type prefix
  + Allow missing cert and key which is a valid usecase
  + Create extraction folder only in /tmp to simplify selinux rules
  + Fix Covscan issues- Build with OpenSSL with MozNSS compatibility layer (#1400570)- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Binutils_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Mass_Rebuild- Rebase to version 2.4.45 (#1458081)
  * fixes CVE-2017-9287 (#1456712, #1456713)
- Update the 'sources' file with new SHA512 hashes- Change Requires to Recommends for nss-tools (#1415086)- Perl 5.26 rebuild- NSS: Maximal TLS protocol version should be equal to NSS default (#1435692)- NSS: Enhance OpenLDAP to support TLSv1.3 protocol with NSS (#1435692)
- NSS: Rearrange ciphers-, parsing-, and protocol-related patches (#1435692)- Rebuilt for https://fedoraproject.org/wiki/Fedora_26_Mass_Rebuild- NSS: Update list of ciphers (#1387868)- NSS: Use what NSS considers default for DEFAULT cipher string (#1387868)- NSS: fix: incorrect multi-keyword parsing and support new ones (#1243517)- fix previous commit (#1375432)- fix: Setting olcTLSProtocolMin does not change supported protocols (#1375432)
- fix: slapd should start after network-online.service (#1336487)- Perl 5.24 rebuild- Update to 2.4.44 (#1305191)- Bring back *.la files in %{_libdir}/openldap/ (#1331484)- Keep *.so libraries in %{_libdir}/openldap/ (#1331484)
- Include AllOp overlay (#1319782)- Ensure all libtool archive files are removed (.la)- Rebuilt for https://fedoraproject.org/wiki/Fedora_24_Mass_Rebuild- Update to 2.4.43 (#1253871)- New upstream release 2.4.41 (#1238251)- Rebuilt for https://fedoraproject.org/wiki/Fedora_23_Mass_Rebuild- Perl 5.22 rebuild- fix: bring back tmpfiles config (#1215655)- remove spurious ghosted file- link against moznss again (#1187742)- fix: Unknown Berkeley DB major version in db.h (#1191098)- CVE-2015-1545: slapd crashes on search with deref control (#1190645)- link against openssl by default
- simplify package even more by removing certificate generation- remove tmpfiles config since it's no longer needed
- fix invalid ldif
- simplify checking for missing server configuration- remove openldap-fedora-systemd.patch
- remove openldap-ldaprc-currentdir.patch
- remove openldap-userconfig-setgid.patch
- remove openldap-syncrepl-unset-tls-options.patch
- remove unneeded configure flags, disable sql backend and aci
- make mdb default after a new installation
- remove pid file and args file
- renumber patches and sources- harden the build
- improve check_password
- provide an unversioned symlink to check_password.so.1.1- remove openldap.pc- enhancement: generate openldap.pc (#1171493)- enhancement: support TLSv1 and later (#1160466)- new upstream release (#1147877)- Perl 5.20 rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_22_Mass_Rebuild- fix license handling- fix: fix typo in generate-server-cert.sh (#1117229)- fix: make default service configuration listen on ldaps:/// as well (#1105634)- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_Mass_Rebuild- fix: remove correct tmp file when generating server cert (#1103102)- re-symlink unversioned libraries, so ldconfig is not confused (#1028557)- don't automatically convert slapd.conf to slapd-config- remove redundant sysconfig-related stuff
- add documentation reference to service file
- alias slapd.service as openldap.service- CVE-2013-4449: segfault on certain queries with rwm overlay (#1060851)- new upstream release (#1059186)- new upstream release (#1031608)- fix: slaptest incorrectly handles 'include' directives containing a custom file (#1028935)- new upstream release (#1023916)
- fix: missing a linefeed at the end of file /etc/openldap/ldap.conf (#1019836)- fix: slapd daemon fails to start with segmentation fault on s390x (#1020661)- �x������������������X�#�eJj�����~������������{���������������������{>�G>?9ld����	!�	B�(�,�D�H�O�n�	���������	�			
	<	E	
P	t	�	��	d�	G(	�8	�Y9
�Y:�Y>4vB4~G4�	H4�	I4�	X4�Y4�Z5([5,\50	]5T	^5�b6&d6�e6�f6�l6�t6�	u7	v7(w8�	x9	y9<�9h9|9�;�;�
=��=�=�	=�g>h>Ccronie-anacron1.4.1125.el7_9Utility for running regular jobsAnacron is part of cronie that is used for running jobs with regular
periodicity which do not have exact time of day of execution.

The default settings of anacron execute the daily, weekly, and monthly
jobs, but anacron allows setting arbitrary periodicity of jobs.

Using anacron allows running the periodic jobs even if the system is often
powered off and it also allows randomizing the time of the job execution
for better utilization of resources shared among multiple systems.dc�x86-02.bsys.centos.org��CentOSMIT and BSD and ISC and GPLv2+CentOS BuildSystem <http://bugs.centos.org>System Environment/Basehttps://github.com/cronie-crond/cronielinuxx86_64[ -e /var/spool/anacron/cron.daily ] || touch /var/spool/anacron/cron.daily
[ -e /var/spool/anacron/cron.weekly ] || touch /var/spool/anacron/cron.weekly
[ -e /var/spool/anacron/cron.monthly ] || touch /var/spool/anacron/cron.monthly��z
T����큤��A큀����dc�dc�dc�dc�dc�dc�dc�dc�dc�bb6371d86936214cabbfc5e70d71375a8ab0b71e45e2c34db08e61f94da8efc70f030f0a1c8124fca5e8b3a34ddc2ad206843227e753d0c10cc4ad1932564cee0a4ab9dab793917884a8bbc4baa3401427f845f6fe330f932796024981a91ffca21022b926d8b58cc9acf37123af9ee5f14b69b7b7b589d3dae66d1aad4e9de9c49244e74c1f1d38731d47ed34930b9b064b64f73609c5b18bcc4cb91d276d44e3b0c44298fc1c149afbf4c8996fb92427ae41e4649b934ca495991b7852b855e3b0c44298fc1c149afbf4c8996fb92427ae41e4649b934ca495991b7852b855e3b0c44298fc1c149afbf4c8996fb92427ae41e4649b934ca495991b7852b855@@@rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootcronie-1.4.11-25.el7_9.src.rpm����������������������������������anacronconfig(cronie-anacron)cronie-anacroncronie-anacron(x86-64)dailyjobs@@@@@@@@@@


@
/bin/sh/bin/shconfig(cronie-anacron)coreutilscroniecrontabslibaudit.so.1()(64bit)libc.so.6()(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libc.so.6(GLIBC_2.7)(64bit)libdl.so.2()(64bit)libpam.so.0()(64bit)libselinux.so.1()(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rtld(GNU_HASH)rpmlib(PayloadIsXz)1.4.11-25.el7_91.4.11-25.el7_93.0.4-14.6.0-14.0-15.2-14.11.3d@a���\d�\l@[��[�
@Y�@Y���Xۡ�X���V�I�U6;�S���S��@R�J@R�U�R߲�R��R�=�R�k�R].@R2�@R �@Q��Q��Q�@Q�@P�!@P��@P��PG>�P��O�N��@N���N��N/��N(�N(�Ne@N�N�N	�@M��@M‘@MT�MQ0@M4/@M	�@M��M@L��@L��@L��@L�|�Le3�L_�LV�@K~}@Ky7@J�@J��@J�T�J�@J��@J�Q�J�Q�Jyt@Ji�@Jd\@J:,@I��@I�I��I��@IP�I��H�}@H�B�Hc��HW�@HF��H=I@H2�@G��@G��@G�O�G�f�G�e�Ondřej Pohořelský <opohorel@redhat.com> - 1.4.11-25Jan Staněk <jstanek@redhat.com> - 1.4.11-24Marcel Plch <m�x�����������������X�#_fJjH
������p�����������������������������d setValue method for checkboxes in snack- added NEWT_FLAG_PASSWORD for entering passwords and having asterix echo'd- build for new release- see CHANGES- revert mblen patch, go back to our own wide char detection- fix doReflow to handle mblen returning 0- fix critical bug in fkey 1-4 recognition on xterms- fixed snack widget setcallback function- strip shared libs- added patch from Toru Hoshina <t@kondara.org> to improve multibyte
  character wrapping- see CHANGES- fix segfault in newtRadioGetCurrent- added numerous bug fixes (see CHANGES)- rebuild with fix for listbox from Nalin- added patch to correctly wrap euc kanji- added suspend/resume to snack- enable gpm support- added hotkey assignment for gridforms, changed listbox.setcurrent to
  take the item key- fixed snack callback function refcounts, as well as optional data args
- fixed suspend callback ref counts- added buttons argument to entrywindow- multi-state checkboxtrees. Woohoo.- added snack wrappings for checkbox flag setting- added snack bindings for setting current listbox selection
- added argument to set default selection in snack ListboxChoiceWindow- added checkboxtree
- improved snack binding- fixed a glibc related bug in reflow that was truncating all text to 1000
chars- fixed bug that made newt apps crash when you hit <insert> followed by lots
of keys- fix from Jakub Jelinek for listbox keypresses- fixed support for navigating listboxes with alphabetical keypresses- updated descriptions
- added support for navigating listboxes with alphabetical keypresses- made grid wrapped windows at least the size of their title bars- Function to set checkbox flags.  This will go away later when I have
  a generic flag setting function and signals to comps to go insensitive.- Stopped using libgpm, internalized all gpm calls.  Still need some cleanups.- Added GPM mouse support
- Moved to autoconf to allow compiling without GPM support
- Changed revision to 0.40- built against slang-1.2.2- bugfixes for text reflow
- added docs- devel package moved to Development/Libraries- removed whiptcl.so -- it should be in a separate package- added newtWinMenu()
- many bug fixes in grid code- removed newtWinTernary()
- made newtWinChoice() return codes consistent with newtWinTernary()- added changes from Bruce Perens
    - small cleanups
    - lets whiptail automatically resize windows
- the order of placing a grid and adding components to a form no longer
  matters
- added newtGridAddComponentsToForm()- added newtWinTernary()- made Make/spec files use a buildroot
- added grid support (for newt 0.11 actually)- Added patched from Clarence Smith for setting the size of a listbox
- Version 0.9- Touchups on Makefile
- Cleaned up NEWT_FLAGS_*- Cleaned up listbox
- Added whiptail
- Added newtButtonCompact button type and associated colors
- Added newtTextboxGetNumLines() and newtTextboxSetHeight()- Added changes from sopwith for C++ cleanliness and some listbox fixes./sbin/ldconfig/sbin/ldconfig	

 !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOarasastbalbgbnbnbscacscydadedzeleoeseteufafifrgaglguhehihrhuiaiditjakmknkokultlvmgmkmlmrmsnbndsnenlnnpaplptptroruskslsqsrsr@latinsvtatetgthtltrukviwoxhzhzh������0.52.15-4.el70.52.15-4.el70.52.15-4.el7	

�x��������������������X5#gJjh;�����������9����������������������9�����/Fedora_12_Mass_Rebuild- rediff systzdata patch- update to v6 of systzdata patch; various fixes- update to v5 of systzdata patch; parses zone.tab and extracts
  timezone->{country-code,long/lat,comment} mapping table- update to 5.3.0
- remove ncurses, dbase, mhash extensions
- add enchant, sqlite3, intl, phar, fileinfo extensions
- raise sqlite version to 3.6.0 (for sqlite3, build with --enable-load-extension)
- sync with upstream "production" php.ini- update to 5.2.10
- add interbase sub-package- update to 5.2.9- Rebuilt for https://fedoraproject.org/wiki/Fedora_11_Mass_Rebuild- add recode support, -recode subpackage (#106755)
- add -zts subpackage with ZTS-enabled build of httpd SAPI
- adjust php.conf to use -zts SAPI build for worker MPM- fix patch fuzz, renumber patches- drop obsolete configure args
- drop -odbc patch (#483690)- split out sysvshm, sysvsem, sysvmsg, posix into php-process- move wddx to php-xml, build curl shared in -common
- remove BR for expat-devel, bogus configure option- rebuild for new MySQL- libtool 2 workaround for phpize (#476004)
- add missing php_embed.h (#457777)- update to 5.2.8- libtool 2 workaround- update to 5.2.7
- enable pdo_dblib driver in php-mssql- tweak Summary, thanks to Richard Hughes- move gd_README to php-gd
- update to r4 of systzdata patch; introduces a default timezone
  name of "System/Localtime", which uses /etc/localtime (#469532)- enable XPM support in php-gd
- Fix BR for php-gd- enable T1lib support in php-gd- update to 5.2.6
- sync default php.ini with upstream
- drop extension_dir from default php.ini, rely on hard-coded
  default, to make php-common multilib-safe (#455091)
- update to r3 of systzdata patch- split pspell extension out into php-spell (#443857)- Autorebuild for GCC 4.3- ext/date: use system timezone database- rebuild for libc-client bump- Rebuild for openssl bump- update to 5.2.5- correct pcre BR version (#333021)
- restore metaphone fix (#205714)
- add READMEs to php-cli- update to 5.2.4- rebuild for fixed APR- add ldconfig post/postun for -embedded (Hans de Goede)- add php-embedded sub-package- fix build with new glibc
- fix License- define php_extdir in macros.php- obsolete php-dbase- add mcrypt, mhash, tidy, mssql subpackages (Dmitry Butskoy)
- enable dbase extension and package in -common- update to 5.2.3 (thanks to Jeff Sheltren)- fix php-pdo *_arg_force_ref global symbol abuse (#216125)- rebuild against uw-imap-devel- update to 5.2.2
- synch changes from upstream recommended php.ini- enable SASL support in LDAP extension (#205772)- drop mime_magic extension (deprecated by php-pecl-Fileinfo)- fix regression in str_{i,}replace (from upstream)- update to 5.2.1
- add Requires(pre) for httpd
- trim %changelog to versions >= 5.0.0- bump default memory_limit to 32M (#220821)
- mark config files noreplace again (#174251)
- drop trailing dots from Summary fields
- use standard BuildRoot
- drop libtool15 patch (#226294)- add php(api), php(zend-abi) provides (#221302)
- package /usr/share/php and append to default include_path (#225434)- fix filter.h installation path
- fix php-zend-abi version (Remi Collet, #212804)- rebuild again- rebuild for net-snmp soname bump- build json and zip shared, in -common (Remi Collet, #215966)
- obsolete php-json and php-pecl-zip
- build readline extension into /usr/bin/php* (#210585)
- change module subpackages to require php-common not php (#177821)- provide php-zend-abi (#212804)
- add /etc/rpm/macros.php exporting interface versions
- synch with upstream recommended php.ini- update to 5.2.0 (#213837)
- php-xml provides php-domxml (#215656)
- fix php-pdo-abi provide (#214281)- rebuild for curl soname bump
- add build fix for curl 7.16 API- from upstream: add safety checks against integer overflow in _ecalloc- update to 5.1.6 (security fixes)
- bump default memory_limit to 16M (#196802)- rebuild- Provide php-posix (#194583)
- only provide php-pcntl from -cli subpackage
- add missing defattr's (thanks to Matthias Saou)- move Obsoletes for �x�������������������X�#ZgJj�H��� ������C�����!�����������������C�C	fe-apply-groupcl-linksafe-reconfigureplesk_configurecloudlinux-linksafecpanelhookscloudlinux_linksafe_hook.shcpanel-linksafe-delete-hookscpanel-linksafe-install-hooksscriptletsrpm_posttrans.shrpm_preun.sh/opt//opt/cloudlinux-linksafe//usr/bin//usr/share//usr/share/cloudlinux-linksafe//usr/share/cloudlinux-linksafe/cpanel//usr/share/cloudlinux-linksafe/cpanel/hooks//usr/share/cloudlinux-linksafe/scriptlets/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches   -m64 -mtune=genericcpioxz2noarch-redhat-linux-gnudirectoryBourne-Again shell script, ASCII text executableRRRRRRRRR/usr/share/cloudlinux-linksafe/scriptlets/rpm_posttrans.sh $1 /etc/cloudlinux-edition-solo /etc/cloudlinux-container
exit 0/bin/sh?����0�3!�ׅ���s�z����{�P�fi�8q
	�{�P�f4��!���ޮ7IY���)��s����m&n�Sb5��s�5��ǻ�Y�_ ���tGJ[Yոt	�Xzh#��JI5��*K�3��G�W&�E��u��3w.{
w�V;/��=1��ƫ�cx8m����c6���遜h��t%��<�]X�e��:�e�{ԭ�w�,Jm�_���8yw
�T"��qԜ�j��AB�u&X99�Ƥ7��]0�|�`vu��ë�=��~"�還���:^�3d�ę����
��DS�X:jЩ^�K�q�1o��3�o�ƺ�����~?[·Im�"2׋���ZW��QKA�5���ܞ!S���g�t�gfz���lF�fp�{����|ND����K]�":�qC���\�e��\��TC;�#؜r-L��S
�,a_%p9��xk�*��Y�i�bs��f�I�R�:a%eۃ'1����'��K��a���K�|T���^��� R(o�
o���F��>��u�W�,Bxi�� �92����}���?�3!�ׅ���s�z����{�P�fi�8q
	�{�P�f���W0�Z:�-����ZZs�%�.��Zs��0�oҍ���:1�d��B�������/�-HaA��V�A�M�;�i��ȅ��ڣӌ��hCd�Sm���o���[��͔���5|A�.�,�����3��4�{,~;P!@4%b��,�9�_,�@�����o����-<y	[��:�eWD�'%��-L����'��t����’�m7yt���Db��o��'
��R�X)�E��0a4"���~�B� zY²rijnL?�a�Dd˝|�Uc���+�F�\�5�U�u�G[��Y%�%��B��mn�$�dny�&=M�5�	Kz4�T���J�E(�jK)�)��3�/�[P(��s��oT6�
E-�Vq��f;���مy�>b�D���h`T �d_R%����:�_}�V7�:4b��֖�g�!��⿟3���}V.8�¡;+y��@F��e��6�N���i��ՠ�zS�����ƀ"�,#7�oi%U*���o���a233fecb2e057a8aa9b851e3ac0c6701fe5337dbi�8�3�i�8�opt/imunify360/venv/lib/python3.11/site-packages/imav/patchman/fs_scanner//opt/imunify360/venv/lib/python3.11/site-packages/imav/patchman/fs_scanner/__pycache__//opt/imunify360/venv/lib/python3.11/site-packages/imav/patchman/rpc//opt/imunify360/venv/lib/python3.11/site-packages/imav/patchman/rpc/__pycache__//opt/imunify360/venv/lib/python3.11/site-packages/imav/patchman/rpc/schema//opt/imunify360/venv/lib/python3.11/site-packages/imav/plugins//opt/imunify360/venv/lib/python3.11/site-packages/imav/plugins/__pycache__//opt/imunify360/venv/lib/python3.11/site-packages/imav/rpc_tools//opt/imunify360/venv/lib/python3.11/site-packages/imav/rpc_tools/__pycache__//opt/imunify360/venv/lib/python3.11/site-packages/imav/simple_rpc//opt/imunify360/venv/lib/python3.11/site-packages/imav/simple_rpc/__pycache__//opt/imunify360/venv/lib/python3.11/site-packages/imav/simple_rpc/schema_responses//opt/imunify360/venv/lib/python3.11/site-packages/imav/subsys//opt/imunify360/venv/lib/python3.11/site-packages/imav/subsys/__pycache__//opt/imunify360/venv/lib/python3.11/site-packages/imav/utils//opt/imunify360/venv/lib/python3.11/site-packages/imav/utils/__pycache__//opt/imunify360/venv/lib/python3.11/site-packages/imunify_antivirus-8.7.1-py3.11.egg-info//opt/imunify360/venv/share/imunify360//opt/imunify360/venv/share/imunify360/config_schema//opt/imunify360/venv/share/imunify360/scripts//opt/imunify360/venv/share/licenses//opt/imunify360/venv/share/licenses/imunify-antivirus-8.7.1//usr/bin//usr/lib/systemd/system//usr/share/imunify360//var//var/imunify360//var/imunify360/aibolit//var/imunify360/aibolit/resident//var/imunify360/aibolit/resident/in//var/log/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstac�x�������������x������X�#gJj�C������P����a������	����������������a�¡`��5.3.3-5Joe Orton <jorton@redhat.com> - 5.3.3-4Joe Orton <jorton@redhat.com> - 5.3.3-3Remi Collet <Fedora@famillecollet.com> 5.3.3-2Remi Collet <Fedora@famillecollet.com> 5.3.3-1Remi Collet <Fedora@famillecollet.com> 5.3.2-3Caolán McNamara <caolanm@redhat.com> 5.3.2-2Remi Collet <Fedora@famillecollet.com> 5.3.2-1Joe Orton <jorton@redhat.com> - 5.3.1-3Joe Orton <jorton@redhat.com> - 5.3.1-2Remi Collet <Fedora@famillecollet.com> 5.3.1-1Tom "spot" Callaway <tcallawa@redhat.com> - 5.3.0-7Tomas Mraz <tmraz@redhat.com> - 5.3.0-6Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 5.3.0-5Joe Orton <jorton@redhat.com> 5.3.0-4Joe Orton <jorton@redhat.com> 5.3.0-3Joe Orton <jorton@redhat.com> 5.3.0-2Remi Collet <Fedora@famillecollet.com> 5.3.0-1Remi Collet <Fedora@famillecollet.com> 5.2.10-1Remi Collet <Fedora@FamilleCollet.com> - 5.2.9-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 5.2.8-10Joe Orton <jorton@redhat.com> 5.2.8-9Joe Orton <jorton@redhat.com> 5.2.8-8Joe Orton <jorton@redhat.com> 5.2.8-7Joe Orton <jorton@redhat.com> 5.2.8-5Joe Orton <jorton@redhat.com> 5.2.8-4Joe Orton <jorton@redhat.com> 5.2.8-3Remi Collet <Fedora@FamilleCollet.com> 5.2.8-2Remi Collet <Fedora@FamilleCollet.com> 5.2.8-1Remi Collet <Fedora@FamilleCollet.com> 5.2.7-1.1Remi Collet <Fedora@FamilleCollet.com> 5.2.7-1Joe Orton <jorton@redhat.com> 5.2.6-7Joe Orton <jorton@redhat.com> 5.2.6-6Remi Collet <Fedora@FamilleCollet.com> 5.2.6-5Remi Collet <Fedora@FamilleCollet.com> 5.2.6-4Joe Orton <jorton@redhat.com> 5.2.6-3Joe Orton <jorton@redhat.com> 5.2.5-7Fedora Release Engineering <rel-eng@fedoraproject.org> - 5.2.5-6Joe Orton <jorton@redhat.com> 5.2.5-5Joe Orton <jorton@redhat.com> 5.2.5-4Release Engineering <rel-eng at fedoraproject dot org> - 5.2.5-3Joe Orton <jorton@redhat.com> 5.2.5-2Joe Orton <jorton@redhat.com> 5.2.4-3Joe Orton <jorton@redhat.com> 5.2.4-2Joe Orton <jorton@redhat.com> 5.2.3-9Joe Orton <jorton@redhat.com> 5.2.3-8Hans de Goede <j.w.r.degoede@hhs.nl> 5.2.3-7Joe Orton <jorton@redhat.com> 5.2.3-6Joe Orton <jorton@redhat.com> 5.2.3-5Joe Orton <jorton@redhat.com> 5.2.3-4Joe Orton <jorton@redhat.com> 5.2.3-3Joe Orton <jorton@redhat.com> 5.2.3-2Joe Orton <jorton@redhat.com> 5.2.2-4Joe Orton <jorton@redhat.com> 5.2.2-3Joe Orton <jorton@redhat.com> 5.2.2-2Joe Orton <jorton@redhat.com> 5.2.1-5Joe Orton <jorton@redhat.com> 5.2.1-4Joe Orton <jorton@redhat.com> 5.2.1-3Joe Orton <jorton@redhat.com> 5.2.1-2Joe Orton <jorton@redhat.com> 5.2.0-10Joe Orton <jorton@redhat.com> 5.2.0-9Joe Orton <jorton@redhat.com> 5.2.0-8Joe Orton <jorton@redhat.com> 5.2.0-7Joe Orton <jorton@redhat.com> 5.2.0-6Joe Orton <jorton@redhat.com> 5.2.0-5Joe Orton <jorton@redhat.com> 5.2.0-4Joe Orton <jorton@redhat.com> 5.2.0-3Joseph Orton <jorton@redhat.com> 5.1.6-4Joe Orton <jorton@redhat.com> 5.1.6-3Joe Orton <jorton@redhat.com> 5.1.6-2Jesse Keating <jkeating@redhat.com> - 5.1.4-8.1Joe Orton <jorton@redhat.com> 5.1.4-8Joe Orton <jorton@redhat.com> 5.1.4-7Joe Orton <jorton@redhat.com> 5.1.4-6Radek Vokal <rvokal@redhat.com> 5.1.4-5.1Joe Orton <jorton@redhat.com> 5.1.4-5Joe Orton <jorton@redhat.com> 5.1.4-3Joe Orton <jorton@redhat.com> 5.1.3-3Joe Orton <jorton@redhat.com> 5.1.2-5Jesse Keating <jkeating@redhat.com> - 5.1.2-4.3Jesse Keating <jkeating@redhat.com> - 5.1.2-4.1Joe Orton <jorton@redhat.com> 5.1.2-4Joe Orton <jorton@redhat.com> 5.1.2-3Joe Orton <jorton@redhat.com> 5.1.2-2Joe Orton <jorton@redhat.com> 5.1.1-8Joe Orton <jorton@redhat.com> 5.1.1-7Joe Orton <jorton@redhat.com> 5.1.1-6Jesse Keating <jkeating@redhat.com>Joe Orton <jorton@redhat.com> 5.1.1-5Joe Orton <jorton@redhat.com> 5.1.1-4Joe Orton <jorton@redhat.com> 5.1.1-3Joe Orton <jorton@redhat.com> 5.1.1-2Tomas Mraz <tmraz@redhat.com> 5.0.5-6Joe Orton <jorton@redhat.com> 5.0.5-5Joe Orton <jorton@redhat.com> 5.0.5-4Joe Orton <jorton@redhat.com> 5.0.5-3Joe Orton <jorton@redhat.com> 5.0.4-11Joe Orton <jorton@redhat.com> 5.0.4-10Joe Orton <jorton@redhat.com> 5.0.4-9Joe Orton�x�������������������X�#�fJj������������6�����p����������������66�D?�d��!�'�	3�	i��� �$�	.�D�r�x��	 
@�P
`��@|���(89:�>	 @	(B	0G	PH	�I	�X	�Y	�Z	�[	�\
]
@^
�b
5d
�e
�f
�l
�t
�u0vpw(xh����
���ghCcpanel-php81-date-holidays-uno0.1.31.cp110~el7PEAR: Driver based class to calculate holidays in UNODate_Holidays helps you calculate the dates and titles of holidays and
other special celebrations. This is the driver for calculating UNO
holidays.ci|�bh-centos-7.dev.cpanel.net��PHP v3.01Development/Librarieshttp://pear.php.net/package/Date_Holidays_UNOlinuxnoarchecho /usr/local/cpanel/3rdparty/php/81/lib/pear/Date_Holidays_UNO.xml >> /var/cpanel/.pending_pear_registrations# Only remove PEAR registry entry if this is a plain uninstall. For upgrades, leave it in place.
if [ x$1 = x0 ]; then echo pear.php.net/Date_Holidays_UNO >> /var/cpanel/.pending_pear_deregistrations ; fi
9F�F�/�.���A�A�A큤A�A�A�A큤������A�A큤I��Aci|�ci|�ci|�ci|�ci|�ci|�ci|�ci|�ci|�ci|�ci|�ci|�ci|�ci|�ci|�5fe303d5797be08a3abe4e2b7bfd6dffe30e2d7e35886fccc9e58fd0a5e6f82f9b9cfcfdd629ff74209a277192e0e47f0209cccd73336237ecbc7c01064972f6e37693ebbaab890748436b9e85214a26abefeae21f7ec0efcd02f03ad64f117dfb219a62d2690cf8f23e76de177c0a7d153dd7fd36269779cebc9a03f47c78e1c74669fc3a43789b69ca0b3dcff9338fbd9097e6c2bda0e832d8f6863b7109fcbbde70b0e8eee6b9cde0d830f12823549509620da8ae1112e28d9009cc6b578ce3b0c44298fc1c149afbf4c8996fb92427ae41e4649b934ca495991b7852b855rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootcpanel-php81-date-holidays-uno-0.1.3-1.cp110~el7.src.rpm����������������������������������������������������������������cpanel-php81-date-holidays-uno




/bin/sh/bin/shcpanel-php81cpanel-php81cpanel-php81cpanel-php81-date-holidaysrpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rpmlib(TildeInVersions)3.0.4-14.6.0-14.0-15.2-14.10.0-14.11.1c_��a��`OL@B. McMahon <b.mcmahon@cpanel.net> - 0.1.3-1.cp110~el7B. McMahon <b.mcmahon@cpanel.net> - 0.1.3-1.cp11102Nicolas Rochelemagne <nicolas.rochelemagne@cpanel.net> - 0.1.3-1.cp1198- Packaging for PHP v8.1- Packaging for PHP v7.4- Rename package and add Ubuntu support/bin/sh/bin/shcpanel-php74-date-holidays-uno	

0.1.3-1.cp110~el7	
Date_Holidays_UNO.xmlDateHolidaysDriverUNO.phpdataDate_Holidays_UNOlangUNOde_DE.serde_DE.xmlen_EN.seren_EN.xmldocscpanel-php81-date-holidays-uno-0.1.3nodocs/usr/local/cpanel/3rdparty/php/81/lib/pear//usr/local/cpanel/3rdparty/php/81/lib/php//usr/local/cpanel/3rdparty/php/81/lib/php/Date//usr/local/cpanel/3rdparty/php/81/lib/php/D�x�������������h������X	#�gJj����ȝظ�����>����������������������>�>�>�rk params patch to apply with fuzz=0
- fix license tag- new upstream version- Fixed segfault when using only "--" as parameter
- Resolves: #430458- Fixed setfacl exitcodes
- Resolves: #368451- New version
- dropped walk patch- Rewriten path_max patch to support long UTF8 names
- Resolves #287701, #183181- Removed NFS4 ACL patch since it was rejected by upstream.- disable nfs patch; linking libacl against libs in /usr will lead to breakage- Build Require gawk- Rebuild for selinux ppc32 issue.- Added NFS v4 ACL support- Updated man page for getfacl- Added support fort short params to getfacl
- Resolves: #204087- new improved walk patch with fixed getfacl exit code (rhbz#232884)- fix buildroot
- remove trailing dot from summary
- -devel requires same version of libacl
- escape macro in changelog
- make .so symlink relative- Apply patch to make order consistent.- rebuild- new version 2.2.39
- fixed usage of long UTF-8 filenames (#183181)
  Thanks to Andrey for the initial patch.- rebuild for -devel deps- bump again for double-long bug on ppc(64)- rebuilt for new gcc4.1 snapshot and glibc changes- new version 2.2.34- rebuilt- fixed permissions of libacl- spec file cleanup
- mark po files as lang specific- 2.2.32- update to 2.2.31- get rid of *.la files
- remove duplicate doc files- Rebuild- make the libs executable so that we find their dependencies (#132696)- libacl-devel Requires: libattr-devel for libattr.la- Requires libtool >= 1.5 for building- Make libacl.so.* executable.- Update to latest upstream version.- Close bug #125300 (Steve Grubb: build requires libtool,gettext)- rebuilt- Add missing %defattr- Add /usr/include/acl to files manifest
- Fix location of doc files, add main doc dir to files manifest- rebuilt- rebuilt- Fix libtool invocation- Update to acl-2.2.7- include patch from Jay Berkenbilt to print better error messages- udpate/rebuild- set execute bits on library so that requires are generated.- Correct patch in previous fix so that shared libraries go in /lib* 
  instead of /usr/lib*- Fix multilibbing- Added fix to install libs in correct directory on 64bit machine- Made the package only own the one directory that is unique to it:
  /usr/include/acl- Initial Red Hat package
  Made as few changes as possible relative to upstream packaging to
  make it easier to maintain long-term.  This means that some of
  the techniques used here are definitely not standard Red Hat
  techniques.  If you are looking for an example package to fit
  into Red Hat Linux transparently, this would not be the one to
  pick.
- acl-devel -> libacl-devel/sbin/ldconfig/sbin/ldconfig����2.2.51-15.el72.2.51-15.el7libacl.so.1libacl.so.1.1.0/usr/lib64/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches   -m64 -mtune=genericcpioxz2x86_64-redhat-linux-gnuELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=5f8ad935c32d87c9a73fe96a36a6d9c68c90d452, strippedPPPPRR	R
RRRRR?���0g�^���$ƨ���/4�]�WU+D�(Z�
�+��_p꫗ւ;QL�Ֆc4�G8U7�!�Xv��h�>O*�V9
X�cm-�Om
Š{r�&,�!�/�[�J�%��]�	���Z��)�3eiH���_��H}��UEܠ�r@�f��ugU�(ފZ�~W�m����b2��zB�������7j�8��ɑ���m�B��=��B0{�#C�>�L�K������2rwU�T~
C,f���+��*
]�9,���+����yu��y�O��Wc���k?�/���{W +��i�k��9%	qKa��*s���d�p3���8؄,��a�1��5w����z���^��t���pi�	�f�@����~^����#h�X�����Y}p��['��}E.r�-%��C��.�3�A�E��YH*�>��s�)��A��1�:��d���ϛ��E�M��C$L�S���}��J����s�l��=���(�+�x�c4�b>ȑK�>k��cN���}9��PYrT^�K_m��*��C\ys<�N�A���.��^���$ƨ����~�.��Z"dʮf.����$���~�P6*�a �q��Ԏ�H�_q[+�*p� q�����e�#�f�@�M�O6
��B����gF���0j �e�������]PӒ��#hg��6��)�KN;j0K���g���|ݢe
�q���'��u��}ac����ņz�Xpߕ��pRD5��U���3��l�&v��A��!����qX�1D�h+1���y�����L:&[^��OȦ�~n�:t·]yS5�@��4lD*!�]�/&����͈x�������������������XXfJj����������������E�5�����������������E4}�'� McIntire <cory@cpanel.net> - 7.3.20-1Julian Brown <julian.brown@cpanel.net> - 7.3.19-2Cory McIntire <cory@cpanel.net> - 7.3.19-1Tim Mullin <tim@cpanel.net> - 7.3.18-3Tim Mullin <tim@cpanel.net> - 7.3.18-2Cory McIntire <cory@cpanel.net> - 7.3.18-1Cory McIntire <cory@cpanel.net> - 7.3.17-1Tim Mullin <tim@cpanel.net> - 7.3.16-2Cory McIntire <cory@cpanel.net> - 7.3.16-1Julian Brown <julian.brown@cpanel.net> - 7.3.15-2Cory McIntire <cory@cpanel.net> - 7.3.15-1Tim Mullin <tim@cpanel.net> - 7.3.14-2Cory McIntire <cory@cpanel.net> - 7.3.14-1Daniel Muey <dan@cpanel.net> - 7.3.13-2Cory McIntire <cory@cpanel.net> - 7.3.13-1Tim Mullin <tim@cpanel.net> - 7.3.12-2Cory McIntire <cory@cpanel.net> - 7.3.12-1Cory McIntire <cory@cpanel.net> - 7.3.11-1Cory McIntire <cory@cpanel.net> - 7.3.10-1Tim Mullin <tim@cpanel.net> - 7.3.9-2Cory McIntire <cory@cpanel.net> - 7.3.9-1Cory McIntire <cory@cpanel.net> - 7.3.8-1Cory McIntire <cory@cpanel.net> - 7.3.7-3Cory McIntire <cory@cpanel.net> - 7.3.7-2Cory McIntire <cory@cpanel.net> - 7.3.7-1Tim Mullin <tim@cpanel.net> - 7.3.6-2Cory McIntire <cory@cpanel.net> - 7.3.6-1Julian Brown <julian.brown@cpanel.net> - 7.3.5-2Cory McIntire <cory@cpanel.net> - 7.3.5-1Daniel Muey <dan@cpanel.net> - 7.3.4-4Tim Mullin <tim@cpanel.net> - 7.3.4-3Tim Mullin <tim@cpanel.net> - 7.3.4-2Cory McIntire <cory@cpanel.net> - 7.3.4-1Cory McIntire <cory@cpanel.net> - 7.3.3-2Cory McIntire <cory@cpanel.net> - 7.3.3-1Cory McIntire <cory@cpanel.net> - 7.3.2-2Dan Muey <dan@cpanel.net> - 7.3.2-1- EA4-136: Fix libxml2 v2.15.0 compatibility- ZC-12246: Correct conffiles for Ubuntu- ZC-12167: Correct libxml2 problem- ZC-12166: remove _isa since it is incorrect- EA-10753: Have snmp module require 'snmp-mibs-downloader' for deb- EA-11821: Patch to build with the latest ea-libxml2- ZC-10950: Add debug_package nil back w/ second directive (3rd item will be ZC-10951)- ZC-10936: Clean up Makefile and remove debug-package-nil- ZC-10873: Do not build on Ubuntu 22- EA-11039: Ensure php.ini is marked as a config file on debian based systems- EA-10532: Update litespeed to 8.0.1- ZC-9628: Ensure sqlite3 is linked into pdo_sqlite.so- ZC-9245: Correct dependency issue on Ubuntu- EA-10281: Update scl-php73 from v7.3.32 to v7.3.33- ZC-9470: Remove gmp extension from common’s built-in Provides list- EA-10237: Update scl-php73 from v7.3.31 to v7.3.32- ZC-9365 : Correct build issues with Ubuntu- EA-10132: Update scl-php73 from v7.3.30 to v7.3.31- EA-10074: Update scl-php73 from v7.3.29 to v7.3.30- EA-9923: Update scl-php73 from v7.3.28 to v7.3.29- EA-9013: Optimize %check section- EA-9730: Update scl-php73 from v7.3.27 to v7.3.28- EA-9625: Update litespeed to 7.9- EA-9568: Update scl-php73 from v7.3.26 to v7.3.27- EA-9518: Update scl-php73 from v7.3.25 to v7.3.26- ZC-8005: Replace ea-openssl11 with system openssl on C8- EA-9451: Update scl-php73 from v7.3.24 to v7.3.25- EA-9403: Update scl-php73 from v7.3.23 to v7.3.24- ZC-7893: Update DSO config to factor in PHP 8- EA-9390: Fix build with latest ea-brotli (v1.0.9)- EA-9337: Update scl-php73 from v7.3.22 to v7.3.23- EA-9281: Update litespeed from upstream to 7.8- EA-9283: Update scl-php73 from v7.3.21 to v7.3.22- EA-9223: Update scl-php73 from v7.3.20 to v7.3.21- EA-9189: Update litespeed from upstream to 7.7- EA-9153: Update scl-php73 from v7.3.19 to v7.3.20- ZC-6964: Build on C8- EA-9111: Update scl-php73 from v7.3.18 to v7.3.19- EA-9087: Fix PHP version in DSO description- EA-9071: Revert new .user.ini search behavior- EA-9068: Update scl-php73 from v7.3.17 to v7.3.18- EA-9009: Update scl-php73 from v7.3.16 to v7.3.17- EA-8928: Updated the required version for ea-libcurl- EA-8932: Update scl-php73 from v7.3.15 to v7.3.16- ZC-6247: Remove conflict between php-fpm and runtime.- EA-8874: Update scl-php73 from v7.3.14 to v7.3.15- EA-8854: Fix circular dependencies in our PHP packages- EA-8851: Update scl-php73 from v7.3.13 to v7.3.14- ZC-4361: Update ea-openssl requirement to v1.1.1 (ZC-5583)- EA-�x�������������X������X)#�gJj���������������>����������������������>�>�>�ovc@redhat.com> 2.2.47-3Tom "spot" Callaway <tcallawa@redhat.com> 2.2.47-2Jiri Moskovcak <jmoskovc@redhat.com> 2.2.47-1Jiri Moskovcak <jmoskovc@redhat.com> 2.2.45-3Jiri Moskovcak <jmoskovc@redhat.com> 2.2.45-2Jiri Moskovcak <jmoskovc@redhat.com> - 2.2.45-1Jiri Moskovcak <jmoskovc@redhat.com> 2.2.39-10Steve Dickson <steved@redhat.com> - 2.2.39-9Jeremy Katz <katzj@redhat.com> - 2.2.39-8Fedora Release Engineering <rel-eng at fedoraproject dot org> - 2.2.39-7Fedora Release Engineering <rel-eng at fedoraproject dot org> - 2.2.39-6Steve Dickson <steved@redhat.com>  2.2.39-5Jiri Moskovcak <jmoskovc@redhat.com> 2.2.39-4.1Jiri Moskovcak <jmoskovc@redhat.com> 2.2.39-4Thomas Woerner <twoerner@redhat.com> 2.2.39-3.1Karsten Hopp <karsten@redhat.com> 2.2.39-3Steve Grubb <sgrubb@redhat.com> 2.2.39-2Jesse Keating <jkeating@redhat.com> - 2.2.39-1.1Thomas Woerner <twoerner@redhat.com> 2.2.39-1Jeremy Katz <katzj@redhat.com> - 2.2.34-2Jesse Keating <jkeating@redhat.com> - 2.2.34-1.2Jesse Keating <jkeating@redhat.com> - 2.2.34-1.1Thomas Woerner <twoerner@redhat.com> 2.2.34-1Jesse Keating <jkeating@redhat.com>Thomas Woerner <twoerner@redhat.com> 2.2.32-2.1Thomas Woerner <twoerner@redhat.com> 2.2.32-2Florian La Roche <laroche@redhat.com>Than Ngo <than@redhat.com> 2.2.31-1Than Ngo <than@redhat.com> 2.2.23-9Stephen C. Tweedie <sct@redhat.com> 2.2.23-6Jeremy Katz <katzj@redhat.com> - 2.2.23-5Stephen C. Tweedie <sct@redhat.com> 2.2.23-4Stephen C. Tweedie <sct@redhat.com> 2.2.23-3Phil Knirsch <pknirsch@redhat.com> 2.2.23-2Phil Knirsch <pknirsch@redhat.com> 2.2.23-1Alan Cox <alan@redhat.com> 2.2.7-7Elliot Lee <sopwith@redhat.com>Stephen C. Tweedie <sct@redhat.com> 2.2.7-5Stephen C. Tweedie <sct@redhat.com> 2.2.7-3Elliot Lee <sopwith@redhat.com>Elliot Lee <sopwith@redhat.com>Elliot Lee <sopwith@redhat.com> 2.2.7-2Stephen C. Tweedie <sct@redhat.com> 2.2.7-1Michael K. Johnson <johnsonm@redhat.com> 2.2.3-2Michael K. Johnson <johnsonm@redhat.com> 2.2.3-1Jeff Johnson <jbj@redhat.com> 2.0.11-7Elliot Lee <sopwith@redhat.com> 2.0.11-5Elliot Lee <sopwith@redhat.com> 2.0.11-4Than Ngo <than@redhat.com> 2.0.11-3Michael K. Johnson <johnsonm@redhat.com> 2.0.11-2Michael K. Johnson <johnsonm@redhat.com> 2.0.11-1- do not follow symlinks without -L (#1714077)
- update project URL (#1579173)- fix spurious acl_check() failure on setfacl --restore (#1451820)- avoid failure of %check when building as root (#1085389)
- setfacl.1: document the meaning of '-' in perms (#1337039)- Mass rebuild 2014-01-24- Mass rebuild 2013-12-27- fix SIGSEGV of getfacl -e on overly long group name (#1025737)- Rebuilt for https://fedoraproject.org/wiki/Fedora_19_Mass_Rebuild- fix specfile issues reported by the fedora-review script- Rebuilt for https://fedoraproject.org/wiki/Fedora_18_Mass_Rebuild- do not mention static libraries in the summary of libacl{,-devel} (#817952)- add filesystem guard- install everything in /usr
  https://fedoraproject.org/wiki/Features/UsrMove- Rebuilt for https://fedoraproject.org/wiki/Fedora_17_Mass_Rebuild- update project URL (#699058)- new upstream release- new upstream release- add function acl_extended_file_nofollow() (#692982)- fix typos in setfacl(1) man page (#675451)- Rebuilt for https://fedoraproject.org/wiki/Fedora_15_Mass_Rebuild- remove dependency of libacl-devel on nfs-utils-lib and openldap- let acl depend on the same version of libacl (#595674)- prevent setfacl --restore from SIGSEGV on malformed restore file (#576550)- run the test-suite if possible- do not package a static library (#556036)
- remove multilib patch no longer useful
- cleanup in BuildRequires- upstream patch for setfacl --restore SUID/SGID bits handling (#467936)- tweaked setfacl tree walk flags (#488674), thanks to Markus Steinborn- new upstream bugfix release
- big cleanup in patches- Rebuilt for https://fedoraproject.org/wiki/Fedora_12_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_11_Mass_Rebuild- little improvement to params patch
- Resolves: #457244- rewo@x���������������@f702�8��������������~�����X#gJj����������������'>�����O����������������'>�	8?�d��)�.�	:�	l���������	����� 	"
$(i
lpuz��0H�(�89:�GtHxI|X�Y�\�]�^�b�d�e�f�l�����
��ghCcpanel-perl-536-class-data-inheritable0.091.cp108~el7CPAN module - Inheritable, overridable class dataCpanel build perl module 'Class::Data::Inheritable'Inheritable, overridable class datab��bh-centos-7.dev.cpanel.net�perlcpanel/perlhttps://metacpan.orglinuxnoarch�$a�tbfe116f4317619837d56434b567fdc086c72fdaee8471da30f2e9333209aa682rootrootcpanel-perl-536-class-data-inheritable-0.09-1.cp108~el7.src.rpm����cpanel-perl(Class::Data::Inheritable)cpanel-perl-class-data-inheritablecpanel-perl-536-class-data-inheritable




cpanel-perl-536rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(CompressedFileNames)rpmlib(PayloadIsXz)rpmlib(TildeInVersions)4.6.0-14.0-13.0.4-15.2-14.10.0-14.11.1b���b�@`-@Q+R@Todd Rinaldo <toddr@cpan.org> - 0.09-1.cp108Busy Camels <bc@cpanel.net> - 0.08-1.cp108Busy Camels <bc@cpanel.net> - 0.08-1.cp1198Todd Rinaldo <toddr@cpanel.net> - 0.08-1.cp1136- Update from upstream: Class-Data-Inheritable 0.09- Bump to 1.cp108 for re-build- Bump to 1.cp1198 for debian re-build- Update from upstream: Class-Data-Inheritable 0.080.090.090.09-1.cp108~el7Inheritable.pm/usr/local/cpanel/3rdparty/perl/536/cpanel-lib/Class/Data/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches   -m64 -mtune=genericcpioxz2noarch-redhat-linux-gnu?�����M�%P�Sd"����db5e538e7ddad4a2d754bb424f5f1244627c547fc�VAc�VA31fc27affb2ffc6726421ab4d34d599ef4e839a67eedad69e8c2fa52f5a7218c743693a028eff8425241271c9a35e237e7af288ab8a765c6f17a5d93b9b2b3c243c031ba78efb6f04d5c9e70f4d9e6010d9edc22ba155d8d6a842216d2b92dbc99e38ab809fb93d52b944702d7b291fb1ed434e24cf9688a779e04b7ade219f693fd572f37b09bed67e8b537b1fc9f2c278ac64e22cc9a7c38aae16b818dab0546b23290555a69830cc7af31122f609f61d0ecf23fca336934425969f48c68f142a89eaacd8bd167cedaba6ccd188a0d488a2a6d2c91221aa74115da20454fc16e52e233700d979c5be86466704d11d7a1420232a3021cdca60e47c3383866e7a5cfdd968699ec7d6b4bbd4832ac2f1e9351f9d79574196481bf766634e00d898c53502f53441141d972afadd0be26d79b219753d144680160f465d405de571150b33dd29add4960457ea214a7708de7632692e1e9f769c838df07bf38aa48a39ce41b456c1b5749c86db98f2818e53850cfb0d12e3e5b48177c1c9f45cb220217554e7d3058b6b56b91a9d0ab23f29ea66a242f94db84f4306158c02e62bdcfee3fe9c500008a902cbf51c6f262384/etc/yum/universal-hooks/multi_pkgs/posttrans/ea-__WILDCARD__/500-restartsrv_httpdrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootea-apache24-config-1.0-190.193.3.cpanel.src.rpm����������������������������������������������������������������������������������������������������������������config(ea-apache24-config-runtime)ea-apache24-config-runtime�x�������������n�����X�#�fJj�������������������0e�����X����������������0e/e1e�'@D6T@D-�C���C�@C�C�q�Cq�Ch�@Cf@C94@C
��B^[@B-��A�@A��@Aju�Af�@A[�@AE��A!�@A!�@A�A��@��@PT�@,�@@�@@@?�Z@?�Z@?��?`c�?O@@?M�?w�?w�>�T@>�T@>��>��@>̻�>��>[Z�>K��>G�@>C��>9�>7�@>.��=�y@=�'�=�>�=ϛ�=p��=f#�=b/@=[��==E@=@=�@<�@<��@<��@<U=@<U=@<<0�<:�@<�@;��;��@;�|@;�*�;��@;�6@;^��;F��;-�@;l�:Ѥ@:ͯ�:�^@:�/@:��:�F@:��:�!�:�!�:��@:�@:~��:~��:W�:4��:W@9��@9�9���9��@9}�@9v�9l]�9WE�9P�@9D�CentOS Sources <bugs@centos.org> - 4.2.6p5-29.el7.centos.2Miroslav Lichvar <mlichvar@redhat.com> 4.2.6p5-29.el7_8.2Miroslav Lichvar <mlichvar@redhat.com> 4.2.6p5-29Miroslav Lichvar <mlichvar@redhat.com> 4.2.6p5-28Miroslav Lichvar <mlichvar@redhat.com> 4.2.6p5-27Miroslav Lichvar <mlichvar@redhat.com> 4.2.6p5-26Miroslav Lichvar <mlichvar@redhat.com> 4.2.6p5-25Miroslav Lichvar <mlichvar@redhat.com> 4.2.6p5-24Miroslav Lichvar <mlichvar@redhat.com> 4.2.6p5-22Miroslav Lichvar <mlichvar@redhat.com> 4.2.6p5-20Miroslav Lichvar <mlichvar@redhat.com> 4.2.6p5-19Miroslav Lichvar <mlichvar@redhat.com> 4.2.6p5-18Daniel Mach <dmach@redhat.com> - 4.2.6p5-17Miroslav Lichvar <mlichvar@redhat.com> 4.2.6p5-16Daniel Mach <dmach@redhat.com> - 4.2.6p5-15Miroslav Lichvar <mlichvar@redhat.com> 4.2.6p5-14Miroslav Lichvar <mlichvar@redhat.com> 4.2.6p5-13Miroslav Lichvar <mlichvar@redhat.com> 4.2.6p5-12Miroslav Lichvar <mlichvar@redhat.com> 4.2.6p5-11Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 4.2.6p5-10Miroslav Lichvar <mlichvar@redhat.com> 4.2.6p5-9Miroslav Lichvar <mlichvar@redhat.com> 4.2.6p5-8Miroslav Lichvar <mlichvar@redhat.com> 4.2.6p5-7Miroslav Lichvar <mlichvar@redhat.com> 4.2.6p5-6Miroslav Lichvar <mlichvar@redhat.com> 4.2.6p5-5Miroslav Lichvar <mlichvar@redhat.com> 4.2.6p5-4Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 4.2.6p5-3Miroslav Lichvar <mlichvar@redhat.com> 4.2.6p5-2Miroslav Lichvar <mlichvar@redhat.com> 4.2.6p5-1Miroslav Lichvar <mlichvar@redhat.com> 4.2.6p4-3Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 4.2.6p4-2Miroslav Lichvar <mlichvar@redhat.com> 4.2.6p4-1Rex Dieter <rdieter@fedoraproject.org> - 4.2.6p3-5.1Miroslav Lichvar <mlichvar@redhat.com> 4.2.6p3-5Bill Nottingham <notting@redhat.com> 4.2.6p3-4Miroslav Lichvar <mlichvar@redhat.com> 4.2.6p3-3Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 4.2.6p3-2Miroslav Lichvar <mlichvar@redhat.com> 4.2.6p3-1Miroslav Lichvar <mlichvar@redhat.com> 4.2.6p3-0.1.rc10Miroslav Lichvar <mlichvar@redhat.com> 4.2.6p2-7jkeating - 4.2.6p2-6Miroslav Lichvar <mlichvar@redhat.com> 4.2.6p2-5Miroslav Lichvar <mlichvar@redhat.com> 4.2.6p2-4Miroslav Lichvar <mlichvar@redhat.com> 4.2.6p2-3Miroslav Lichvar <mlichvar@redhat.com> 4.2.6p2-2Miroslav Lichvar <mlichvar@redhat.com> 4.2.6p2-1Miroslav Lichvar <mlichvar@redhat.com> 4.2.6p1-2Miroslav Lichvar <mlichvar@redhat.com> 4.2.6p1-1Miroslav Lichvar <mlichvar@redhat.com> 4.2.6p1-0.1.rc5Miroslav Lichvar <mlichvar@redhat.com> 4.2.4p8-1Miroslav Lichvar <mlichvar@redhat.com> 4.2.4p7-7Miroslav Lichvar <mlichvar@redhat.com> 4.2.4p7-6Tomas Mraz <tmraz@redhat.com> - 4.2.4p7-5Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 4.2.4p7-4Miroslav Lichvar <mlichvar@redhat.com> 4.2.4p7-3Miroslav Lichvar <mlichvar@redhat.com> 4.2.4p7-2Miroslav Lichvar <mlichvar@redhat.com> 4.2.4p7-1Miroslav Lichvar <mlichvar@redhat.com> 4.2.4p6-4Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 4.2.4p6-3Miroslav Lichvar <mlichvar@redhat.com> 4.2.4p6-2Miroslav Lichvar <mlichvar@redhat.com> 4.2.4p6-1Miroslav Lichvar <mlichvar@redhat.com> 4.2.4p5-2Miroslav Lichvar <mlichvar@redhat.com> 4.2.4p5-1Miroslav Lichvar <mlichvar@redhat.com> 4.2.4p4-7Miroslav Lichvar <mlichvar@redhat.com> 4.2.4p4-6Miroslav Lichvar <mlichvar@redhat.com> 4.2.4p4-5Miroslav Lichvar <mlichvar@redhat.com> 4.2.4p4-4Fedora Release Engineering <rel-eng@fedoraproject.org> - 4.2.4p4-3Miroslav Lichvar <mlichvar@redhat.com> 4.2.4p4-2Miroslav Lichvar <mlichvar@redhat.com> 4.2.4p4-1Miroslav Lichvar <mlichvar@redhat.com> 4.2.4p2-6Mirosl�x��������������]�����Xa#�eJj������������@�������o7���������������������o7�>cP�3e20ac274d1cc04adf924af41d7387f404012335c73ef798f557196b29e6baaecf11bbd30ad59cffdac3d58d75a07a5404012335c73ef798f557196b29e6baaecf11bbd30ad59cffdac3d58d75a07a5351bcfa8a0f49bbb6b70aee5b0de8b5f7103bf4cc88b7fb5ca9e0c2258254a061ccbb472f6006e1f13c636aa6995d1a16e4849a1bc9547110a355f05e4ad3e1b1b2b4678c4317804dc67dfd04c5a99a9a94196a58e74b455f87c9da3d57174e4d45b421af4c996e42500bca4b58c754b97a9e413e6e4fc0a9cc4a590e7c0b0b6b1bfadf6dd6887c8e753ff9b30aaefc4ed20ec9e00e375fb39c697909edb215972e8c72616c0d9bca4e28fbfc83438f2f3d207b47a3cee9f4072cc1ee2641c112908883713e5434d41d1ae2ef9a2f8c1f8f3593471c0a8d2267c3997bf0042e271b4e9e78d24209df0a786ee00973e0e42d113789dabea01e666cfb9c1cae64bb97081afd4d50b7b8d669c7bc4bffb162df15aa365734f8d9a78c82365b1317ea4a97ac3c1fd1218dd3837cda8f7e13f49d6bd86790a308993e79ce66211c11a1196ed25ac52bbb84ccde13edde4f6b2bf314ed966e78a2d4de0132f39cd7fc7f9220be50e079c1483e313c5893e458662686cb684e30aebcf1903416b1d67c965ca124890f241622d57c9d956a6d28a013a4575b4b70945f417ef4d6c6a1f6288c06fb0c74f29b093685ce715500bf6d1e676ea7b9322f6fb551c682d0b8ab83cf3ca59b262a5b10477d2079de106e8dbeafc08793f8fd427166184b765f7f18ec2fc8dcb27f1ee23fc8c6ee849ddaea7db2023c1127b27a096ec7921e8daa659da2d41bebd3e78f0dedf082b2b03181bc06b887af5f776265dcc734359022668cb4f58dd3ec68e17ea110c6795245b9d231e0805b88e9ae3f535228034b61eed7c24ecbc845f25175e8ecb65dcd4de8032d179a17dac71d044be37e4f847c6b0cd593916ed573beff808b85480004d5fac4b49076f3459b1540beaa4203c16ce7d68d19c77b39a4b858c9075726632a954dbb5edbe09f149f5f2524f29f02b3135271131d8823d5e41bfc2d163e4a0f7b7e7c04b19836a461a29aa7348d82ea1508e9438508dc5caffe28dd609878c7e4529dfb3515144a115966af3709658125812a072f653def04e53eb359eb07503e9d151839c178150b490169cb284210062608caf3fc6a7f1d89509be82fd889c583045506c655b36f54e1ffc18374a2b72c7d7fc5ed43a131cefcfd80cbacdc4ae97cce0be95ba4d4f44079d64f4d2c8105db872f8714d26d2e4af5a417aa82be5adbea9b0c6625a08cca56fa31aa7317005805878efa3196892da250b38c81a3e92830457f4d23b0ca4de36ba205b60fbb08fc5092937743ea58aa7983d458465cbaac12a05d67deb5d10e5b5c337fb9493bb4b697c6f9ce79881a0d70c7be0cb4678a69ef0cc95eadc2cf67bca4380d2bb19b184ec40bad4279c87f1f64aad40aa85711cd2da07aedc2989b16a37b782d6536c03e1121778211f5e8961e07855d460fb73f00320e373d0142f2641f99dd05179be9b4d267041b1b0d97c301e258fabc50e2834e3902f96e522d202c9bfd2229d17ef9dc8208d6e834160e8257cb83031ae0ba656a5d5df92ff2dd6c9bfd2229d17ef9dc8208d6e834160e8257cb83031ae0ba656a5d5df92ff2dd61ee95b2ed884b89f572766d5571fee3dea60f0af355a7e99531a50774f41b5671ee95b2ed884b89f572766d5571fee3dea60f0af355a7e99531a50774f41b567401a8656459c050ee5de304794c1a6b192596c201093526923e251feb2f8946c401a8656459c050ee5de304794c1a6b192596c201093526923e251feb2f8946c0155bcddca32ccf2c465d9c48f7ce61e59d6d491e7d30cae40205860153ea1c10155bcddca32ccf2c465d9c48f7ce61e59d6d491e7d30cae40205860153ea1c193db5d0276e12a5a1218279a4516f36fe76e73cec2966e7d307e61cb1a0c40c793db5d0276e12a5a1218279a4516f36fe76e73cec2966e7d307e61cb1a0c40c79bb61b342db8d5555c402dcf294e968e2720da72739efb318facf4063aaea2479bb61b342db8d5555c402dcf294e968e2720da72739efb318facf4063aaea2478dd4149401145bc0e25c9f6f6e1cb10bb37d0cf2d02cb149badb98b853d4c33c8dd4149401145bc0e25c9f6f6e1cb10bb37d0cf2d02cb149badb98b853d4c33c0990f53c807dd5e37c2a2913201e1ef3309dc4173ee573f9d343021df9e423ad0990f53c807dd5e37c2a2913201e1ef3309dc4173ee573f9d343021df9e423adb2b09c310d2dfda9f7c642421df406ab15450ea1f9c1bb97990c49a258f48159b2b09c310d2dfda9f7c642421df406ab15450ea1f9c1bb97990c49a258f48159ec683613cafb153c323c4570663e52b3ab00f68f97268237b07b4ca4a56a04e8ec683613cafb153c323c4570663e52b3ab00f68f97268237b07b4ca4a56a04e8734523dd1ee57937cd242e5cf1c91ec8f06d50252d2513f6b5d805a1ad29c276734523dd1ee57937cd242e5cf1c91ec8f06d50252d2513f6b5d805a1ad29c2765a4a1a51cdadb11ccbbaa7249025cc0d43ec4352eee4653df1151c3f94920fa95a4a1a51cdadb11ccbbaa7249025cc0d43ec4352eee4653df1151c3f94920fa962bd2e8e57182b15fc12c6d5adb583403ac258ae60f21b0176820c7fd46c54b462bd2e8e57182b15fc12c6d5adb583403ac258ae60f21b0176820c7fd46c54b4c8d28d8d63707993685941326913b731bfc47b6ef15e056e3c3d17184012be02c8d28d�x�����H�������L�����X#jgJj��������h�������e�����o����������������e>Pv��ׄ�V���;&��|�n�Ŗ�g%���J����z����s�r�e��n����V�S'���}�s'��ίN-ap��qW4!�`��ޛvL

�I���X�f� )�L�|����q}����C!�D�E����Vc�6a��r=�j�v�ya���|K`�eܲ���gg����F]����@�R�+�Z\��u����ë>�փ+Ϙ��Nt�/^�_�3�|ꉯW���]�<y������Ȃ����܈����JfLa;}��+w�5 �3��#v��7m{ۯ=<��,�Y�(Z��~���b�4N>:�^Ό�"	l�<�p�c�¿����V�]&�]9��ҽB]�5�����$�;x��P{�:��<,�@�� 3�9��~�)��r�ۅ�-.�3��m���f1v}��U:m��ߐӑz�m����Pd���e����R�S��ص�J�9�!�2�o������C?���xωi��#x��~�|P���( 3�.<g���Q4���]>nUr�0�Yfy�����+ڦ����"`"`7������B```H�q����YI�rg_|�	G6C;a�Pc\ǏK��	+WD���R�CM�%q���n]Ǹ�B`u��*S�D���PR���:%����Rx_�	�.WB��Kj��3��KA�qG6XQ���@�;���A���l��]��Ϫ?z�tOfUM
����
����#�#w������"�&���R��ek)C�ٮi�U?EU$�|xv
E�I{�(�(=SݠC�V�ed�I�;M�b\�`�8��z���h�V����:����POb�i�o�Bٮ�8����A�R���Q�.ѯ�Ȃ!�"�C0�̋3�����nMp�,�|JOJ��|���c�g��vj�/��ye�G��*o�x��f���N�����-c����Y����(�O-�	�*C̤j��(	�\��Ń��S�j�{i�nw�«���T4���-�D�-e�-��_d97a1d5756af2f49d3f4a860143bf2e24413dd41i�\,��i�F 1107619 1107620]
- [infiniband] mlx4: Fix SIDR support of for UD QPs under SRIOV/RoCE (Amir Vadai) [1107617 1107618 1107619 1107620]
- [infiniband] mlx4: Implement IP based gids support for RoCE/SRIOV (Amir Vadai) [1107617 1107618 1107619 1107620]
- [infiniband] mlx4: Add ref counting to port MAC table for RoCE (Amir Vadai) [1107617 1107618 1107619 1107620]
- [infiniband] mlx4: In RoCE allow guests to have multiple GIDS (Amir Vadai) [1107617 1107618 1107619 1107620]
- [infiniband] mlx4: For RoCE, allow slaves to set the GID entry at that slave's index (Amir Vadai) [1107617 1107618 1107619 1107620]
- [infiniband] mlx4: Adjust QP1 multiplexing for RoCE/SRIOV (Amir Vadai) [1107617 1107618 1107619 1107620]
- [infiniband] mlx5_core: remove unreachable function call in module init (Amir Vadai) [1107617 1107618 1107619 1107620]
- [infiniband] mlx5: Expose support for signature MR feature (Amir Vadai) [1107617 1107618 1107619 1107620]
- [infiniband] mlx5: Collect signature error completion (Amir Vadai) [1107617 1107618 1107619 1107620]
- [infiniband] mlx5: Support IB_WR_REG_SIG_MR (Amir Vadai) [1107617 1107618 1107619 1107620]
- [infiniband] mlx5: Keep mlx5 MRs in a radix tree under device (Amir Vadai) [1107617 1107618 1107619 1107620]
- [infiniband] mlx5: Remove MTT access mode from umr flags helper function (Amir Vadai) [1107617 1107618 1107619 1107620]
- [infiniband] mlx5: Break up wqe handling into begin & finish routines (Amir Vadai) [1107617 1107618 1107619 1107620]
- [infiniband] mlx5: Initialize mlx5_ib_qp signature-related members (Amir Vadai) [1107617 1107618 1107619 1107620]
- [infiniband] mlx5: Implement create_mr and destroy_mr (Amir Vadai) [1107617 1107618 1107619 1107620]
- [ethernet] mlx4: mlx4_en_verify_params() can be static (Amir Vadai) [1107617 1107618 1107619 1107620]
- [ethernet] mlx4: Change Connect-X description in kconfig (Amir Vadai) [1107617 1107618 1107619 1107620]
- [ethernet] mlx4: Use union for BlueFlame WQE (Amir Vadai) [1107617 1107618 1107619 1107620]
- [ethernet] mlx4: Fix sparse warning (Amir Vadai) [1107617 1107618 1107619 1107620]
- [ethernet] mlx4: Fix selftest failing on non 10G link speed (Amir Vadai) [1107617 1107618 1107619 1107620]
- [ethernet] mlx4: Replace mlx4_en_mac_to_u64() with mlx4_mac_to_u64() (Amir Vadai) [1107617 1107618 1107619 1107620]
- [ethernet] mlx4: Move queue stopped/waked counters to be per ring (Amir Vadai) [1107617 1107618 1107619 1107620]
- [ethernet] mlx4: Pad ethernet packets smaller than 17 bytes (Amir Vadai) [1107617 1107618 1107619 1107620]
- [ethernet] mlx4: Verify mlx4_en module parameters (Amir Vadai) [1107617 1107618 1107619 1107620]
- [ethernet] mlx4: Fix UP limit in ieee_ets->prio_tc (Amir Vadai) [1107617 1107618 1107619 1107620]
- [ethernet] mlx4: Fix bad use of dev_id (Amir Vadai) [1107617 1107618 1107619 1107620]
- [ethernet] mlx4: Expose port number through sysfs (Amir Vadai) [1107617 1107618 1107619 1107620]
- [ethernet] mlx: Bump all Mell�x�������������p<�����X##dgJj@�����8Y�����������d������������������	E���@redhat.com> 5.0.2-5Joe Orton <jorton@redhat.com> 5.0.2-4Joe Orton <jorton@redhat.com> 5.0.1-4Joe Orton <jorton@redhat.com> 5.0.1-3Joe Orton <jorton@redhat.com> 5.0.1-2Joe Orton <jorton@redhat.com> 5.0.1-1Tom Callaway <tcallawa@redhat.com>Tom Callaway <tcallawa@redhat.com>- EA4-136: Fix libxml2 v2.15.0 compatibility- ZC-12167: Correct libxml2 problem- EA-11821: Patch to build with the latest ea-libxml2- ZC-10950: Fix build problems- ZC-10936: Clean up Makefile and remove debug-package-nil- EA-10532: Update litespeed to 8.0.1- ZC-9589: Update DISABLE_BUILD to match OBS- EA-9013: Disable %check section- EA-9625: Update litespeed to 7.9- EA-9390: Fix build with latest ea-brotli (v1.0.9)- EA-9281: Update litespeed from upstream to 7.8- EA-9189: Update litespeed from upstream to 7.7- EA-8928: Updated the required version for ea-libcurl- ZC-6270: Fix circular deps like EA-8854- ZC-6247: Remove multiple conflicts between php-fpm and other rpms- EA-8762: Update litespeed from upstream to 7.6- ZC-4361: Fix bogus changelog dates- EA-8549: Build php-fpm with pcntl- EA-8576: Update litespeed from upstream to 7.5- EA-8558: Update litespeed from upstream to 7.4.2- EA-8538: Update litespeed from upstream to 7.4- ZC-5036: Add find-latest-version (assumes PHP is checked out next ro ea-tools)- EA-8342: Update litespeed to new upstream update of 7.3- EA-8342: Update litespeed to 7.3- Update litespeed to the lastest version (7.2)- Fixed php-fpm installing directories it does not own (EA-7526)- EA-7359: Ensure ea-libxml2 is listed as a requirement for the php-xml package.- ZC-3600: Update litespeed to the latest version (7.1).- EA-7382: Update dependency on ea-openssl to require the latest version with versioned symbols.- ZC-3552: Added versioning to ea-openssl and libcurl requirements.- ZC-3475: Update for ea-openssl shared object- HB-3287: Increase open file limit for php-fpm by default- HB-3263: Ensure securetmp is done before starting FPM- EA-7044: Adjust PHPs to use ea-libxml2- HB-3061: Fix epoll bug.- EA-7008: init openssl for FTP like 7.x does- EA-6812: build PHP against ea-openssl like Apache- EA-4653: Update mail header patch for PHP 5.4- HB-2873: Added network-online.target to "After" in the service file- EA-6819: Patch to support libtidy 5.4.0- EA-6805: Apply PHP_INI_SCAN_DIR patch to PHP 5.4- EA-4197: make php.ini directives consistent w/ other versions- EA-6574: Make permissions on FPM socket dir more secure- EA-6484: Clarify Summary and Description for DSO- EA-6232: Build -curl with HTTP/2 support- Switch libxml2 to OS provided libraries- EA-6282: Swapped ea-php## symlinks to match EasyApache 3 compatibility- Switch libxml2 to cPanel distributed packages- Added ea-php54 symlinks to /usr/bin and /usr/local/bin- Disable dtrace functionality since CentOS does not provide dtrace via repos.- EA-6031: Enable mssql option and use our ea-freetds instead of freetds- ZC-2475: PHPs need build reqs when building for libcurl- EA-2422: Have PHPs use our ea-libcurl- EA-5946: force requirement of ea-libtidy instead of .so from BuildRequires ea-libtidy-devel- EA-5807: enable php-tidy on rhel 6 and above- EA-3685: do not create apache user/group since we use nobody- Fix erronous getpwnam message in php-fpm jailshell code- Make php-cli require php-litespeed- Ensure the same extensions are compiled statically across all
  SAPI types (EA-5587)- Set register_argc_argv default on to match EasyApache 3- Force users on jailshell and noshell to be chrooted when using php-fpm- Changed php-fpm.d directory to 0710 (EA-5097)- Applied patch in spec from from previous version- Disallow php-fpm from loading .user.ini files outside of homedir- EA-4383: Update Release value to OBS-proof versioning- Removed unused global session cache directory (EA-4692)- Added EasyApache 3 backwards compatibility php.ini patch (EA-4663)- Bumped Release Number for consistency- Enabled LiteSpeed Module- Now uses bundled gd (ZC-1562)
- Updated descriptions to use scl_prefix macros�x��������������+�����XD#CfJj0T������(�������`���������������������`ta�- 7.3.18-3Tim Mullin <tim@cpanel.net> - 7.3.18-2Cory McIntire <cory@cpanel.net> - 7.3.18-1Cory McIntire <cory@cpanel.net> - 7.3.17-1Tim Mullin <tim@cpanel.net> - 7.3.16-2Cory McIntire <cory@cpanel.net> - 7.3.16-1Julian Brown <julian.brown@cpanel.net> - 7.3.15-2Cory McIntire <cory@cpanel.net> - 7.3.15-1Tim Mullin <tim@cpanel.net> - 7.3.14-2Cory McIntire <cory@cpanel.net> - 7.3.14-1Daniel Muey <dan@cpanel.net> - 7.3.13-2Cory McIntire <cory@cpanel.net> - 7.3.13-1Tim Mullin <tim@cpanel.net> - 7.3.12-2Cory McIntire <cory@cpanel.net> - 7.3.12-1Cory McIntire <cory@cpanel.net> - 7.3.11-1Cory McIntire <cory@cpanel.net> - 7.3.10-1Tim Mullin <tim@cpanel.net> - 7.3.9-2Cory McIntire <cory@cpanel.net> - 7.3.9-1Cory McIntire <cory@cpanel.net> - 7.3.8-1Cory McIntire <cory@cpanel.net> - 7.3.7-3Cory McIntire <cory@cpanel.net> - 7.3.7-2Cory McIntire <cory@cpanel.net> - 7.3.7-1Tim Mullin <tim@cpanel.net> - 7.3.6-2Cory McIntire <cory@cpanel.net> - 7.3.6-1Julian Brown <julian.brown@cpanel.net> - 7.3.5-2Cory McIntire <cory@cpanel.net> - 7.3.5-1Daniel Muey <dan@cpanel.net> - 7.3.4-4Tim Mullin <tim@cpanel.net> - 7.3.4-3Tim Mullin <tim@cpanel.net> - 7.3.4-2Cory McIntire <cory@cpanel.net> - 7.3.4-1Cory McIntire <cory@cpanel.net> - 7.3.3-2Cory McIntire <cory@cpanel.net> - 7.3.3-1Cory McIntire <cory@cpanel.net> - 7.3.2-2Dan Muey <dan@cpanel.net> - 7.3.2-1- EA4-136: Fix libxml2 v2.15.0 compatibility- ZC-12246: Correct conffiles for Ubuntu- ZC-12167: Correct libxml2 problem- ZC-12166: remove _isa since it is incorrect- EA-10753: Have snmp module require 'snmp-mibs-downloader' for deb- EA-11821: Patch to build with the latest ea-libxml2- ZC-10950: Add debug_package nil back w/ second directive (3rd item will be ZC-10951)- ZC-10936: Clean up Makefile and remove debug-package-nil- ZC-10873: Do not build on Ubuntu 22- EA-11039: Ensure php.ini is marked as a config file on debian based systems- EA-10532: Update litespeed to 8.0.1- ZC-9628: Ensure sqlite3 is linked into pdo_sqlite.so- ZC-9245: Correct dependency issue on Ubuntu- EA-10281: Update scl-php73 from v7.3.32 to v7.3.33- ZC-9470: Remove gmp extension from common’s built-in Provides list- EA-10237: Update scl-php73 from v7.3.31 to v7.3.32- ZC-9365 : Correct build issues with Ubuntu- EA-10132: Update scl-php73 from v7.3.30 to v7.3.31- EA-10074: Update scl-php73 from v7.3.29 to v7.3.30- EA-9923: Update scl-php73 from v7.3.28 to v7.3.29- EA-9013: Optimize %check section- EA-9730: Update scl-php73 from v7.3.27 to v7.3.28- EA-9625: Update litespeed to 7.9- EA-9568: Update scl-php73 from v7.3.26 to v7.3.27- EA-9518: Update scl-php73 from v7.3.25 to v7.3.26- ZC-8005: Replace ea-openssl11 with system openssl on C8- EA-9451: Update scl-php73 from v7.3.24 to v7.3.25- EA-9403: Update scl-php73 from v7.3.23 to v7.3.24- ZC-7893: Update DSO config to factor in PHP 8- EA-9390: Fix build with latest ea-brotli (v1.0.9)- EA-9337: Update scl-php73 from v7.3.22 to v7.3.23- EA-9281: Update litespeed from upstream to 7.8- EA-9283: Update scl-php73 from v7.3.21 to v7.3.22- EA-9223: Update scl-php73 from v7.3.20 to v7.3.21- EA-9189: Update litespeed from upstream to 7.7- EA-9153: Update scl-php73 from v7.3.19 to v7.3.20- ZC-6964: Build on C8- EA-9111: Update scl-php73 from v7.3.18 to v7.3.19- EA-9087: Fix PHP version in DSO description- EA-9071: Revert new .user.ini search behavior- EA-9068: Update scl-php73 from v7.3.17 to v7.3.18- EA-9009: Update scl-php73 from v7.3.16 to v7.3.17- EA-8928: Updated the required version for ea-libcurl- EA-8932: Update scl-php73 from v7.3.15 to v7.3.16- ZC-6247: Remove conflict between php-fpm and runtime.- EA-8874: Update scl-php73 from v7.3.14 to v7.3.15- EA-8854: Fix circular dependencies in our PHP packages- EA-8851: Update scl-php73 from v7.3.13 to v7.3.14- ZC-4361: Update ea-openssl requirement to v1.1.1 (ZC-5583)- EA-8798: Update scl-php73 from v7.3.12 to v7.3.13- EA-8762: Update litespeed from upstream to 7.6- EA-8761: Update scl-php73 from v7.3.11 to v7.3.12- EA-8719: U�x�������������`�����XH# gJj������������SS������;����������������S����
 for segfault in variable parsing introduced in 5.0.2- update to 5.0.2 (#127980)
- build against mysqlclient10-devel
- use new RTLD_DEEPBIND to load extension modules
- drop explicit requirement for elfutils-devel
- use AddHandler in default conf.d/php.conf (#135664)
- "fix" round() fudging for recent gcc on x86
- disable sqlite pending audit of warnings and subpackage split- don't build dom extension into 2.0 SAPI- ExclusiveArch: x86 ppc x86_64 for the moment- fix default extension_dir and conf.d/php.conf- update to 5.0.1
- only build shared modules once
- put dom extension in php-dom subpackage again
- move extension modules into %{_libdir}/php/modules
- don't use --with-regex=system, it's ignored for the apache* SAPIs- Merge in some spec file changes from Jeff Stern (jastern@uci.edu)- bump to 5.0.0
- add patch to prevent clobbering struct re_registers from regex.h
- remove domxml references, replaced with dom now built-in
- fix php.ini to refer to php5 not php4hou-2 17768065435.5.38-64.65.14.cpanel5.5.38-64.65.14.cpanelsoap.inisoap.so/opt/cpanel/ea-php55/root/etc/php.d//opt/cpanel/ea-php55/root/usr/lib64/php/modules/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1  -m64 -mtune=genericobs://private/EA4-production/CentOS_7/e38ad767615740854ededd9f4cf2e315-scl-php55cpioxz2x86_64-redhat-linux-gnu��&4�^@��~p�?����n�i��#x��~�|�` �&���C>ՏV���G��� ��٘$L~<��Z�1�E�bo�3��L;X�&�����EOM����|obx�=��*"��+�ݮ�2Tr�A�y�a0���印K��_7P��P�t��hNCZR˔p�yD��,�z�<�����y�q�m~#���e~mh�}����A��F�1�k#Mn���!M졌x߹�C�s-�׵_����%�}�U���K���y�#L昨�X��wX�¦g��Uuϼ��"��ZR�$�����A�ɉo��?�W]��F��`���
��2�[\�6�ᮕߘ�?`&V�ƥ�����SR#���������"�+T8p*HN�מ�(�S�%�H�˨���*�/˭�Sl'���l�h�+˖�^惄5�;��B���K��S�l(��錊���C��2��	F�dX~L�B?g��<y4E���&4��\)�=Ծ�[�F� �B�*����!,~�C�P+T���5��gn�ͤ�%�����^�N|'��T�#w)o�OU�i��#x��~�|�M���v|�[�ټ�'�m8)RJF��
��8�|�j��s�85��/4�|aW��Ft~�PA�����5R���&�t�_*0䖥�RZ9���S�!�"p'�ޱt�h^��� ��AO�n��v����]|�S�mNծ�C|x0i�=�D1�gg��C�" nb<_5~{a�!�*�e��f|a*'|���JQ��/�3A(�(Q��!�F\W�P����;�1�4%}+D`�L>��oO��zZ u��K�4jI�e�p�ym4`C��x�]~���z{��&�J�'tXoʞ/yUd}�m*�i=�7�P�Cq��a���!*C���d�u
z��B�]��=��x�s#L���.H٘�K��9�(sW�Q5�SAfh
��cv�}h��K�3?���}X���9�M@���	�M0�q��^�$��@"����g�q7�*�o�;����Y�]
ԝ�h��rz�r0�Up��+�/����d�Ǹ$�~A��urɛddd4d75ed01fd2c5d0519489f5b97479040bb653i�[όi�F- [drm] nouveau: attempt to disarm all interrupts before request_irq() (Ben Skeggs) [986654]
- [drm] nouveau: disable runtime pm by default (Ben Skeggs) [1072481]
- [s390] appldata_os: fix cpu array size calculation (Hendrik Brueckner) [1071354]
- [s390] cio: Fix missing subchannels after CHPID configure on (Hendrik Brueckner) [1071248]
- [s390] pci/dma: use correct segment boundary size (Hendrik Brueckner) [1071239]
- [scsi] isci: fix reset timeout handling (David Milburn) [1040402]
- [wireless] ath9k: Add custom parameters for CUS198 (John Green) [1044005]
- [ethernet] bnx2x: utilize FW 7.8.19 (Michal Schmidt) [1058008]
- [fs] fix the performance of reading /proc/mounts and friends (Alexander Viro) [1072461]
- [fs] namespace: mount hash table is too small (Alexander Viro) [1072451]
- [fs] xfs: inode log reservations are still too small (Brian Foster) [1071068]
- [fs] aio, memory-hotplug: Fix confliction when migrating and accessing ring pages (Motohiro Kosaki) [1060974]
- [x86] only add -Werror when using RHEL7 gcc (Stefan Assmann) [1073055]
- [mm] filemap: fix truncation crash due to exceptional entries (Johannes Weiner) [1069295 1071162]
- [mm] Add kernel and mm data structure padding before kABI freeze (Larry Woodman) [1071438]
- [pci] add pci_hw_vendor_status() (Prarit Bhargava) [1073062]
- [cpufreq] pcc: Enable autoload of pcc-cpufreq for all AC�x��������������
�����XL#3fJj����0������z������:Y�����R����������������:Y9Y�ibs), for GNU/Linux 2.6.32, BuildID[sha1]=8d76c4661abc1e0cf06ccd7bddeebdfe072a8dce, strippedELF 64-bit LSB executable, x86-64, version 1 (SYSV), dynamically linked (uses shared libs), for GNU/Linux 2.6.32, BuildID[sha1]=ae965bdf0b176c29193daa9c8601d039e2394098, strippedELF 64-bit LSB executable, x86-64, version 1 (SYSV), dynamically linked (uses shared libs), for GNU/Linux 2.6.32, BuildID[sha1]=a322dd9c65411f07c163eeb9b7aa582b60537453, strippedELF 64-bit LSB executable, x86-64, version 1 (SYSV), dynamically linked (uses shared libs), for GNU/Linux 2.6.32, BuildID[sha1]=1655cb34e1f85e3ea86097f5668c3274bde46ced, strippedELF 64-bit LSB executable, x86-64, version 1 (SYSV), dynamically linked (uses shared libs), for GNU/Linux 2.6.32, BuildID[sha1]=9ef409539d45099b23a7aae66bfe5008fe14ee54, strippedELF 64-bit LSB executable, x86-64, version 1 (SYSV), dynamically linked (uses shared libs), for GNU/Linux 2.6.32, BuildID[sha1]=7bfe434ed9f9ca2d9d3b407dad09643e4b00239d, strippedELF 64-bit LSB executable, x86-64, version 1 (SYSV), dynamically linked (uses shared libs), for GNU/Linux 2.6.32, BuildID[sha1]=e0bdf7892e102efd1da179c17a706c260fb70cab, strippedELF 64-bit LSB executable, x86-64, version 1 (SYSV), dynamically linked (uses shared libs), for GNU/Linux 2.6.32, BuildID[sha1]=eb950642b260fa363c1cc29323a1389d975416bc, strippedELF 64-bit LSB executable, x86-64, version 1 (SYSV), dynamically linked (uses shared libs), for GNU/Linux 2.6.32, BuildID[sha1]=f4734340004425564addb28f5c7103447e46aaad, strippeddirectoryASCII text'3AKL]lv�����


	R/R(R"RRRRRR
R	RRR!R.RR3RRR
R
R	RR$R"R!RR3RR
R	RR(R)R&R"R!RRR3RR	R
RR(R)R*R"R!RRR3RRR
R	RR%R$R*R&R"R!RRR3RR	R
RR)R"RR!RR3RRRR/R(R"RRR
R
R	RRR!RR.RR3RRR(R"RRR
R
R	RRR!RRR3RR
R
RR	R$R"R!RR3RRRRRR RRRRRR#R'R(R)R$R*R&R"RR
R
R	RRR!RRR3R	RR
RR(R)R"R!RR3R"R/RRRRR
R	RR!RRR.RR3R(R"RR	R
RR!RR3RRRRR
RRR	R(R)R*R"R!RRRR3R,R-RRRRR	RR
R
RRR(R)R"R!RRR+RR3?����ɼ�_�G�$ƨ������Z���3֙aג��f8Q�k��[�m�ݸy�	�L��Z���!���Qa'�[X��1�>�X����G2}�&�&�ޞ3��Y릪 3g����\˱���%�a�_X7̌��Kp�怚2A�yz4�&G�|H�:�Zܚ�P�ޖx�Ʊ�ºR���K~1��n勒�H՝k`T�ʪV�c���2kxd�+�m
�%@���g``Ð��|�O��y׉�Y|zd��"��T3��[���򈁒`F��W��z��"j&��H���]v���F�MyC-
�	���
��f���΀$�@�#E4�C�
B�p�)D���!�ڴ��+�����u�V�2,�!f.&��#�&*~K�{'��(o�Z���A�Tw�AZM��~܃.l���Al޼D�Z��I�C�t|O�RAEʏ^bq|�Y�T�Y��2az Z4
���)}U�N��|��?������/��Q��;TL��:τ�
]�QJl���h�zi�o�W����w���=�h.�Yna�6â���_�G�$ƨ���,8�b�iF�Q�Hc��;IӶ�TIC2�s]z��=�}�4��=!�jl��f	x��M�$D��uw�97��NQ�kSf
�c&J�f���8��-�t��%���2�"�E�pN+'�=I��i4�F��
2��f@�k�H��$�>QA|e��ho��J�QqV�f3c����GUGFA�QK7Ej�Ҍ3W�%ɨ���,(�3b�ɘ�L4fgӟbT�C𾧴������	S3� �>�k��X�����2W���j�ֻޚpPx��d��HUZ���,τo���S��>a�MZM����e&ʐbѨh��*���v�OE�77FL��y���IC!� �2��9b�Lj��y�َȤ �����p��*�/�������q;Y��'� ��)#�����%�W���1SYQ:�J�㚳(�l��hQ����^R��k�H�-�ym���M��_�7���/��L�� ����E��L�N��b023ec3820f8f83f2e9fa29be1d5ce9a59d7fc85bL���8bL�ȣL��GB]��C�y����ejo�on-�3ߌ0��e}��N"W�TL��.p�ϒ,�h���X�I4Xi�؜z������}�g_
��c��g� �����7��C�*j�>]�����o�P'v��G(aE�k�������O��ɏ-x���7�8"D��crc��y�v<<T�px�@��Qd�D�i��tձ1N��棋X�*r:�P�9C���IɌK@�+�������t�(��ONr�L�����8O1�yq�=-�D�@x�������������0�������@Nameamese��8�������������������X�#�fJj��������������������y�����W�����������������y<C?4d����	!�	Q���������������	%�1�7>��	
�
������(@�(�8�9:r>�G�H�I�X�Y�\�]�^$bHd�e�f�l�tuvw x(�0DH6~�6

��
�
�
�g
�hCalt-common-release1.0.01.el7TuxCare alt common ELS repository configurationThis package configures the TuxCare alt common ELS repository for CentOS/RHEL systems.h���buildfarm03-new.corp.cloudlinux.com
;CloudLinuxCloudLinuxGPLv2+CloudLinux Packaging Team <packager@cloudlinux.com>Unspecifiedlinuxx86_64# Amazon Linux 2
if [ -f /etc/system-release ] && grep -qi "amazon linux release 2" /etc/system-release; then
    sed -i 's/\$releasever/7/g' /etc/yum.repos.d/alt-common-els.repo
fiW䁤��h���h���aea2cdacbbb1d4966df708f176954eef3006f8b6d9ae371858cd4cfeceea5c9a763c0b575935d5f9d01b6853829724d9d4a7fca9a1e393067e8cfdefc2ee4f63rootrootrootrootalt-common-release-1.0.0-1.el7.src.rpm��������alt-common-releasealt-common-release(x86-64)config(alt-common-release)



/bin/shconfig(alt-common-release)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)1.0.0-1.el73.0.4-14.6.0-14.0-15.2-14.11.3h�f@h��Koba Karaputadze <kkaraputadze@cloudlinux.com> - 1.0.0-1Koba Karaputadze <kkaraputadze@cloudlinux.com> - 1.0.0-0- Add support for Amazon Linux 2- Initial package/bin/sh1.0.0-1.el71.0.0-1.el71.0.0-1.el7RPM-GPG-KEY-TuxCarealt-common-els.repo/etc/pki/rpm-gpg//etc/yum.repos.d/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches   -m64 -mtune=genericcpioxz2x86_64-redhat-linux-gnuASCII text?���pT�3!�ׅ���s�z����{�P�fh���
	�{�P�f���ei���!o�z�j+[��\MUP��6��@Q����ԞBeB��׎���(Ƃe��e�3@d蚹|y*O_Tou��Q�d�Kr��Ի�~�J�s3�z�.(�d�2�x3C|�A?�X��HY���Nd��G��S�}�t��&V�E�J�{(���ҟ/�sR�3|Ğu^�a
{s�T�(߫|�>��P�WC���jh���V�A�u�-�&�SgZ#V���n�6�gy��0̛U�]�{�Vf0�u��r�m.RX�ܤ�HC1bWʢ7ܝ��GC���YN!����r��6�\��n��K��d.?>�jD������p-��&�J!�*�X�����Q������z��E��:\G����x�H �X�x����a(�<UK�?�)��i��7R?aq��e"�Ц<ʰ�{B5�0�j��/��Y��b��w�_?�W�LxT	�s��Pg�,��C� N*IbNT�"q�N���y^9��j-d!�W�FN��I���)%��$|Ǫ��{�R��DB�t�V�3!�ׅ���s�z����{�P�fh���
	�{�P�f�_�B�u��8v�(TiZ�~���M�-�	ߦ���� ܢ�b�77����Z�GB0���8�1�mӊi�	�J3K�|oZ��fj�~�"�5��ē�A�Q,���v�ʪz��	�%� v���o�LW�ùT?S�ԝ������*+�>�D��ËU=[��聐+��!���"8�wg���M�o�=|i�s��$92TC˽��	b��}��__�����F��0Q�	9��w����2A�R�5&	P�.��,�Y��6Bʧ�=��W1���wS�6���f���~�0����ˊӁ�wcM zk���b�4�%'
Ѹ��
]�yp&1Y��yT�M#�w#gP��5�AB/�5+@3�m�N�k.����^5���G�)G�������@�"���ޮ�/���ig��Ct_��W���q�@	��|�~)��fhHp2�����
�סּٺa�>!�N�6�S$<ރ�!����n�C��n��3	��$�M@���h`0���33735adb854bcb45c697b3cd02178e0a9e71b69eh��5�h��4otrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootro�x��������������������X�#�fJj���������������(�����H�����������������(�8X?
�d���!�	-�	i���������	����
�4	@
Ld�
�&Dx���(�89:�G`HxI�X�Y�\	X]	p^	�b
1d
�e
�f
�l
��
�
�@DLgPhTCcpanel-perl-536-ipc-run30.0481.cp108~el7CPAN module - run a subprocess with input/ouput redirectionCpanel build perl module 'IPC::Run3'run a subprocess with input/ouput redirectionb�Xbh-centos-7.dev.cpanel.net�open_sourcecpanel/perlhttps://metacpan.orglinuxnoarch`&��
���$�$�$�$�$�$S6�S6�S6�S6�S6�S6�597dfd873f4032e2dd1f2b712dfba5cf8ff3108716ee3e30e090bbc224daa1aa53a52f106a73e06d28c217f0a01e95863134d649552e9998cf61715774cb7ae00c26ef5441b3b75190758e1f80d4bdd42d292cb4e6212a41b36e5afde44521c18262c5905bf3ecca22eec990867427c7128d66bb5a95391f25f78ef2f519f6e50bdd8a11cce307f2c00dd83b470199dab5f88ca3a670535cb0faf5a588f3937f2425a066647c70318872969a8892ea94b61ab7d87bcddf6dd39d3ada55df280drootrootrootrootrootrootrootrootrootrootrootrootcpanel-perl-536-ipc-run3-0.048-1.cp108~el7.src.rpm������������������������cpanel-perl(IPC::Run3)cpanel-perl(IPC::Run3::ProfArrayBuffer)cpanel-perl(IPC::Run3::ProfLogReader)cpanel-perl(IPC::Run3::ProfLogger)cpanel-perl(IPC::Run3::ProfPP)cpanel-perl(IPC::Run3::ProfReporter)cpanel-perl-536-ipc-run3-profarraybuffercpanel-perl-536-ipc-run3-profloggercpanel-perl-536-ipc-run3-proflogreadercpanel-perl-536-ipc-run3-profppcpanel-perl-536-ipc-run3-profreportercpanel-perl-ipc-run3cpanel-perl-ipc-run3-profarraybuffercpanel-perl-ipc-run3-profloggercpanel-perl-ipc-run3-proflogreadercpanel-perl-ipc-run3-profppcpanel-perl-ipc-run3-profreportercpanel-perl-536-ipc-run3




cpanel-perl-536cpanel-perl-536-test-morecpanel-perl-536-time-hiresrpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(CompressedFileNames)rpmlib(PayloadIsXz)rpmlib(TildeInVersions)0.314.6.0-14.0-13.0.4-15.2-14.10.0-14.11.1b�@`-@S>��Q+R@Busy Camels <bc@cpanel.net> - 0.048-1.cp108Busy Camels <bc@cpanel.net> - 0.048-1.cp1198Todd Rinaldo <toddr@cpanel.net> - 0.048-1.cp1146Todd Rinaldo <toddr@cpanel.net> - 0.045-1.cp1136- Bump to 1.cp108 for re-build- Bump to 1.cp1198 for debian re-build- Update from upstream: IPC-Run3 0.048- Update from upstream: IPC-Run3 0.0450.0480.0480.0480.0480.0480.0480.0480.0480.0480.0480.0480.0480.0480.0480.0480.0480.0480.048-1.cp108~el7Run3.pmProfArrayBuffer.pmProfLogReader.pmProfLogger.pmProfPP.pmProfReporter.pm/usr/local/cpanel/3rdparty/perl/536/cpanel-lib/IPC//usr/local/cpanel/3rdparty/perl/536/cpanel-lib/IPC/Run3/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches   -m64 -mtune=genericcpioxz2noarch-redhat-linux-gnu?���;�tj9���$��z���Rf44e021474402d79f857e74d7a4e2cc15b682246c�VE��c�VAire <cory@cpanel.net> - 8.0.14-1Cory McIntire <cory@cpanel.net> - 8.0.13-1Dan Muey <dan@cpanel.net> - 8.0.12-2Cory McIntire <cory@cpanel.net> - 8.0.12-1Tim Mullin <tim@cpanel.net> - 8.0.11-4Julian Brown <julian.brown@cpanel.net> - 8.0.11-3Cory McIntire <co�x�������������������X0#egJj(A������������������e����������������������� (like php7)- mod_php adjusted to conflict with other mod_php versions, and
  not itself.  this lets the user reinstall the package without
  conflict. (ZC-1459)- Added imap extension for all CentOS versions.  It now depends on
  our internal SCL libc-client package.- Add story to previous changelog entry- Improve DSO conflicts (EA-3751)- mod_php requires a non-threaded Apache mpm (EA-3982)- Enabled short_open_tags (ZC-1283)- Disable ZTS support (EA-3790)- make ea-php5x-php-fpm depend on ea-php5X-php-cli (EA-3836)- Rename www.conf to www.conf.example (ZC-1204)- Use libphp5.so as module name for simplicity/consistency (EA-3750)- Updated to version 5.4.45 via update_pkg.pl- Updated to version 5.4.44 via update_pkg.pl- Enabled mcrypt for all builds- Moved "ea-php-cli" to correct package- Fixed name for "ea-php-cli" in requirement- Added php-cli requirement- Fix macros.php syntax error- Change ea-apache2 to ea-apache24- Set imap and recode to be incompatible- Upgrade to PHP 5.4.38
- Made compatible with EA4 web server- fileinfo: fix out-of-bounds read in elf note headers. CVE-2014-3710- xmlrpc: fix out-of-bounds read flaw in mkgmtime() CVE-2014-3668
- core: fix integer overflow in unserialize() CVE-2014-3669
- exif: fix heap corruption issue in exif_thumbnail() CVE-2014-3670- fix heap-based buffer over-read in DateInterval CVE-2013-6712
- gd: fix NULL pointer dereference in gdImageCreateFromXpm().
  CVE-2014-2497
- gd: fix NUL byte injection in file names. CVE-2014-5120
- spl: fix use-after-free in ArrayIterator due to object
  change during sorting. CVE-2014-4698
- spl: fix use-after-free in SPL Iterators. CVE-2014-4670
- core: fix heap-based buffer overflow in DNS TXT record
  parsing. CVE-2014-4049
- network: fix segfault in dns_get_record
  (incomplete fix for CVE-2014-4049). CVE-2014-3597
- core: type confusion issue in phpinfo(). CVE-2014-4721
- core: unserialize() SPL ArrayObject / SPLObjectStorage
  type confusion flaw. CVE-2014-3515
- fileinfo: fix infinite recursion. CVE-2014-1943
- fileinfo: fix out-of-bounds memory access. CVE-2014-2270
- fileinfo: fix extensive backtracking CVE-2013-7345
- fileinfo: cdf_unpack_summary_info() excessive looping
  DoS. CVE-2014-0237
- fileinfo: CDF property info parsing nelements infinite
  loop. CVE-2014-0238
- fileinfo: cdf_read_short_sector insufficient boundary
  check. CVE-2014-0207
- fileinfo: fix extensive backtracking in regular expression
  (incomplete fix for CVE-2013-7345). CVE-2014-3538
- fileinfo: cdf_check_stream_offset insufficient boundary
  check. CVE-2014-3479
- fileinfo: cdf_count_chain insufficient boundary check
  CVE-2014-3480
- fileinfo: fix mconvert incorrect handling of truncated
  pascal string size. CVE-2014-3478
- fileinfo: cdf_read_property_info insufficient boundary
  check. CVE-2014-3487
- fileinfo: fix cdf_read_property_info
  (incomplete fix for CVE-2012-1571). CVE-2014-3587- allow multiple paths in ini_scan_dir #1058162- add security fix for CVE-2013-6420- disable mod_php for httpd24- relocate RPM macro #1008483
- remove ZTS conditional stuf for ligibility
- add mod_php for httpd24 collection- fix enchant package summary and description
- add security fix for CVE-2013-4248- improve mod_php, pgsql and ldap description
- add missing man pages (phar, php-cgi)
- add provides php(pdo-abi) for consistency with php(api) and php(zend-abi)
- use %__isa_bits instead of %__isa in ABI suffix #985350- add security fix for CVE-2013-4113
- add missing ASL 1.0 license- run tests during build- rebase to 5.4.16
- fix hang in FindTishriMolad(), #965144
- patch for upstream Bug #64915 error_log ignored when daemonize=0
- patch for upstream Bug #64949 Buffer overflow in _pdo_pgsql_error, #969103
- patch for upstream bug #64960 Segfault in gc_zval_possible_root- remove wrappers in /usr/bin (#966407)- rebuild for libjpeg (instead of libjpeg_turbo)
- fix unowned dir %{_datadir}/fpm and %{_libdir}/httpd (#956221)- update to 5.4.14
- clean old deprecated options- update to 5.4.13
- security fixes for CVE-2013-163�x�������������x������X#:gJj�������H������;�����;�����������������;�s�K�h for fixing a use-before-init in a test program
  - drop obsolete patch teaching config.guess/config.sub about aarch64-linux
  - drop backport for RT#7598
  - drop backport for RT#7172
  - drop backport for RT#7642
  - drop backport for RT#7643
  - drop patches from master to not test GSSRPC-over-UDP and to not
    depend on the portmapper, which are areas where our build systems
    often give us trouble, too; obsolete
  - drop backports for RT#7682
  - drop backport for RT#7709
  - drop backport for RT#7590 and partial backport for RT#7680
  - drop OTP backport
  - drop backports for RT#7656 and RT#7657
- BuildRequires: libedit-devel to prefer it
- BuildRequires: pkgconfig, since configure uses it- create and own /etc/gss (#1019937)- pull up fix for importing previously-exported credential caches in the
  gssapi library (RT# 7706, #1019420)- backport the callback to use the libkrb5 prompter when we can't load PEM
  files for PKINIT (RT#7590, includes part of #965721/#1016690)
- extract the rest of the fix #965721/#1016690 from the changes for RT#7680- fix trigger scriptlet's invocation of sed (#1016945)- rebuild with keyutils 1.5.8 (part of #1012043)- switch to the version of persistent-keyring that was just merged to
  master (RT#7711), along with related changes to kinit (RT#7689)
- go back to setting default_ccache_name to a KEYRING type- pull up fix for not calling a kdb plugin's check-transited-path
  method before calling the library's default version, which only knows
  how to read what's in the configuration file (RT#7709, #1013664)- configure --without-krb5-config so that we don't pull in the old default
  ccache name when we want to stop setting a default ccache name at configure-
  time- fix broken dependency on awk (should be gawk, rdieter)- add missing dependency on newer keyutils-libs (#1012034)- back out setting default_ccache_name to the new default for now, resetting
  it to the old default while the kernel/keyutils bits get sorted (sgallagh)- add explicit build-time dependency on a version of keyutils that's new
  enough to include keyctl_get_persistent() (more of #991148)- incorporate Simo's updated backport of his updated persistent-keyring changes
  (more of #991148)- don't break during %check when the session keyring is revoked- pull the newer F21 defaults back to F20 (sgallagh)- only apply the patch to autocreate /run/user/0 when we're hard-wiring the
  default ccache location to be under it; otherwise it's unnecessary- don't let comments intended for one scriptlet become part of the "script"
  that gets passed to ldconfig as part of another one (Mattias Ellert, #1005675)- incorporate Simo's backport of his persistent-keyring changes (#991148)
- restore build-time default DEFCCNAME on Fedora 21 and later and EL, and
  instead set default_ccache_name in the default krb5.conf's [libdefaults]
  section (#991148)
- on releases where we expect krb5.conf to be configured with a
  default_ccache_name, add it whenever we upgrade from an older version of
  the package that wouldn't have included it in its default configuration
  file (#991148)- take another stab at accounting for UnversionedDocdirs for the -libs
  subpackage (spotted by ssorce)
- switch to just the snapshot of nss_wrapper we were using, since we
  no longer need to carry anything that isn't in the cwrap.org repository
  (ssorce)- drop a patch we weren't not applying (build tooling)
- wrap kadmind and kpropd in scripts which check for the presence/absence
  of files which dictate particular exit codes before exec'ing the actual
  binaries, instead of trying to use ConditionPathExists in the unit files
  to accomplish that, so that we exit with failure properly when what we
  expect isn't actually in effect on the system (#800343)- attempt to account for UnversionedDocdirs for the -libs subpackage- tweak configuration files used during tests to try to reduce the number
  of conflicts encountered when builds for multiple arches land on the same
  builder- pull up changes to allow GSSAPI modul�x�������������������X�#gJj�����H���@�����á�����+����������������áġ¡�an Brown <julian.brown@cpanel.net> - 5.5.38-50Tim Mullin <tim@cpanel.net> - 5.5.38-49Daniel Muey <dan@cpanel.net> - 5.5.38-48Tim Mullin <tim@cpanel.net> - 5.5.38-47Cory McIntire <cory@cpanel.net> - 5.5.38-46Cory McIntire <cory@cpanel.net> - 5.5.38-45Tim Mullin <tim@cpanel.net> - 5.5.38-44Daniel Muey <dan@cpanel.net> - 5.5.38-43Tim Mullin <tim@cpanel.net> - 5.5.38-42Tim Mullin <tim@cpanel.net> - 5.5.38-41Cory McIntire <cory@cpanel.net> - 5.5.38-40Tim Mullin <tim@cpanel.net> - 5.5.38-39Rishwanth Yeddula <rish@cpanel.net> - 5.5.38-38Rishwanth Yeddula <rish@cpanel.net> - 5.5.38-37Rishwanth Yeddula <rish@cpanel.net> - 5.5.38-36Cory McIntire <cory@cpanel.net> - 5.5.38-35Daniel Muey <dan@cpanel.net> - 5.5.38-34<darren@cpanel.net> - 5.5.38-33<darren@cpanel.net> - 5.5.38-32<cory@cpanel.net> - 5.5.38-31<julian.brown@cpanel.net> - 5.5.38-30<dan@cpanel.net> - 5.5.38-29<dan@cpanel.net> - 5.5.38-28<cory@cpanel.net> - 5.5.38-27Tim Mullin <tim@cpanel.net> - 5.5.38-26Dan Muey <dan@cpanel.net> - 5.5.38-25Dan Muey <dan@cpanel.net> - 5.5.38-24Dan Muey <dan@cpanel.net> - 5.5.38-23Dan Muey <dan@cpanel.net> - 5.5.38-22Jacob Perkins <jacob.perkins@cpanel.net> - 5.5.38-21Jacob Perkins <jacob.perkins@cpanel.net> - 5.5.38-20Jacob Perkins <jacob.perkins@cpanel.net> - 5.5.38-19Jacob Perkins <jacob.perkins@cpanel.net> - 5.5.38-18Jacob Perkins <jacob.perkins@cpanel.net> - 5.5.38-17Jacob Perkins <jacob.perkins@cpanel.net> - 5.5.38-16Jacob Perkins <jacob.perkins@cpanel.net> - 5.5.38-15Dan Muey <dan@cpanel.net> - 5.5.38-14Cory McIntire <cory@cpanel.net> - 5.5.38-13Cory McIntire <cory@cpanel.net> - 5.5.38-12Dan Muey <dan@cpanel.net> - 5.5.38-11Dan Muey <dan@cpanel.net> - 5.5.38-10Dan Muey <dan@cpanel.net> - 5.5.38-9Dan Muey <dan@cpanel.net> - 5.5.38-8Matt Dees <matt.dees@cpanel.net> 5.5.38-7S. Kurt Newman <kurt.newman@cpanel.net> - 5.5.38-6Edwin Buck <e.buck@cpanel.net> 5.5.38-5Jacob Perkins <jacob.perkins@cpanel.net> 5.5.38-4Matt Dees <matt@cpanel.net> - 5.5.38-3S. Kurt Newman <kurt.newman@cpanel.net> - 5.5.38-2Edwin Buck <e.buck@cpanel.net> - 5.5.38-1Darren Mobley <darren@cpanel.net> - 5.5.37-7Julian Brown <julian.brown@cpanel.net> - 5.5.37-6Jacob Perkins <jacob.perkins@cpanel.net> - 5.5.37-1Dan Muey <dan@cpanel.net> - 5.5.36-5S. Kurt Newman <kurt.newman@cpanel.net> - 5.5.36-4Jacob Perkins <jacob.perkins@cpanel.net> 5.5.36-3Jacob Perkins <jacob.perkins@cpanel.net> 5.5.36-2Jacob Perkins <jacob.perkins@cpanel.net> - 5.5.36-1Jacob Perkins <jacob.perkins@cpanel.net> - 5.5.35-1S. Kurt Newman <kurt.newman@cpanel.net> - 5.5.34-2Jacob Perkins <jacob.perkins@cpanel.net> - 5.5.34-1Jacob Perkins <jacob.perkins@cpanel.net> - 5.5.33-1S. Kurt Newman <kurt.newman@cpanel.net> - 5.5.32-3S. Kurt Newman <kurt.newman@cpanel.net> - 5.5.32-2Jacob Perkins <jacob.perkins@cpanel.net> - 5.5.32-1David Nielson <david.nielson@cpanel.net> - 5.5.31-2Jacob Perkins <jacob.perkins@cpanel.net> - 5.5.31-1S. Kurt Newman <kurt.newman@cpanel.net> - 5.5.30-7Jacob Perkins <jacob.perkins@cpanel.net> - 5.5.30-6S. Kurt Newman <kurt.newman@cpanel.net> - 5.5.30-5Dan Muey <dan@cpanel.net> - 5.5.30-4S. Kurt Newman <kurt.newman@cpanel.net> - 5.5.30-3Dan Muey <dan@cpanel.net> - 5.5.30-2Jacob Perkins <jacob.perkins@cpanel.net> - 5.5.30-1Jacob Perkins <jacob.perkins@cpanel.net> - 5.5.29-1Kurt Newman <kurt.newman@cpanel.net> - 5.5.28-1Trinity Quirk <trinity.quirk@cpanel.net> - 5.5.22-6Darren Mobley <darren@cpanel.net> 5.5.22-5Darren Mobley <darren@cpanel.net> 5.5.22-4S. Kurt Newman <kurt.newman@cpanel.net> 5.5.22-3Dan Muey <dan@cpanel.net> 5.5.22-2S. Kurt Newman <kurt.newman@cpanel.net> - 5.5.22-1S. Kurt Newman <kurt.newman@cpanel.net> - 5.5.22-0Trinity Quirk <trinity.quirk@cpanel.net> - 5.5.6-14Jan Kaluza <jkaluza@redhat.com> - 5.5.6-13Remi Collet <rcollet@redhat.com> - 5.5.6-12Remi Collet <rcollet@redhat.com> - 5.5.6-11Remi Collet <rcollet@redhat.com> - 5.5.6-10Remi Collet <rcollet@redhat.com> - 5.5.6-9Remi Collet <rcollet@redhat.com> - 5.5.6-8Remi Collet <rcollet@redhat.com> - 5.5.6-7Rem�x�������������h������X=#�fJj����(�������P�������2e�����Z����������������2e1e3e�0-4Harald Hoyer <harald@redhat.de> 4.1.0-3Harald Hoyer <harald@redhat.de> 4.1.0-2Harald Hoyer <harald@redhat.de> 4.1.0-1Harald Hoyer <harald@redhat.de> 4.0.99mrc2-5Tim Powers <timp@redhat.com> 4.0.99mrc2-4Harald Hoyer <harald@redhat.com> 4.0.99mrc2-3Tim Powers <timp@redhat.com>Harald Hoyer <harald@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Preston Brown <pbrown@redhat.com>Pekka Savola <pekkas@netcore.fi>Preston Brown <pbrown@redhat.com>Preston Brown <pbrown@redhat.com>Pekka Savola <pekkas@netcore.fi>Jarno Huuskonen <Jarno.Huuskonen@uku.fi>Preston Brown <pbrown@redhat.com>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Preston Brown <pbrown@redhat.com>Preston Brown <pbrown@redhat.com>Preston Brown <pbrown@redhat.com>Bernhard Rosenkraenzer <bero@redhat.com>Jeff Johnson <jbj@redhat.com>Karsten Hopp <karsten@redhat.de>Jeff Johnson <jbj@redhat.com>Jeff Johnson <jbj@redhat.com>Jeff Johnson <jbj@redhat.com>Jeff Johnson <jbj@redhat.com>Jeff Johnson <jbj@redhat.com>Jeff Johnson <jbj@redhat.com>Bill Nottingham <notting@redhat.com>Prospector <bugzilla@redhat.com>Preston Brown <pbrown@redhat.com>Preston Brown <pbrown@redhat.com>Jeff Johnson <jbj@redhat.com>- rebrand vendorzone- don't update transmission time on invalid response (CVE-2020-11868)
- randomize transmit timestamp in client requests (CVE-?, #1813787)- fix CVE-2016-7429 patch to restore default ttl configuration (#1550637)
- fix buffer overflow in parsing of address in ntpq and ntpdc (CVE-2018-12327)
- fix crash in parsing of received address in ntpq (#1616250)
- avoid reading freed memory after disabling netlink socket (#1555401)
- don't disable netlink socket on ENOBUFS error (#1555413)
- replace ntpstat with shell script using ntpq and supporting chrony (#1592871)- fix buffer overflow in datum refclock driver (CVE-2017-6462)
- fix crash with invalid unpeer command (CVE-2017-6463)
- fix potential crash with invalid server command (CVE-2017-6464)
- add Spectracom TSYNC driver (#1491797)
- fix initialization of system clock status (#1493452)
- fix typos in ntpd man page (#1420453)
- use SHA1 request key by default (#1442083)
- use network-online target in ntpdate and sntp services (#1466947)- fix CVE-2016-7429 patch to work correctly on multicast client (#1422944)- don't limit rate of packets from sources (CVE-2016-7426)
- don't change interface from received packets (CVE-2016-7429)
- fix calculation of root distance again (CVE-2016-7433)
- require authentication for trap commands (CVE-2016-9310)
- fix crash when reporting peer event to trappers (CVE-2016-9311)- don't allow spoofed packet to enable symmetric interleaved mode
  (CVE-2016-1548)
- check mode of new source in config command (CVE-2016-2518)
- make MAC check resilient against timing attack (CVE-2016-1550)- fix crash with invalid logconfig command (CVE-2015-5194)
- fix crash when referencing disabled statistic type (CVE-2015-5195)
- don't hang in sntp with crafted reply (CVE-2015-5219)
- don't crash with crafted autokey packet (CVE-2015-7691, CVE-2015-7692,
  CVE-2015-7702)
- fix memory leak with autokey (CVE-2015-7701)
- don't allow setting driftfile and pidfile remotely (CVE-2015-7703)
- don't crash in ntpq with crafted packet (CVE-2015-7852)
- check key ID in packets authenticated with symmetric key (CVE-2015-7974)
- fix crash with reslist command (CVE-2015-7977, CVE-2015-7978)
- don't allow spoofed packets to demobilize associations (CVE-2015-7979,
  CVE-2016-1547)
- don't accept server/peer packets with zero origin timestamp (CVE-2015-8138)
- fix infinite loop in ntpq/ntpdc (CVE-2015-8158)
- fix resetting of leap status (#1242553)
- extend rawstats log (#1242877)
- report clock state changes related to leap seconds (#1242935)
- allow -4/-6 on restrict lines with mask (#1304492)
- explain synchronised state in ntpstat man page (#1309594)- check origin timestamp before accepting KoD RATE packet (CVE-2015-7704)
- allow only one step larger than panic threshold with -g (CVE-2015-5300)- valida�x�������������������X�#�gJj�t���~�������v����������������������v�v�G�Andrew DeFaria <A.DeFaria@cpanel.net> - 1.4.43-18Charan Angara <charan@cpanel.net> - 1.4.43-17Joe Zhou <joe.zhou@cpanel.net> - 1.4.43-16Tim Mullin <tim@cpanel.net> - 1.4.43-15Thomas Baugh <thomas.baugh@cpanel.net> - 1.4.43-14Joe Zhou <joe.zhou@cpanel.net> - 1.4.43-13Sloane Bernstein <sloane@cpanel.net> - 1.4.43-12Joe Zhou <joe.zhou@cpanel.net> - 1.4.43-11Dan Muey <dan@cpanel.net> - 1.4.43-10Joe Zhou <joe.zhou@cpanel.net> - 1.4.43-9Sloane Bernstein <sloane@cpanel.net> - 1.4.43-8Nicolas Rochelemagne <nicolas.rochelemagne@cpanel.net> - 1.4.43-7Nicolas Rochelemagne <nicolas.rochelemagne@cpanel.net> - 1.4.43-5Nicolas Rochelemagne <nicolas.rochelemagne@cpanel.net> - 1.4.43-4Nicolas Rochelemagne <nicolas.rochelemagne@cpanel.net> - 1.4.43-3Nicolas Rochelemagne <nicolas.rochelemagne@cpanel.net> - 1.4.43-2Nicolas Rochelemagne <nicolas.rochelemagne@cpanel.net> - 1.4.43-1Nicolas Rochelemagne <nicolas.rochelemagne@cpanel.net> - 1.4.42-3Nicolas Rochelemagne <nicolas.rochelemagne@cpanel.net> - 1.4.42-2Nicolas Rochelemagne <nicolas.rochelemagne@cpanel.net> - 1.4.42-1Nicolas Rochelemagne <nicolas.rochelemagne@cpanel.net> - 1.4.41-1Sloane Bernstein <sloane@cpanel.net> - 1.4.40-1Andrew Starodub <a.starodub@cpanel.net> - 1.4.39-1Todd Rinaldo <toddr@cpanel.net> - 1.4.38-1Sloane Bernstein <sloane@cpanel.net> - 1.4.37-1Todd Rinaldo <toddr@cpanel.net> - 1.4.36-1Andrew DeFaria <A.DeFaria@cpanel.net> - 1.4.35-2Caitlin Flattery <c.flattery@cpanel.net> 1.4.35-1Deepak Kumar <d.kumar@cpanel.net> 1.4.34-1Sloane Bernstein <sloane@cpanel.net> 1.4.33-1Nicolas Rochelemagne <nicolas.rochelemagne@cpanel.net> 1.4.32-1Brian Mendoza <brian.mendoza@cpanel.net> 1.4.31-1Sloane Bernstein <sloane@cpanel.net> 1.4.30-1Deepak Kumar <d.kumar@cpanel.net> 1.4.29-1Rikus Goodell <rikus.goodell@webpros.com> 1.4.28-1Brian Mendoza <brian.mendoza@cpanel.net> 1.4.27-1Sloane Bernstein <sloane@cpanel.net> 1.4.26-1Sloane Bernstein <sloane@cpanel.net> 1.4.25-2Todd Rinaldo <todd.rinaldo@webpros.com> 1.4.25-1Chris Dillon <chris.dillon@webpros.com> 1.4.24-1Todd Rinaldo <sloane@cpanel.net> 1.4.23-1Sloane Bernstein <sloane@cpanel.net> 1.4.22-1Nicolas Rochelemagne <nicolas.rochelemagne@cpanel.net> 1.4.21-1Brian Mendoza <brian.mendoza@cpanel.net> 1.4.20-1Dustin Scherer <dustin.scherer@cpanel.net> 1.4.19-1Tom Green <tomg@cpanel.net> 1.4.18-6Todd Rinaldo <toddr@cpanel.net> 1.4.18-5Nicolas Rochelemagne <nicolas.rochelemagne@cpanel.net> 1.4.18-4Thomas Green <tomg@cpanel.net> 1.4.18-3Andrew DeFaria <a.defaria@cpanel.net> 1.4.18-2Andrew DeFaria <a.defaria@cpanel.net> 1.4.18-1Chris Castillo <chris.castillo@cpanel.net> 1.4.17-1Matthew Spahr <matthew.spahr@cpanel.net> 1.4.16-1Deepak Kumar <d.kumar@cpanel.net> 1.4.15-1Everett Hickey <e.hickey@cpanel.net> 1.4.14-1Nicolas Rochelemagne <nicolas.rochelemagne@cpanel.net> 1.4.13-1Todd Rinaldo <toddr@cpanel.net> 1.4.12-1Roberto Alvarado <roberto.alvarado@cpanel.net> 1.4.11-1Everett Hickey <e.hickey@cpanel.net> 1.4.10-1Nicolas Rochelemagne <nicolas.rochelemagne@cpanel.net> 1.4.9-1Chris Dillon <chris.dillon@webpros.com> 1.4.8-1Marco Ferrufino <marco@cpanel.net> 1.4.7-2Adam Wien <adam.wien@webpros.com> 1.4.6-2Matthew Spahr <matthew.spahr@webpros.com> 1.4.6-1Rikus Goodell <rikus.goodell@webpros.com> 1.4.5-1Darren Mobley <darren@cpanel.net> 1.4.4-1Nicolas Rochelemagne <nicolas.rochelemagne@cpanel.net> 1.4.3-7Rikus Goodell <rikus.goodell@webpros.com> 1.4.3-6Thomas Green <tomg@cpanel.net> 1.4.2-6Thomas Green <tomg@cpanel.net> 1.4.2-5Brian Mendoza <brian.mendoza@cpanel.net> 1.4.2-4Thomas Green <tomg@cpanel.net> 1.4.2-3Thomas Green <tomg@cpanel.net> 1.4.2-2Julian Bernier <j.bernier@cpanel.net> 1.4.2-1Matthew Spahr <matthew.spahr@cpanel.net> 1.4.1-1Marco Ferrufino <marco@cpanel.net> 1.4.0-1Thomas Green <tomg@cpanel.net> 1.3.20-1Todd Rinaldo <toddr@cpanel.net> 1.3.19-1Everett Hickey <e.hickey@cpanel.net> 1.3.18-1Joe Zhou <joe.zhou@cpanel.net> 1.3.17-1Charan Angara <charan@cpanel.net> 1.3.16-1Chris Castillo <c.castillo@cpanel.net> 1.3.15-2Brian Gottreu <b.gott�x�������������X������X=#�gJj���������������;�����S����������������;<:�mlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)1.5.8-3.el73.0.4-14.6.0-14.0-15.2-14.11.1R�U�R�k�RN��RL
�R7�N��N��N�T@N^"@NC�@N.�@N%q�Mx�@Ml�MP�L�K�g@K�g@K��@K���D��D��D[>@D[>@DY�C�+�C�B�C��@C��@C}�@C|p�B��B�<�BӰ�BӰ�BӰ�BӰ�Daniel Mach <dmach@redhat.com> - 1.5.8-3Daniel Mach <dmach@redhat.com> - 1.5.8-2David Howells <dhowells@redhat.com> - 1.5.8-1David Howells <dhowells@redhat.com> - 1.5.7-1David Howells <dhowells@redhat.com> - 1.5.6-1David Howells <dhowells@redhat.com> - 1.5.5-1David Howells <dhowells@redhat.com> - 1.5.4-1David Howells <dhowells@redhat.com>David Howells <dhowells@redhat.com>David Howells <dhowells@redhat.com> - 1.5.3-1David Howells <dhowells@redhat.com> - 1.5.2-1David Howells <dhowells@redhat.com> - 1.5.1-1David Howells <dhowells@redhat.com> - 1.5-1David Howells <dhowells@redhat.com> - 1.4-4Diego Elio Pettenò <flameeyes@hosting.flameeyes.eu> - 1.4-3David Howells <dhowells@redhat.com> - 1.4-2David Howells <dhowells@redhat.com> - 1.4-1David Howells <dhowells@redhat.com> - 1.3-3David Howells <dhowells@redhat.com> - 1.3-2David Howells <dhowells@redhat.com> - 1.3-1David Howells <dhowells@redhat.com> - 1.2-1David Howells <dhowells@redhat.com> - 1.1-4David Howells <dhowells@redhat.com> - 1.1-3David Howells <dhowells@redhat.com> - 1.1-2David Howells <dhowells@redhat.com> - 1.1-1David Howells <dhowells@redhat.com> - 1.0-2David Howells <dhowells@redhat.com> - 1.0-1David Howells <dhowells@redhat.com> - 1.0-1David Howells <dhowells@redhat.com> - 0.3-4David Howells <dhowells@redhat.com> - 0.3-3David Howells <dhowells@redhat.com> - 0.3-2David Howells <dhowells@redhat.com> - 0.3-1David Howells <dhowells@redhat.com> - 0.2-2David Howells <dhowells@redhat.com> - 0.2-1David Howells <dhowells@redhat.com> - 0.1-3David Howells <dhowells@redhat.com> - 0.1-2David Howells <dhowells@redhat.com> - 0.1-1- Mass rebuild 2014-01-24- Mass rebuild 2013-12-27- New lib symbols should go in a new library minor version [BZ 1014739].- Provide a utility function to find a key by type and name.
- Allow keyctl commands to take a type+name arg instead of a key-id arg.
- Add per-UID get_persistent keyring function [BZ 1014739].- Fix the request-key.conf.5 manpage.
- Fix the max depth of key tree dump (keyctl show) [BZ 1002761].
- The input buffer size for keyctl padd and pinstantiate should be larger [BZ 1002761].
- Add keyctl_invalidate.3 manpage [BZ 1002761].- Fix a Makefile error.- Fix the keyctl padd command and similar to handle binary input.
- Make keyctl show able to take a keyring to dump.
- Make keyctl show able to take a flag to request hex key IDs.
- Make keyctl show print the real ID of the root keyring.- Allow /sbin/request-key to have multiple config files.- Adjust the manual page for 'keyctl unlink' to show keyring is optional.
- Add --version support for the keyutils version and build date.- Make the keyutils rpm depend on the same keyutils-libs rpm version.- Use correct format spec for printing pointer subtraction results.- Fix unread variables.
- Licence file update.- Disable RPATH setting in Makefile.
- Add -I. to build to get this keyutils.h.
- Make CFLAGS override on make command line work right.
- Make specfile UTF-8.
- Support KEYCTL_REJECT.
- Support KEYCTL_INSTANTIATE_IOV.
- Add AFSDB DNS lookup program from Wang Lei.
- Generalise DNS lookup program.
- Add recursive scan utility function.
- Add bad key reap command to keyctl.
- Add multi-unlink variant to keyctl unlink command.
- Add multi key purger command to keyctl.
- Handle multi-line commands in keyctl command table.
- Move the package to version to 1.5.- Make build guess at default libdirs and word size.
- Make program build depend on library in Makefile.
- Don't include $(DESTDIR) in MAN* macros.
- Remove NO_GLIBC_KEYSYS as it is obsolete.
- Have Makefile extract version info from specfile and version script.
- Provide RPM build rule in Makefile.
- Provide distclean rule in Makefile.- Fix local linking and RPATH.- Fix prototypes in manual pages (some char* should b�x��������������u�����X�#�gJj����pK���PQ�������=�����r�����������������=�=�=�le to have log without prefix & log_level & limit
- log-level warn/err -> warning/error (RHBZ#1009436)
- Use policy DROP while reloading, do not reset policy in restart twice
- Add _direct chains to all table and chain combinations
- documentation improvements
- New firewalld.direct(5) man page docbook source
- tests/firewall-cmd_test.sh: make rich language tests work
- Rich_Rule._import_from_string(): improve error messages (RHBZ#994150)
- direct.passthrough wasn't always matching out_signature (RHBZ#967800)
- firewall-config: twist ICMP Type IP address family logic.
- firewall-config: port-forwarding/masquerading dialog (RHBZ#993658)
- firewall-offline-cmd: New --remove-service=<service> option (BZ#969106)
- firewall-config: Options->Lockdown was not changing permanent.
- firewall-config: edit line on doubleclick (RHBZ#993572)
- firewall-config: System Default Zone -> Default Zone (RHBZ#993811)
- New direct D-Bus interface, persistent direct rule handling, enabled passthough
- src/firewall-cmd: Fixed help output to use more visual parameters
- src/firewall-cmd: New usage output, no redirection to man page anymore
- src/firewall/core/rich.py: Fixed forwad port destinations
- src/firewall-offline-cmd: Early enable/disable handling now with mask/unmask
- doc/xml/firewalld.zone.xml: Added more information about masquerade use
- Prefix to log message is optional (RHBZ#998079)
- firewall-cmd: fix --permanent --change-interface (RHBZ#997974)
- Sort zones/interfaces/service/icmptypes on output.
- wbem-https service (RHBZ#996668)
- applet&config: add support for KDE NetworkManager connection editor
- firewall/core/fw_config.py: New method update_lockdown_whitelist
- Added missing file watcher for lockdown whitelist in config D-Bus interface
- firewall/core/watcher: New add_watch_file for lockdown-whitelist and direct
- Make use of IPv6 NAT conditional, based on kernel number (RHBZ#967376)- several rich rule check enhancements and fixes
- firewall-cmd: direct options - check ipv4|ipv6|eb (RHBZ#970505)
- firewall-cmd(1): improve description of direct options (RHBZ#970509)
- several firewall-applet enhancements and fixes
- New README
- several doc and man page fixes
- Service definitions for PCP daemons (RHBZ#972262)
- bash-completion: add lockdown and rich language options
- firewall-cmd: add --permanent --list-all[-zones]
- firewall-cmd: new -q/--quiet option
- firewall-cmd: warn when default zone not active (RHBZ#971843)
- firewall-cmd: check priority in --add-rule (RHBZ#914955)
- add dhcpv6 (for server) service (RHBZ#917866)
- firewall-cmd: add --permanent --get-zone-of-interface/source --change-interface/source
- firewall-cmd: print result (yes/no) of all --query-* commands
- move permanent-getZoneOf{Interface|Source} from firewall-cmd to server
- Check Interfaces/sources when updating permanent zone settings.
- FirewallDConfig: getZoneOfInterface/Source can actually return more zones
- Fixed toaddr check in forward port to only allow single address, no range
- firewall-cmd: various output improvements
- fw_zone: use check_single_address from firewall.functions
- getZoneOfInterface/Source does not need to throw exception
- firewall.functions: Use socket.inet_pton in checkIP, fixed checkIP*nMask
- firewall.core.io.service: Properly check port/proto and destination address
- Install applet desktop file into /etc/xdg/autostart
- Fixed option problem with rich rule destinations (RHBZ#979804)
- Better exception creation in dbus_handle_exceptions() decorator (RHBZ#979790)
- Updated firewall-offline-cmd
- Use priority in add, remove, query and list of direct rules (RHBZ#979509)
- New documentation (man pages are created from docbook sources)
- firewall/core/io/direct.py: use prirority for rule methods, new get_all_ methods
- direct: pass priority also to client.py and firewall-cmd
- applet: New blink and blink-count settings
- firewall.functions: New function ppid_of_pid
- applet: Check for gnome3 and fix it, use new settings, new size-changed cb
- firewall-offline-cmd: Fix use of systemctl in chroot
- fir�x�������������He�����X7#gJj����@����P����������������������������	

 !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~������������������������������������������������������8.32-17.el78.32-17.el78.328.328.328.328.32pcre-configpcre.hpcre_scanner.hpcre_stringpiece.hpcrecpp.hpcrecpparg.hpcreposix.hlibpcre.solibpcre16.solibpcre32.solibpcrecpp.solibpcreposix.solibpcre.pclibpcre16.pclibpcre32.pclibpcrecpp.pclibpcreposix.pcpcre-devel-8.32HACKINGhtmlindex.htmlpcre-config.htmlpcre.htmlpcre16.htmlpcre_assign_jit_stack.htmlpcre_compile.htmlpcre_compile2.htmlpcre_config.htmlpcre_copy_named_substring.htmlpcre_copy_substring.htmlpcre_dfa_exec.htmlpcre_exec.htmlpcre_free_study.htmlpcre_free_substring.htmlpcre_free_substring_list.htmlpcre_fullinfo.htmlpcre_get_named_substring.htmlpcre_get_stringnumber.htmlpcre_get_stringtable_entries.htmlpcre_get_substring.htmlpcre_get_substring_list.htmlpcre_jit_exec.htmlpcre_jit_stack_alloc.htmlpcre_jit_stack_free.htmlpcre_maketables.htmlpcre_pattern_to_host_byte_order.htmlpcre_refcount.htmlpcre_study.htmlpcre_utf16_to_host_byte_order.htmlpcre_version.htmlpcreapi.htmlpcrebuild.htmlpcrecallout.htmlpcrecompat.htmlpcrecpp.htmlpcredemo.htmlpcregrep.htmlpcrejit.htmlpcrelimits.htmlpcrematching.htmlpcrepartial.htmlpcrepattern.htmlpcreperform.htmlpcreposix.htmlpcreprecompile.htmlpcresample.htmlpcrestack.htmlpcresyntax.htmlpcretest.htmlpcreunicode.htmlpcre-config.txtpcre.txtpcredemo.cpcregrep.txtpcretest.txtperltest.txtpcre-config.1.gzpcre.3.gzpcre16.3.gzpcre16_assign_jit_stack.3.gzpcre16_compile.3.gzpcre16_compile2.3.gzpcre16_config.3.gzpcre16_copy_named_substring.3.gzpcre16_copy_substring.3.gzpcre16_dfa_exec.3.gzpcre16_exec.3.gzpcre16_free_study.3.gzpcre16_free_substring.3.gzpcre16_free_substring_list.3.gzpcre16_fullinfo.3.gzpcre16_get_named_substring.3.gzpcre16_get_stringnumber.3.gzpcre16_get_stringtable_entries.3.gzpcre16_get_substring.3.gzpcre16_get_substring_list.3.gzpcre16_jit_exec.3.gzpcre16_jit_stack_alloc.3.gzpcre16_jit_stack_free.3.gzpcre16_maketables.3.gzpcre16_pattern_to_host_byte_order.3.gzpcre16_refcount.3.gzpcre16_study.3.gzpcre16_utf16_to_host_byte_order.3.gzpcre16_version.3.gzpcre32.3.gzpcre32_assign_jit_stack.3.gzpcre32_compile.3.gzpcre32_compile2.3.gzpcre32_config.3.gz�x��������������T�����X`#qgJj���������^����������������������������m�?.�?*d����	'�	F�������������	��2�8@p	�
��
���(T�<+�+B+(�8�%9H%:"%F&lG&�H&�I&�X&�Y'\'�]'�^(Kb(�c){d)�e)�f)�l)�z)��***,0,@
.X�.�.�.�g.�h.�Cea-php83-php-cli8.3.302.4.6.cpanelCommand-line interface for PHPThe php-cli package contains the command-line interface
executing PHP scripts, /usr/bin/php, and the CGI interface.i��hou-1�+EA4-production / CentOS_7cPanel, Inc.PHP and Zend and BSDDevelopment/Languageshttp://www.php.net/linuxx86_64	;�k�`kڨ*$#�=)%������큤������������i���i���i���i���i���i���i���i���i���i���i��i��49fe31321b1f3a7dc29ef735968257d2a38dd7442ca07b776a90badbed8bb5f8b231bcbe9dc363039522f517357ff44585c048f968ff7127a893c9f754031e9f0bc0f33a25fd0bf0a59e02524bda1cc8d59204f0ad04945ca57569aa6b8081f6556d81537177081af8b0961057b25e23f770ef076bd6117bc5a97c879dea092675fdc4564985ab906358a3510a8508761cdc184e6b8c36b1ae143c4dfc98c968c9aac1b6cbefa8f9ffe9ce2bb88cec7e3fd35bd9fa26cf69a9b1b0986c01389b30dafb292f584fcf3574492f16cac08241f7f571c14a796f92783d260c75ac1476d76ae1f7e33705d192d530887eb40c4f092655d3175aeb716df7d2d1ced6cb1fd930de6f2eb0d1ba7da07f7cd1d69882abff1707b5da4faacff4eb80cfd232phar.phar/opt/cpanel/ea-php83/root/usr/bin/php-cgi/opt/cpanel/ea-php83/root/usr/bin/phprootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootea-php83-php-8.3.30-2.4.6.cpanel.src.rpm������������������������������������������������ea-php83-php-cgiea-php83-php-cgi(x86-64)ea-php83-php-pcntlea-php83-php-pcntl(x86-64)ea-php83-php-readlineea-php83-php-readline(x86-64)ea-php83-php-cliea-php83-php-cli(x86-64)


@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@
ea-php83-php-common(x86-64)ea-php-cliea-php-cli-lsphpea-php83-php-litespeedrpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(CompressedFileNames)/bin/shlibargon2.so.0()(64bit)libc.so.6()(64bit)libc.so.6(GLIBC_2.11)(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.15)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.3)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libc.so.6(GLIBC_2.7)(64bit)libc.so.6(GLIBC_2.8)(64bit)libcrypt.so.1()(64bit)libcrypto-ea.so.1.1()(64bit)libcrypto-ea.so.1.1(OPENSSL_EA_1_1_0)(64bit)libcrypto-ea.so.1.1(OPENSSL_EA_1_1_1)(64bit)libdl.so.2()(64bit)libdl.so.2(GLIBC_2.2.5)(64bit)libedit.so.0()(64bit)libm.so.6()(64bit)libm.so.6(GLIBC_2.2.5)(64bit)libncurses.so.5()(64bit)libresolv.so.2()(64bit)libresolv.so.2(GLIBC_2.2.5)(64bit)librt.so.1()(64bit)librt.so.1(GLIBC_2.2.5)(64bit)libssl-ea.so.1.1()(64bit)libssl-ea.so.1.1(OPENSSL_EA_1_1_0)(64bit)libstdc++.so.6()(64bit)libtinfo.so.5()(64bit)libutil.so.1()(64bit)libutil.so.1(GLIBC_2.2.5)(64bit)libxml2.so.16()(64bit)libz.so.1()(64bit)rtld(GNU_HASH)rpmlib(PayloadIsXz)8.3.30-2.4.6.cpanel8.3.30-2.4.6.cpanel4.6.0-14.0-13.0.4-15.2-14.11.3ir@ip��iC�i�i��i�@h��hҋ�h�h@hfp�hA��h��g���g��g��x�������������8D�����X�#gJj�������`P�����������|�������������������9S��php-openssl to -common (#194501)
- Provide: php-cgi from -cli subpackage- split out php-cli, php-common subpackages (#177821)
- add php-pdo-abi version export (#193202)- rebuilt for new libnetsnmp- provide mod_php (#187891)
- provide php-cli (#192196)
- use correct LDAP fix (#181518)
- define _GNU_SOURCE in php_config.h and leave it defined
- drop (circular) dependency on php-pear- update to 5.1.4- update to 5.1.3- provide php-api (#183227)
- add provides for all builtin modules (Tim Jackson, #173804)
- own %{_libdir}/php/pear for PEAR packages (per #176733)
- add obsoletes to allow upgrade from FE4 PDO packages (#181863)- bump again for double-long bug on ppc(64)- rebuilt for new gcc4.1 snapshot and glibc changes- rebuild for new libc-client soname- only build xmlreader and xmlwriter shared (#177810)- update to 5.1.2- rebuild again- rebuild for new net-snmp- enable short_open_tag in default php.ini again (#175381)- rebuilt- require net-snmp for php-snmp (#174800)- add /usr/share/pear back to hard-coded include_path (#174885)- rebuild for httpd 2.2- update to 5.1.1
- remove pear subpackage
- enable pdo extensions (php-pdo subpackage)
- remove non-standard conditional module builds
- enable xmlreader extension- rebuilt against new openssl- pear: update to XML_RPC 1.4.4, XML_Parser 1.2.7, Mail 1.1.9 (#172528)- rebuild for new libnetsnmp- update to 5.0.5
- add fix for upstream #34435
- devel: require autoconf, automake (#159283)
- pear: update to HTTP-1.3.6, Mail-1.1.8, Net_SMTP-1.2.7, XML_RPC-1.4.1
- fix imagettftext et al (upstream, #161001)- ldap: restore ldap_start_tls() function- disable RPATHs in shared extensions (#156974)- build simplexml_import_dom even with shared dom (#156434)
- prevent truncation of copied files to ~2Mb (#155916)
- install /usr/bin/php from CLI build alongside CGI
- enable sysvmsg extension (#142988)- prevent build of builtin dba as well as shared extension- split out dba and bcmath extensions into subpackages
- BuildRequire gcc-c++ to avoid AC_PROG_CXX{,CPP} failure (#155221)
- pear: update to DB-1.7.6
- enable FastCGI support in /usr/bin/php-cgi (#149596)- build /usr/bin/php with the CLI SAPI, and add /usr/bin/php-cgi,
  built with the CGI SAPI (thanks to Edward Rudd, #137704)
- add php(1) man page for CLI
- fix more test cases to use -n when invoking php- rebuild for new libpq soname- bundle from PEAR: HTTP, Mail, XML_Parser, Net_Socket, Net_SMTP
- snmp: disable MSHUTDOWN function to prevent error_log noise (#153988)
- mysqli: add fix for crash on x86_64 (Georg Richter, upstream #32282)- build shared objects as PIC (#154195)- fix PEAR installation and bundle PEAR DB-1.7.5 package- update to 5.0.4 (#153068)
- add .phps AddType to php.conf (#152973)
- better gcc4 fix for libxmlrpc- BuildRequire mysql-devel >= 4.1
- don't mark php.ini as noreplace to make upgrades work (#152171)
- fix subpackage descriptions (#152628)
- fix memset(,,0) in Zend (thanks to Dave Jones)
- fix various compiler warnings in Zend- package mysqli extension in php-mysql
- really enable pcntl (#142903)
- don't build with --enable-safe-mode (#148969)
- use "Instant Client" libraries for oci8 module (Kai Bolay, #149873)- fix build with GCC 4- install the ext/gd headers (#145891)
- enable pcntl extension in /usr/bin/php (#142903)
- add libmbfl array arithmetic fix (dcb314@hotmail.com, #143795)
- add BuildRequire for recent pcre-devel (#147448)- update to 5.0.3 (thanks to Robert Scheck et al, #143101)
- enable xsl extension (#142174)
- package both the xsl and dom extensions in php-xml
- enable soap extension, shared (php-soap package) (#142901)
- add patches from upstream 5.0 branch:
 * Zend_strtod.c compile fixes
 * correct php_sprintf return value usage- update for db4-4.3 (Robert Scheck, #140167)
- build against mysql-devel
- run tests in %check- truncate changelog at 4.3.1-1
- merge from 4.3.x package:
 - enable mime_magic extension and Require: file (#130276)- fix dom/sqlite enable/without confusion- fix phpize installation for lib64 platforms
- add fix�x��������������3�����X�#�eJj�����X�����w/���������������������w/�
8H?�d���$�	0�	^���������	�������	
�
������l�,(S8\9p:iG(H0I8X<YL\|]�^�b$d�e�f�l�����
�48<g@hDCcpanel-perl-536-ref-util-xs0.1171.cp108~el7CPAN module - XS implementation for Ref::UtilCpanel build perl module 'Ref::Util::XS'XS implementation for Ref::Utilb�bh-centos-7.dev.cpanel.net��mitcpanel/perlhttps://metacpan.orglinuxx86_64���$�$b�b�c6c79898734bbb5141d76cca030a881acc47fd57bb95eb7a80e8a2a05d3d44796376c558261ced146216f656f88d9dea9c36d477b1518c8135cf629a589d3d6arootrootrootrootcpanel-perl-536-ref-util-xs-0.117-1.cp108~el7.src.rpm��������cpanel-perl(Ref::Util::XS)cpanel-perl-ref-util-xscpanel-perl-536-ref-util-xscpanel-perl-536-ref-util-xs(x86-64)




cpanel-perl-536cpanel-perl-536-xsloaderrpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(CompressedFileNames)rpmlib(PayloadIsXz)rpmlib(TildeInVersions)4.6.0-14.0-13.0.4-15.2-14.10.0-14.11.1b�@`-@\�9�[��@Y��Busy Camels <bc@cpanel.net> - 0.117-1.cp108Busy Camels <bc@cpanel.net> - 0.117-1.cp1198Nicolas Rochelemagne <rochelemagne@cpanel.net> - 0.117-2.cp1178Todd Rinaldo <toddr@cpan.org> - 0.117-1.cp1178Todd Rinaldo <toddr@cpanel.net> - 0.116-1.cp1170- Bump to 1.cp108 for re-build- Bump to 1.cp1198 for debian re-build- Update patches: Ref-Util-XS 0.117- Update from upstream: Ref-Util-XS 0.117- Update from upstream: Ref-Util-XS 0.1160.1170.1170.117-1.cp108~el70.117-1.cp108~el7XS.pmXS.so/usr/local/cpanel/3rdparty/perl/536/cpanel-lib/x86_64-linux/Ref/Util//usr/local/cpanel/3rdparty/perl/536/cpanel-lib/x86_64-linux/auto/Ref/Util/XS/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches   -m64 -mtune=genericcpioxz2x86_64-redhat-linux-gnu?���,��X�B��n>a��S�3cfed56893556c4c3cac0c68d8b3a2392d96e505c�VB��c�VA1.3.34 and i40evf to 1.3.21 (Stefan Assmann) [1269238 1272322 1274176 1281279 1293277 1310436]
- [netdrv] i40e: increase AQ work limit (Stefan Assmann) [1269238 1272322 1274176 1281279 1293277 1310436]
- [netdrv] i40e: Recognize 1000Base_T_Optical phy type when link is up (Stefan Assmann) [1269238 1272322 1274176 1281279 1293277 1310436]
- [netdrv] i40e: reset the invalid msg counter in vf when a valid msg is received (Stefan Assmann) [1269238 1272322 1274176 1281279 1293277 1310436]
- [netdrv] i40e/i40evf: moderate interrupts differently (Stefan Assmann) [1269238 1272322 1274176 1281279 1293277 1310436]
- [netdrv] i40e: Add support for non-willing Apps (Stefan Assmann) [1269238 1272322 1274176 1281279 1293277 1310436]
- [netdrv] i40e: priv flag for controlling VEB stats (Stefan Assmann) [1269238 1272322 1274176 1281279 1293277 1310436]
- [netdrv] i40e: Removed unused defines (Stefan Assmann) [1269238 1272322 1274176 1281279 1293277 1310436]
- [netdrv] i40e: remove read/write failed messages from nvmupdate (Stefan Assmann) [1269238 1272322 1274176 1281279 1293277 1310436]
- [netdrv] i40e/i40evf: Fix compile issue related to const string (Stefan Assmann) [1269238 1272322 1274176 1281279 1293277 1310436]
- [netdrv] i40e: generate fewer startup messages (Stefan Assmann) [1269238 12723�x�������������(#�����X9#7gJj���������D�����n�����y�����������������n�J�s� patch for 0004-Make-ksu-respect-the-default_ccache_name-setting, no longer needed
  - drop patch for 0005-Copy-config-entries-to-the-ksu-target-ccache, no longer needed
  - drop patch for 0006-Use-more-randomness-for-ksu-secondary-cache-names, no longer needed
  - drop patch for 0007-Make-krb5_cc_new_unique-create-DIR-directories, no longer needed
  - drop patch for krb5-1.12-kpasswd-skip-address-check, fixed in krb5-1.13
  - drop patch for 0000-Refactor-cm-functions-in-sendto_kdc.c, no longer needed
  - drop patch for 0001-Simplify-sendto_kdc.c, no longer needed
  - drop patch for 0002-Add-helper-to-determine-if-a-KDC-is-the-master, no longer needed
  - drop patch for 0003-Use-k5_transport-_strategy-enums-for-k5_sendto, no longer needed
  - drop patch for 0004-Build-support-for-TLS-used-by-HTTPS-proxy-support, no longer needed
  - drop patch for 0005-Add-ASN.1-codec-for-KKDCP-s-KDC-PROXY-MESSAGE, no longer needed
  - drop patch for 0006-Dispatch-style-protocol-switching-for-transport, no longer needed
  - drop patch for 0007-HTTPS-transport-Microsoft-KKDCPP-implementation, no longer needed
  - drop patch for 0008-Load-custom-anchors-when-using-KKDCP, no longer needed
  - drop patch for 0009-Check-names-in-the-server-s-cert-when-using-KKDCP, no longer needed
  - drop patch for 0010-Add-some-longer-form-docs-for-HTTPS, no longer needed
  - drop patch for 0011-Have-k5test.py-provide-runenv-to-python-tests, no longer needed
  - drop patch for 0012-Add-a-simple-KDC-proxy-test-server, no longer needed
  - drop patch for 0013-Add-tests-for-MS-KKDCP-client-support, no longer needed
  - drop patch for krb5-1.12ish-tls-plugins, fixed in krb5-1.13.1
  - drop patch for krb5-1.12-nodelete-plugins, fixed in krb5-1.13.1
  - drop patch for krb5-1.12-ksu-untyped-default-ccache-name, fixed in krb5-1.13.1
  - drop patch for krb5-1.12-ksu-no-ccache, fixed in krb5-1.13.1
  - drop patch for krb5-ksu_not_working_with_default_principal, fixed in krb5-1.13.1
  - drop patch for CVE_2014_5353_fix_LDAP_misused_policy_name_crash, fixed in krb5-1.13.1
  - drop patch for CVE_2014_5354_support_keyless_principals_in_ldap, fixed in krb5-1.13.1
  - drop patch for kinit -C loops (MIT/krb5 bug #243), fixed in krb5-1.13.1
  - drop patch for CVEs { 2014-9421, 2014-9422, 2014-9423, 2014-5352 }, fixed in krb5-1.13.1
  - added patch krb5-1.14-Support-KDC_ERR_MORE_PREAUTH_DATA_REQUIRED
  - added patch krb5-1.12.1-CVE_2014_5355_fix_krb5_read_message_handling
- Minor spec cleanup- fix for kinit -C loops (#1184629, MIT/krb5 issue 243, "Do not
  loop on principal unknown errors").- fix for CVE-2014-5352 (#1179856) "gss_process_context_token()
  incorrectly frees context (MITKRB5-SA-2015-001)"
- fix for CVE-2014-9421 (#1179857) "kadmind doubly frees partial
  deserialization results (MITKRB5-SA-2015-001)"
- fix for CVE-2014-9422 (#1179861) "kadmind incorrectly
  validates server principal name (MITKRB5-SA-2015-001)"
- fix for CVE-2014-9423 (#1179863) "libgssrpc server applications
  leak uninitialized bytes (MITKRB5-SA-2015-001)"- fix for CVE-2014-5354 (#1174546) "krb5: NULL pointer
  dereference when using keyless entries"- fix for CVE-2014-5353 (#1174543) "Fix LDAP misused policy
  name crash"- In ksu, without the -e flag, also check .k5users (#1105489)
  When ksu was explicitly told to spawn a shell, a line in .k5users which
  listed "*" as the allowed command would cause the principal named on the
  line to be considered as a candidate for authentication.
  When ksu was not passed a command to run, which implicitly meant that
  the invoking user wanted to run the target user's login shell, knowledge
  that the principal was a valid candidate was ignored, which could cause
  a less optimal choice of the default target principal.
  This doesn't impact the authorization checks which we perform later.
  Patch by Nalin Dahyabhai <nalin@redhat.com>- Undo libkadmclnt SONAME change (from 8 to 9) which originally
  happened in the krb5 1.12 rebase (#1166012) but broke
  rubygem-rkerberos (sort of ruby language bindings for
  libkadmclnt&co�x�������������������X�#�gJj������Pb�������v����������������������v�i�v�hwanth Yeddula <rishwanth.yeddula@webpros.com> - 1.4.57-11Maksym Lutsiv <maksym.lutsiv@webpros.com> - 1.4.57-10Chris Castillo <chris.castillo@webpros.com> - 1.4.57-9Rikus Goodell <rikus.goodell@webpros.com> - 1.4.57-8Chris Castillo <chris.castillo@webpros.com> - 1.4.57-4Rishwanth Yeddula <rishwanth.yeddula@webpros.com> - 1.4.57-3Brian Mendoza <brian.mendoza@webpros.com> - 1.4.57-2Darren Mobley <darren.mobley@webpros.com> - 1.4.57-1Charan Angara <sricharan.angara@webpros.com> - 1.4.56-2Eetion Narcisse <eetion.narcisse@webpros.com> - 1.4.56-1Thomas "Andy" Baugh <andy.baugh@webpros.com> - 1.4.55-5Thomas "Andy" Baugh <andy.baugh@webpros.com> - 1.4.55-4Thomas "Andy" Baugh <andy.baugh@webpros.com> - 1.4.55-3Thomas "Andy" Baugh <andy.baugh@webpros.com> - 1.4.55-2Jared Wright <jared.wright@webpros.com> - 1.4.55-1Darren Mobley <darren.mobley@webpros.com> - 1.4.54-4Thomas "Andy" Baugh <andy.baugh@webpros.com> - 1.4.54-3Thomas "Andy" Baugh <andy.baugh@webpros.com> - 1.4.54-2Thomas "Andy" Baugh <andy.baugh@webpros.com> - 1.4.54-1Sloane Bernstein <sloane.bernstein@webpros.com> - 1.4.53-1Deepak Kumar <d.kumar@cpanel.net> - 1.4.52-1Rikus Goodell <rikus.goodell@webpros.com> - 1.4.51-1Rikus Goodell <rikus.goodell@webpros.com> - 1.4.50-1Deepak Kumar <d.kumar@cpanel.net> - 1.4.49-12Darren Mobley <darren@cpanel.net> - 1.4.49-11Deepak Kumar <d.kumar@cpanel.net> - 1.4.49-10B. McMahon <benjamin.mcmahon@webpros.com> - 1.4.49-9Jason Kiniry <jason.kiniry@webpros.com> - 1.4.49-8B. McMahon <benjamin.mcmahon@webpros.com> - 1.4.49-7Jared Wright <jared.wright@webpros.com> - 1.4.49-6Darren Mobley <darren.mobley@webpros.com> - 1.4.49-5Jason Kiniry <jason.kiniry@webpros.com> - 1.4.49-4B. McMahon <benjamin.mcmahon@webpros.com> - 1.4.49-3Darren Mobley <darren.mobley@webpros.com> - 1.4.49-2Jared Wright <jared.wright@webpros.com> - 1.4.49-1Joe Zhou <joe.zhou@cpanel.net> - 1.4.48-5Charan Angara <sricharan.angara@webpros.com> - 1.4.48-4Charan Angara <sricharan.angara@webpros.com> - 1.4.48-3B. McMahon <benjamin.mcmahon@webpros.com> - 1.4.48-2Rikus Goodell <rikus.goodel@webpros.com> - 1.4.48-1Andy Baugh <andy.baugh@webpros.com> - 1.4.48-1Charan Angara <sricharan.angara@webpros.com> - 1.4.47-3Chris Castillo <c.castillo@cpanel.net> - 1.4.47-2Jared Wright <jared.wright@webpros.com> -  1.4.47-1Rikus Goodell <rikus.goodell@webpros.com> - 1.4.46-1Deepak Kumar <d.kumar@cpanel.net> - 1.4.45-5Joe Zhou <joe.zhou@cpanel.net> - 1.4.45-4Charan Angara <charan@cpanel.net> - 1.4.45-3Charan Angara <charan@cpanel.net> - 1.4.45-1Jared Wright <jared.wright@cpanel.net> - 1.4.44-31Tim Mullin <tim@cpanel.net> - 1.4.44-30Joe Zhou <joe.zhou@cpanel.net> - 1.4.44-29Travis Holloway <t.holloway@cpanel.net> - 1.4.44-28Joe Zhou <joe.zhou@cpanel.net> - 1.4.44-27Jared Wright <jared.wright@webpros.com> - 1.4.44-26Chris Castillo <c.castillo@cpanel.net> - 1.4.44-25Joe Zhou <joe.zhou@cpanel.net> - 1.4.44-24Jared Wright <jared.wright@webpros.com> - 1.4.44-23Travis Holloway <t.holloway@cpanel.net> - 1.4.44-22Joe Zhou <joe.zhou@cpanel.net> - 1.4.44-21Deepak Kumar <d.kumar@cpanel.net> - 1.4.44-20Joe Zhou <joe.zhou@cpanel.net> - 1.4.44-19Joe Zhou <joe.zhou@cpanel.net> - 1.4.44-18Joe Zhou <joe.zhou@cpanel.net> - 1.4.44-17Joe Zhou <joe.zhou@cpanel.net> - 1.4.44-16Joe Zhou <joe.zhou@cpanel.net> - 1.4.44-15Deepak Kumar <d.kumar@cpanel.net> - 1.4.44-14Travis Holloway <t.holloway@cpanel.net> - 1.4.44-13Travis Holloway <t.holloway@cpanel.net> - 1.4.44-12Deepak Kumar <d.kumar@cpanel.net> - 1.4.44-11Julian Bernier <julian.bernier@webpros.com> - 1.4.44-10Nicolas Rochelemagne <nicolas.rochelemagne@cpanel.net> - 1.4.44-9Everett Hickey <e.hickey@cpanel.net> - 1.4.44-8Patrick Furtak <patrick.furtak@webpros.com> - 1.4.44-7Joe Zhou <joe.zhou@cpanel.net> - 1.4.44-6Charan Angara <charan@cpanel.net> - 1.4.44-5Joe Zhou <joe.zhou@cpanel.net> - 1.4.44-4Nicolas Rochelemagne <nicolas.rochelemagne@cpanel.net> - 1.4.44-3Nicolas Rochelemagne <nicolas.rochelemagne@cpanel.net> - 1.4.44-2Todd Rinaldo <toddr@cpanel.net> - 1.4.44-1�x������������������Xt#fJj������������p���<X�����T����������������<X;X~��&�����7�+��ź�K��T�(�_�G|$ƨ���������#��o�E�z��¾G�!�y��6
G�pŽLf�1�+�هlf���_�PdN�� ��������İ���&�Sч,�j��~�	fnEw���{��u�(^�ҺÞ[辆&g�^t����5�g/;�)L���hv˞O�l��p�)���*�����o��svo#�A �I�E��'�,��qiNQq����C�djZW��E�8<χ$�V��]�;S�p%�(�e���k��x�ZX*�ާѯ;Ljñp6�"z�㎟Ȳ-]t�T
���C��Ro^;�g�5�!�G��b�w,F#5Z̈́�{���Ŷ^Ԑ~l�<�|ݡ/)���L�����I�-�F^�a��kG�4.<ؔ;;t���Ǜ:�����~bǔ.c08H� m��l�<�X����;�2HP[
u>lCe�O'���R�X�,����w����ࡑ�w�4��.0m�|(]�4�����As�K��o/�)et���-wg4#PJa�#�44&e�'��1rd5738416094d0da5f205f33e78c3117e56b4508bbL���|bL��dhat.com)
- moved devel header files to inc/ and included them in -devel package (jmoskovc@redhat.com, npajkovs@redhat.com)
- renamed abrt-utils.pc to abrt.pc (jmoskovc@redhat.com)
- string updates based on a UI text review (kklic@redhat.com)
- rhtsupport obsoletes the old rh plugins (jmoskovc@redhat.com)
- list allowed items in RHTSupport.conf (kklic@redhat.com)
- GUI: fixed package name in warning message when the packge is kernel rhbz#612191 (jmoskovc@redhat.com)
- remove rating for python crashes (jmoskovc@redhat.com)
- CCpp: give zero rating to an empty backtrace (jmoskovc@redhat.com)
- GUI: allow sending crashes without rating (jmoskovc@redhat.com)
- RHTSupport: set default URL to api.access.redhat.com/rs (dvlasenk@redhat.com)
- abort initialization on abrt.conf parsing errors (dvlasenk@redhat.com)
- changing NoSSLVerify to SSLVerify in bugzilla plugin (mtoman@redhat.com)
- added rating to python crashes
- show hostname in cli (kklic@redhat.com)
- updated po files (jmoskovc@redhat.com)
- added support for package specific actions rhbz#606917 (jmoskovc@redhat.com)
- renamed TicketUploader to ReportUploader (jmoskovc@redhat.com)
- bad hostnames on remote crashes (npajkovs@redhat.com)
- unlimited MaxCrashReportsSize (npajkovs@redhat.com)
- abrt_rh_support: improve error messages rhbz#608698 (vda.linux@googlemail.com)
- Added BacktraceRemotes option. (kklic@redhat.com)
- Allow remote crashes to not to belong to a package. Skip GPG check on remote crashes. (kklic@redhat.com)
- remove obsolete Catcut and rhfastcheck reporters (vda.linux@googlemail.com)
- make rhel bug point to correct place rhbz#578397 (npajkovs@redhat.com)
- Show comment and how to reproduce fields when reporing crashes in abrt-cli (kklic@redhat.com)
- Bash completion update (kklic@redhat.com)
- Rename --get-list to --list (kklic@redhat.com)
- Update man page (kklic@redhat.com)
- Options overhaul (kklic@redhat.com)
- abrt should not point to Fedora bugs but create new RHEL bug instead (npajkovs@redhat.com)
- Don't show global uuid in report (npajkovs@redhat.com)
- GUI: don't try to use action plugins as reporters (jmoskovc@redhat.com)
- Added WatchCrashdumpArchiveDir directive to abrt.conf and related code (vda.linux@googlemail.com)
- GUI: don't show the placehondler icon rhbz#605693 (jmoskovc@redhat.com)
- Make "Loaded foo.conf" message less confusing (vda.linux@googlemail.com)
- Fixed a flaw in strbuf_prepend_str (kklic@redhat.com)
- TicketUploader: do not add '\n' to text files in crashdump (vda.linux@googlemail.com)
- GUI: skip the plugin selection, if it's not needed (jmoskovc@redhat.com)
- Check conf file for syntax errors (kklic@redhat.com)
- move misplaced sanity checks in cron parser (vda.linux@googlemail.com)
- GUI: don't require the rating for all reporters (jmoskovc@redhat.com)
- GUI: fixed exception when there is no configure dialog for plugin rhbz#603745 (jmoskovc@redhat.com)
- Add a GUI config dialog for RHTSupport plugin (vda.linux@googlemail.com)
- abrt_curl: fix a problem with incorrect content-length on 32-bit arches (vda.linux@googlemail.com)
- sosreport: save the dump directly to crashdump directory (vda.linux@googlemail.com)
- plugin rename: rhticket -> RHTSupport (vda.linux@googlemail.com)
- Daemon socket for reporting crashes (karel@localhost.localdomain)
- GUI: fixed few typos (jmoskovc@redhat.com)- Rebuilt for https://fedoraproject.org/wiki/Features/Python_2.7/MassRebuild- G�x��������������������X#�gJj�������������?����������n�������������������� 2.1 from the spec file.
- reorganize the build() function slightly in the spec file to limit the
  number of redundant and conflicting options passedto configure.
- Remove the attempt to hardlink ldapmodify and ldapadd together, since
  the current make install make ldapadd a symlink to ldapmodify.
- Include the -ads patches to allow SASL binds to an Active Directory
  server to work.  Nalin <nalin@redhat.com> wrote the patch, based on my
  broken first attempt.- rebuilt against new openssl- New upstream version.- Upgrade to nev upstream version.  This makes the 2.2.*-hop patch obsolete.- Move the slapd.pem file to /etc/pki/tls/certs
  and edit the -config patch to match to close
  bz#143393  Creates certificates + keys at an insecure/bad place
- also use _sysconfdir instead of hard-coding /etc- Add the tls-fix-connection-test patch to close
  bz#161991 openldap password disclosure issue
- add the hop patches to prevent infinite looping when chasing referrals.
  OpenLDAP ITS #3578- fix typo in ldap.init (call $klist instead of klist, from Charles Lopes)- run slaptest with the -u flag if no id2entry db files are found, because
  you can't check for read-write access to a non-existent database (#156787)
- add _sysconfdir/openldap/cacerts, which authconfig sets as the
  TLS_CACERTDIR path in /etc/openldap/ldap.conf now
- use a temporary wrapper script to launch slapd, in case we have arguments
  with embedded whitespace (#158111)- update to 2.2.26 (stable 20050429)
- enable the lmpasswd scheme
- print a warning if slaptest fails, slaptest -u succeeds, and one of the
  directories listed as the storage location for a given suffix in slapd.conf
  contains a readable file named __db.001 (#118678)- update to 2.2.25 (release)- update to 2.2.24 (stable 20050318)
- export KRB5_KTNAME in the init script, in case it was set in the sysconfig
  file but not exported- prefer libresolv to libbind- add bind-libbind-devel and libtool-ltdl-devel buildprereqs- rebuild with openssl-0.9.7e- update to 2.2.23 (stable-20050125)
- update notes on upgrading from earlier versions
- drop slapcat variations for 2.0/2.1, which choke on 2.2's config files- update to 2.2.20 (stable-20050103)
- warn about unreadable krb5 keytab files containing "ldap" keys
- warn about unreadable TLS-related files
- own a ref to subdirectories which we create under _libdir/tls- rebuild- update to 2.2.17 (stable-20040923) (#135188)
- move nptl libraries into arch-specific subdirectories on x86 boxes
- require a newer glibc which can provide nptl libpthread on i486/i586- move slapd startup to earlier in the boot sequence (#103160)
- update to 2.2.15 (stable-20040822)
- change version number on compat-openldap to include the non-compat version
  from which it's compiled, otherwise would have to start 2.2.15 at release 3
  so that it upgrades correctly- build a separate, static set of libraries for openldap-devel with the
  non-standard ntlm bind patch applied, for use by the evolution-connector
  package (#125579), and installing them under
  evolution_connector_prefix)
- provide openldap-evolution-devel = version-release in openldap-devel
  so that evolution-connector's source package can require a version of
  openldap-devel which provides what it wants- update administrator guide- add compat-openldap subpackage
- default to bdb, as upstream does, gambling that we're only going to be
  on systems with nptl now- preliminary 2.2.13 update
- move ucdata to the -servers subpackage where it belongs- build experimental sql backend as a loadable module- rebuilt- update to 2.1.30- removed rpath
- added pie patch: slapd and slurpd are now pie
- requires libtool >= 1.5.6-2 (PIC libltdl.a)- move rfc documentation from main to -devel (#121025)- rebuild- update to 2.1.29 (stable 20040329)- don't build servers with --with-kpasswd, that option hasn't been recognized
  since 2.1.23- rebuilt- Use ':' instead of '.' as separator for chown.- rebuilt- remove 'reload' from the init script -- it never worked as intended (#115310)- c�x�����X�������������XM#�gJj0T�����������������m��������������������n codes (#242667)
- Provide overlays (as modules; #246036, #245896)
- Add available modules to config file- do not create script in /tmp on startup (bz#188298)
- add compat-slapcat to openldap-compat (bz#179378)
- do not import ddp services with migrate_services.pl
  (bz#201183)
- sort the hosts by adders, preventing duplicities
  in migrate*nis*.pl (bz#201540)
- start slupd for each replicated database (bz#210155)
- add ldconfig to devel post/postun (bz#240253)
- include misc.schema in default slapd.conf (bz#147805)- slapadd during package update is now quiet (bz#224581)
- use _localstatedir instead of var/ during build (bz#220970)
- bind-libbind-devel removed from BuildRequires (bz#216851)
- slaptest is now quiet during service ldap start, if
  there is no error/warning (bz#143697)
- libldap_r.so now links with pthread (bz#198226)
- do not strip binaries to produce correct .debuginfo packages
  (bz#152516)- New upstream release
- Upgrade the scripts for migrating the database so that they might
  actually work.
- change bind-libbind-devel to bind-devel in BuildPreReq- tcp_wrappers has a new devel and libs sub package, therefore changing build
  requirement for tcp_wrappers to tcp_wrappers-devel- New upstream version- New upstream version- rebuilt for unwind info generation, broken in gcc-4.1.1-21- Include --enable-multimaster to close
  bz#185821: adding slapd_multimaster to the configure options
- Upgade guide.html to the correct one for openladp-2.3.27, closing
  bz#190383: openldap 2.3 packages contain the administrator's guide for 2.2
- Remove the quotes from around the slaptestflags in ldap.init
  This closes one part of
  bz#204593: service ldap fails after having added entries to ldap
- include __db.* in the list of files to check ownership of in
  ldap.init, as suggested in
  bz#199322: RFE: perform cleanup in ldap.init- New upstream release
- Include the gethostbyname_r patch so that nss_ldap won't hang
  on recursive attemts to ldap_initialize.- rebuild- New upstream version- Upgrade to 2.3.21
- Add two upstream patches for db-4.4.20- Re-fix ldap.init- bump again for double-long bug on ppc(64)- Modify the ldap.init script to call runuser correctly.- rebuilt for new gcc4.1 snapshot and glibc changes- Upgrade to 2.3.19, which upstream now considers stable
- Modify the -config.patch, ldap.init, and this spec file to put the
  pid file and args file in an ldap-owned openldap subdirectory under
  /var/run.
- Move back_sql* out of _sbindir/openldap , which requires
  hand-moving slapd and slurpd to _sbindir, and recreating symlinks
  by hand.
- Retire openldap-2.3.11-ads.patch, which went upstream.
- Update the ldap.init script to run slaptest as the ldap user rather
  than as root.  This solves
  bz#150172 Startup failure after database problem
- Add to the servers post and preun scriptlets so that on preun, the
  database is slapcatted to /var/lib/ldap/upgrade.ldif and the
  database files are saved to /var/lib/ldap/rpmorig.  On post, if
  /var/lib/ldap/upgrade.ldif exists, it is slapadded.  This means that
  on upgrades from 2.3.16-2 to higher versions, the database files may
  be automatically upgraded.  Unfortunatly, because of the changes to
  the preun scriptlet, users have to do the slapcat, etc by hand when
  upgrading to 2.3.16-2.  Also note that the /var/lib/ldap/rpmorig
  files need to be removed by hand because automatically removing your
  emergency fallback files is a bad idea.
- Upgrade internal bdb to db-4.4.20.  For a clean upgrade, this will
  require that users slapcat their databases into a temp file, move
  /var/lib/ldap someplace safe, upgrade the openldap rpms, then
  slapadd the temp file.- rebuilt- Remove Requires: cyrus-sasl and cyrus-sasl-md5 from openldap- and
  compat-openldap- to close
  bz#173313 Remove exlicit 'Requires: cyrus-sasl" + 'Requires: cyrus-sasl-md5'- Upgrade to 2.3.11, which upstream now considers stable.
- Switch compat-openldap to 2.2.29
- remove references to nss_ldap_build from the spec file
- remove references to 2.0 and�x��������������������XJ#�fJj������������� ���	;�����a����������������	;
;�umper.pmDataDumperDumper.soperl-Data-Dumper-2.145ChangesTodoData::Dumper.3pm.gz/usr/lib64/perl5/vendor_perl//usr/lib64/perl5/vendor_perl/Data//usr/lib64/perl5/vendor_perl/auto//usr/lib64/perl5/vendor_perl/auto/Data//usr/lib64/perl5/vendor_perl/auto/Data/Dumper//usr/share/doc//usr/share/doc/perl-Data-Dumper-2.145//usr/share/man/man3/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches   -m64 -mtune=genericcpioxz2x86_64-redhat-linux-gnudirectoryPerl5 module source textELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=0x8c9d0c35c762c3776086ee9d7e966f60fadfe73f, strippedPerl POD document, ASCII texttroff or preprocessor input, ASCII text (gzip compressed data, from Unix, max compression)PRRR	R
RRRRRRR?�����@�S�*�$ƨ�����t�/I��xf}h@�^��aY<���'�{H�����l�T��,wa�+�F9-A8��R���jp�X2�J�z.�Bp�pس��� o�mؤTIg>��XvNH^ف.4ݑkd�ø]>_�t�CԌ����߅%�-�4�2cZ���a�=��[vE���G$�υ�@�L\�Z�DG����jw���p=�!���!���G����j[uÓ�������`�T�y�N
"g�՜xn ���,w��|
z�9y��J�>1d��CZ�(���h܃J��>l����z����[ٵ��KGi-�
i�Q��M��|����г���X��ڪ�1>�v
�����o��,�@HO&��䓄�x����Q�l�b�YN�@f�?�.�<y?�b�
6��ٯ
� S�	�V`�2��tV����d�F�AT�oZ���(�/tV�w��9�Bi�%.�@�ʥ������R;Om$],xO�w*�	J�k�b�q$G�gij=/�s=�9�٦~(G��S�*�$ƨ�����n��	�-IBk\�g�\'��p�'g�1~����!{�؊���1?�$�϶p^B��|ba�J�0�)���''s�cw#��δ�L�y���,�����o{���W �ǫal���C����O76��H"E�i���&H���!��gPT2O��M[?k�F�	}^q�dP�zS��7��{�e�ױ�C`�'�2b���P�^>�W�A�	_�҂�[�4��ge�7z�~
�X�J�������y����@�`��e�J��t�	�S�v�T��f��[}�s�f�{�2.c��X�����K��E�H�~�L���~�)nQУ���e1�$�^�\�,Ũ��[�<m�D�D[޺���"|�[U�)��������n���
俆 �C�87���9h��.���p�n�z	H�����E�
�T�?�wAgJ@4#�
�~5S�JH��d�c|��z��>55H�a[���\�<����}����$�A2���ύ����X1�;�>�d9574e5e1ad2c850bf34d2029a37df678ce68c90bL����bL��double space after return (Stefan Assmann) [1091127]
- [ethernet] i40evf: fix oops in watchdog handler (Stefan Assmann) [1091127]
- [ethernet] i40evf: clean up init error messages (Stefan Assmann) [1091127]
- [ethernet] i40evf: don't shut down admin queue on error (Stefan Assmann) [1091127]
- [ethernet] i40e/i40evf: Add EEE LPI stats (Stefan Assmann) [1091127]
- [ethernet] i40e/i40evf: Bump build versions (Stefan Assmann) [1091127]
- [ethernet] i40e/i40evf: reduce context descriptors (Stefan Assmann) [1091127]
- [ethernet] i40e/i40evf: enable hardware feature head write back (Stefan Assmann) [1091127]
- [ethernet] i40evf: use min_t (Stefan Assmann) [1091127]
- [ethernet] i40evf: correctly program RSS HLUT table (Stefan Assmann) [1091127]
- [ethernet] i40evf: Rename i40e_ptype_lookup i40evf_ptype_lookup (Stefan Assmann) [1091127]
- [ethernet] i40e/i40evf: Use dma_set_mask_and_coherent (Stefan Assmann) [1091127]
- [ethernet] i40e/i40evf: Use correct number of VF vectors (Stefan Assmann) [1091127]
- [ethernet] i40e/i40evf: Some flow director HW definition fixes (Stefan Assmann) [1091127]
- [ethernet] i40e/i40evf: Bump pf&vf build versions (Stefan Assmann) [1091127]
- [ethernet] i40e/i40evf: carefully fill tx ring (Stefan Assmann) [1091127]
- [ethernet] i40e/i40evf: i40e implementation for skb_set_hash (Stefan Assmann) [1091127]
- [ethernet] i40evf: Enable the ndo_set_features netdev op (Stefan Assmann) [1091127]
- [ethernet] i40e/i40evf: Bump driver versions (Stefan Assmann) [1091127]
- [ethernet] i40e: Change MSIX to MSI-X (Stefan Assmann) [1091127]
- [ethernet] i40evf: remove errant space (Stefan Assmann) [1091127]
- [ethernet] i40evf: update version and copyright date (Stefan Assmann) [1091127]
- [ethernet] i40evf: store ring size in ring structs (Stefan Assmann) [1091127]
- [ethernet] i40evf: don't guess device name (Stefan�x��������������������XA#gJj@�����S��������u�����������������3239eca44be6501e455f4c43b5f598d4a46e384fa45fa0991be270167b93fd0b12acd92988077b4ca1db0aaf5fd43ff97e2e391ff37a083ba59b9f4ffb196c3f308632e191c2bdc2d3f644877225b230bf4f2bf0d23b88b1dba02581296b72fb1edc30bc10094412cdc0a37547be96217b0ed0987eee1b1ab7f1a473677d957753b47e5956c57aabd96521325370533ec73cf8abc51e9705391d341ffc1b1705a1d3787e78394d2e19a99762781749b3f63196ab2a09f927ad9ece69ed73b5254cb2f93edf4a4769e4b4d08bae57d8bd556eed2885e59e64eb57fe4e1222d3ce1265ae113db716bb1f23454bcc5a6da28832c987b5297dfcf1cce46938cce87f47aee0c370651336131c2f732fc9167ea9cf7e09e3da0a7fed5c48ffdda672deda764b5c46c1b3948039b9f833ad6d6cfe894b628e16ba500b6599694cea3d66d7a96171703a023c349d97e1b9d751a27995f2a74880d29f3aa41af0f27275c38173313dae7ec18c56890e4488e6828d3e96a798fbd7e98b4aa689dc30e1cd9dd9e45e4e0807efbdad15958cbedd804d0b289525729ab1afe1d5c3cdadb55afbbeb7a93a50b3e250fcf560214934b665107c276190d8166d858ca32db7cedcbd103646d4372db861cef3bbc927b8aaf444301f3280b8b795765ba5956c197c97c7ebab7cc1cfaa78610d09f8b069a6406b56becdd9224aa6210e0eb6f965cec36f33f224b07a8707cefad0872c9e0ddb893b6cb61d3586c8be88a09b82f4437255dc0cd0ef68823cd163076aaf132245da8b3d404a180035b3901b802aaa1a84d1ffc00635a3960b108ddeb7f6975de8e693aa92b93d4fc15dafc0221e89e1ae506463567684eb372397b440938a7c8d159c3e5b8a5d0f9bd7f1675a999b6e2e827c3e41273b558153b590113d4e862b2a144a42d74cee85312a6712e257b112a44eec9d8c6b346f14d476403d20201ab4f04db265d9b77c45f81f6e3e14fe0d9c9cd497030a249417f1b52f6385a6e277484e2e5639048d2a825659d1d69f08cd9c8faee9546a8a51df48581afcb6ebffd49aaef336ffa2eb39d5547f8e3654adc34e322e43e63944658d2d136d98c0d5d45cddf59cc0c3d53e33d18ed1b0ce86d6b3412a5c1c789cfbc6a2bfb272e6876a427ddcea0ee48826fefbcc7c471d1e7373d5fb1a433605bd45d3abddd79287ffc0f24a1532c003f0d903a0004151836796826474bc5e9890b317d31b9d9ee406c945fc3b76a7d259e06483f58df1a401c00f516aa737b7cd19152c8f552ea1adddb57763079e7b681aa8f2e7c0bbb85b8fd66c753cabfe398f8abe7f9a1abcdc552b5ef7dbd9f31bf24459d160b9e84da972715479f8295a1dd6e6cf5a64cd1aa26f827c6c0ee861285a7d9e95c1f10b430a38266a0ef7d8ec8370a657729a07405318b05446778e1041588e25fe2e658952a323196d00670d426daeacbabcc32e6f56972b256eca12a3927c6ea7ab27312d862ab4c8b87d54a3b9651efc9507f9602c57069fa42c89eb09105dc537e400376bb9d0425f4161a799648f90d7fc5f13957d6a7a6c242c09187c4e8e86693e8475f4468f34db87dbf657985c114b86ac02a9ac76fc4f79608f28b0ec595688c47f50d31e4251728a932e074a8619360393692c9ee44a19ea7deb24b4021066178638c4030924cd403ccedfc187b967d907fb8a88c60e94359013d89a1204cca04e735030b11beee2e69cba5e76225d532101c60a9957a7a7808b6b785aa599867b8010232a09d59d0b200be2955a6140e4dd23921f344530d9378f262c4606c4e50d35661836985aa6c0c3cdee5e0102991bb4df695ae52390c5277679ed1bc5b02fe81b30ef1f211bc65d6c6f1fd5e890412384104005715b2516a2e37947431c8d2fc1c594d70f2fc5e2226bcc6a5fbb1cd6ce0967cc46fe62bc2155af3139c5d453fe921cd32bbe2d9e2bb3f16c30c6ce817703ca3585084324ff97776bd363f1f9f1c7bfa475fa97cd00c4f57932af387cd0ff7f2cdc7ccbc286dc728f5a4c03fe0adc63f9d23f18ccaad3eea74fc04a20f31c0b8447ca4d4b0e751bba990a8711212a466cfb4363dad6184ced60f67abdd9b2acf326e258e0962826fe0e65a5c2e6b97149943e81abb3fd0e6f084ffb8431b16eea024da225b633156b5457ed4acc15c085f07443947d9d21477a6f04a1cff3f37582a455ce4ce0f68977c644921cc91976f18e78d86e48d8a5afb5ee4a587768b0033b5ff69aafb16d37ffc564a6456bd10f7e43015cc3814d811f0445c8c6200e161fe78647c5d73ab305ee47006c2aa42b2c1e235dae83de6c3c62f06f1c165aec9a53c8477dbbaa743bd1a879105e47682e4926441fc58fa2098e136f067345595e23a5aa23747a88a0e2af59ca0e240d15566a197f2993ba7a09c736ed1870edf0a4f62b177b4829a033b76722ffecbb8b8551ef2b8cc7b2d49a707471f475d447c24d5fceb65d3c0deb31e7ee1dd603bf7eb6935ed62eef58d390f9789c59ac81e793605236547fab3beb43c79ccf4b7cd8ff239ddfde2e7a5e641097259896d08fd487393dc6ceb2f2130a8d58c6ec83d79fff14d2b084dae1888dadc88f01fad17779a0de265fd0d0a7a7640180db8cebb0e3f164e04509b51c8e95d321ef5afef9bdc409b8aceabc81dbfcc263b16d724ff0214902baae3c39fd948ccb4fe1b147760e82a0b5fd71ffc67a9688dcfafdfdaf5cc961a009113d9810dc02ee7590099036c9b192d5c23d67ecdd9f943384fb911e6532ea031aabe6de38198e560ba47c95570022545ff7321f2bf691dafc1d63�x�������������p������XU#?fJj������������X��u����������������������u(
8	�?	<d���%�	1�	=�h�l�����	���������	�
���
����$��?(e8l9�:�GhHtI�X�Y�\�]�^�bd	e	f	l	 �	8	L	P
	`�	�	�	�g	�h	�Ccpanel-perl-536-string-crc322.1001.cp108~el7CPAN moduleCpanel build perl module 'String::CRC32'b��bh-centos-7.dev.cpanel.net?wunrestrictedcpanel/perlhttps://metacpan.orglinuxx86_64Xk7��$�$�$`��]��b��79641dcdc8018da941f5326206056968d9a65e0a1563ae2ec55d2900d16f5ebd59e0297ee42783ebfa931ca4b880e1f036bd2be70d978fa64950ad417cb7830aff4002dbff96741058ccb13179a5e781b44c1a0abf9224ef28e09fb578ae69e2rootrootrootrootrootrootcpanel-perl-536-string-crc32-2.100-1.cp108~el7.src.rpm������������cpanel-perl(String::CRC32)cpanel-perl-string-crc32cpanel-perl-536-string-crc32cpanel-perl-536-string-crc32(x86-64)




cpanel-perl-536rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(CompressedFileNames)rpmlib(PayloadIsXz)rpmlib(TildeInVersions)4.6.0-14.0-13.0.4-15.2-14.10.0-14.11.1b��@b�@`-@_��@_�9�[�@[�-�Y��Yy�S>��Q+R@Todd Rinaldo <toddr@cpan.org> - 2.100-1.cp108Busy Camels <bc@cpanel.net> - 1.8-1.cp108Busy Camels <bc@cpanel.net> - 1.8-1.cp1198Todd Rinaldo <toddr@cpan.org> - 1.8-1.cp1194Todd Rinaldo <toddr@cpan.org> - 1.8-1.cp1194Todd Rinaldo <toddr@cpanel.net> - 1.7-1.cp1178Todd Rinaldo <toddr@cpanel.net> - 1.7-1.cp1178Todd Rinaldo <toddr@cpanel.net> - 1.6-1.cp1170Nicolas Rochelemagne <rochelemagne@cpanel.net> - 1.5-1.cp1168Todd Rinaldo <toddr@cpanel.net> - 1.5-1.cp1146Todd Rinaldo <toddr@cpanel.net> - 1.4-1.cp1136- Update from upstream: String-CRC32 2.100- Bump to 1.cp108 for re-build- Bump to 1.cp1198 for debian re-build- Update patches: String-CRC32 1.8- Update from upstream: String-CRC32 1.8- Update patches: String-CRC32 1.7- Update from upstream: String-CRC32 1.7- Update from upstream: String-CRC32 1.6
- Update patches: String-CRC32 1.6- Update patches: String-CRC32 1.5- Update from upstream: String-CRC32 1.5- Update from upstream: String-CRC32 1.42.1002.1002.100-1.cp108~el72.100-1.cp108~el7CRC32.pmCRC32.podCRC32.so/usr/local/cpanel/3rdparty/perl/536/cpanel-lib/x86_64-linux/String//usr/local/cpanel/3rdparty/perl/536/cpanel-lib/x86_64-linux/auto/String/CRC32/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches   -m64 -mtune=genericcpioxz2x86_64-redhat-linux-gnu?���"��0�%Qn�WDc�d7a3e094d7827515c808a6f4630905cb867d9d38c�VDB4c�VAm v7.1.32 to v7.1.33- EA-8549: Build php-fpm with pcntl- EA-8634: Update scl-php71 from v7.1.31 to v7.1.32- EA-8595: Update scl-php71 from v7.1.30 to v7.1.31- EA-8576: Update litespeed from upstream to 7.5- EA-8558: Update litespeed from upstream to 7.4.2- EA-8538: Update litespeed from upstream to 7.4- Updated to version 7.1.30 via update_pkg.pl (EA-8516)- ZC-5063: Add PLESK Signal Managment patches for PHP-FPM- Updated to version 7.1.29 via update_pkg.pl (EA-8431)- ZC-5036: Add find-latest-version (assumes PHP is checked out next ro ea-tools)- EA-8342: Update litespeed to new upstream update of 7.3- EA-8342: Update litespeed to 7.3- Updated to version 7.1.28 via update_pkg.pl (E�x�����8m������������X�#ffJj(������*���H����� ����������������HIl
isable static library creation by default.
- Add missing defattr to devel subpackage
- Add missing documentation files to doc macro- Renamed package to prepend "xorg-x11" to the name for consistency with
  the rest of the X11R7 packages.
- Added "Requires: %{name} = %{version}-%{release}" dependency to devel
  subpackage to ensure the devel package matches the installed shared libs.
- Added virtual "Provides: lib<name>" and "Provides: lib<name>-devel" to
  allow applications to use implementation agnostic dependencies.
- Added post/postun scripts which call ldconfig.
- Added Conflicts with XFree86-libs and xorg-x11-libs to runtime package,
  and Conflicts with XFree86-devel and xorg-x11-devel to devel package.- Initial build./sbin/ldconfig/sbin/ldconfig�1.5.1-2.el71.5.1-2.el7libXrandr.so.2libXrandr.so.2.2.0libXrandr-1.5.1AUTHORSCOPYING/usr/lib64//usr/share/doc//usr/share/doc/libXrandr-1.5.1/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches   -m64 -mtune=genericcpioxz2x86_64-redhat-linux-gnuELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=ee17ca7909f542a211a16a50c1d995827a6be16c, strippeddirectoryASCII textUTF-8 Unicode text	PRR	RRRRRR
?���`gD�Y��$ƨ���q��i�80�$�5Ҍv�����3�\�A-�7Zv3�o��\[��h��Ǯ���G��sC�̯}�+��:F.b\nly�r(S�L\K���5x[A���`��dv��|��/|@�-��ۻOI��X�&6�-�7=ݐ����~�!������1���cA���vɧ�-�D�~�5ra�[�x'G�T��خ/�B�(�(��T{:gbCTe��Fz�
�L��b�����o�vZN&�:��z���u���Fo�%�f���(�[Zp
pB,���
���yh���b�.&Vd�a��e�����!����4j�:%�W6 X-�_���$`3&�p��0{MX�k�u߭p���,�F*�#^��k[u*��{�M��r��~��V�R��K�w&!PزJ'�=Ϻ=
��>
J!\�ϔ���JS���s��I=m��Q[�l?��z�
=ǕBS�tQBL>��]nN�^�C8��X��<�CGw���Qj��ֺ]�v�ˎ�hא=�����,�H��/zj��$�Y��$ƨ���j~�P�s��uYn�$T>*Y��G�
��`h�N��)CK�U�ǿ�f�i��T_�]D٬�@�����P�>Zo���BCp?��D0D���K�my&e��So[��S�յ�c���)y���M���U�ᗦ����|����\/��r�>98x?�S0xR���S��$�3@���,��j�m���!Q��ӥ*�@�y,�n�?��U�x�uq����N;6�����|�)^[2�5��$怷�N�h㬜�\���ޙe��q�LZ僼��>�?�˵�
^���>�<���xd� ��X��l�(�V�^6HȎ4�؀��ģ�*be(:��a.䋷a'_!�ը��F݊�Q��?���3^�Z�0�����nt��у�C7�,�Cc��=�`9�����'m}y��K�1���`��@���E���W�Y;D�A�`,���6R�����k�/���@�̋�7�����;W��J\�چT�:�|����2d�%
�fa0809f49c4a7364190f750af40056b3751a99fcbL���dbL��5 1456486 1457880]
- [nvme] pci: Remove watchdog timer (David Milburn) [1457880 1456486 1454365]
- [nvme] move protection information check into nvme_setup_rw (David Milburn) [1457880 1456486 1454365]
- [nvme] mark shutdown_timeout static (David Milburn) [1457880 1456486 1454365]
- [nvme] rdma: fix error code in nvme_rdma_create_ctrl() (David Milburn) [1457880 1456486 1454365]
- [nvme] fabrics: keep track of nvmet connect error status (David Milburn) [1457880 1456486 1454365]
- [nvme] add fields into identify controller data structure (David Milburn) [1457880 1456486 1454365]
- [nvme] fc: Remove a set-but-not-used variable (David Milburn) [1457880 1456486 1454365]
- [nvme] use ctrl->device consistently for logging (David Milburn) [1457880 1456486 1454365]
- [nvme] allow overriding the NVMe VS via configfs (David Milburn) [1457880 1456486 1454365]
- [nvme] add uuid field to nvme_ns and populate via configfs (David Milburn) [1451199]
- [nvme] implement namespace identify descriptor list (David Milburn) [1451199]
- [nvme] provide UUID value to userspace (David Milburn) [1451199]
- [nvme] get list of namespace descriptors (David Milburn) [1451199]
- [nvme] rename uuid to nguid in nvme_ns (David Milburn) [1451199]
- [nvme] introduce NVMe Namespace Identification Descriptor structures (David Milburn) [1457880 1456486 1454365]
- [nvme] use NVME_IDENTIFY_DATA_SIZE (David Milburn) [145788�x�������������`������X�#�fJj��������8�����������k���������������������.so.2.0libss-1.42.9COPYING/usr/lib64//usr/share/doc//usr/share/doc/libss-1.42.9/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches   -m64 -mtune=genericcpioxz2x86_64-redhat-linux-gnuELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=d202263a037685acd1d0af4dd7acc41a8d4add72, strippeddirectoryASCII textPRRRRRRRR
RRR?���P�T�3!�ׅ���s�z����{�P�ff�
	�{�P�f��|����*y�	}2���l���!�M�!�ЬN`��-���^�}��;F��7<4�e�Q$k���J�/���>Q��bj����j�f������¯��޴�/x����$���߶T��Q�O���i�R�����5]e�;�J�x4��	�H�d���p�!j����H��i��W��F1j`��hɄ3Ax_���+=W,�Ȅ�A�cW�>�n����T?��.}5ĉ8���wl8��ΡsB��|8�Wk7��+��bҴ��͞o�Ɣ�
/"3	�p$�5���v�>v
�cho�\W��?�7o�ق�f }{:��vɖrU%�#��.�>�]�K�f}b
��q$;
�����QV��\}3YⲢ2��v�<C.�-n�Z���cNj�X����G��VIƉ'sE`l��jb����ϴ������Bh������C$��ã�٦Z,/0�?�y�,xB�v��� stF��9<mg�&�$ͥ��R�_v�3!�ׅ���s�z����{�P�ff�
	�{�P�fG��m����-`���0�D�{���_�}"�U�`H`��#��`�@&�n��>@(;�I�T�Pnvݑ�
�s#��^�u�;[��� wL��"�?&���Qp��>y���|��|���=�;�|	6-��D�󪤐k�
}���7j1G�}�ϐWށU�w|��˓�z<nF�׎���S�ձp?U;��TP���B
��"���Rg?�vix�~q�
����J�t������
P$W| �Ӽg������Ɛ^��n�wAf�Z��W\�,
��e��٘�%�8}�n�WqG��&�0.���`����	w��V�[T�����t�j��y#��/l�j��
��m�^v^���	uo� :f�[Ԏ_�&�_��³�*�=�o\Vդ��;�ӯ�ގ"6L#M��O��#�ll-ƌi��R	,
�}��
g�����85Lq����ʅw$^X[wGA��W���0���	�jpUz��0�`� o8������p���l�#��t��cd741ee341067fe7f7aa68ce5c19585b5b2dcf96f���f��eib) [1275159 1296272 1296405 1298421 1298422 1298423 1298424 1298425]
- [netdrv] mlx4_core: Implement pci_resume callback (kamal heib) [1275159 1296272 1296405 1298421 1298422 1298423 1298424 1298425]
- [netdrv] mlx4_en: do batched put_page using atomic_sub (kamal heib) [1275159 1296272 1296405 1298421 1298422 1298423 1298424 1298425]
- [netdrv] mlx4_en: allocate non 0-order pages for RX ring with __GFP_NOMEMALLOC (kamal heib) [1275159 1296272 1296405 1298421 1298422 1298423 1298424 1298425]
- [infiniband] ib/mlx5: fix VFs callback function prototypes (kamal heib) [1275159 1296272 1296405 1298421 1298422 1298423 1298424 1298425]
- [infiniband] ib/ipoib: Allow mcast packets from other VFs (kamal heib) [1275159 1296272 1296405 1298421 1298422 1298423 1298424 1298425]
- [include] ib/mlx5: Implement callbacks for manipulating VFs (kamal heib) [1275159 1296272 1296405 1298421 1298422 1298423 1298424 1298425]
- [include] mlx5_core: Implement modify HCA vport command (kamal heib) [1275159 1296272 1296405 1298421 1298422 1298423 1298424 1298425]
- [include] mlx5_core: Add VF param when querying vport counter (kamal heib) [1275159 1296272 1296405 1298421 1298422 1298423 1298424 1298425]
- [infiniband] ib/ipoib: Add ndo operations for configuring VFs (kamal heib) [1275159 1296272 1296405 1298421 1298422 1298423 1298424 1298425]
- [include] ib/core: Add interfaces to control VF attributes (kamal heib) [1275159 1296272 1296405 1298421 1298422 1298423 1298424 1298425]
- [include] ib/core: Support accessing SA in virtualized environment (kamal heib) [1275159 1296272 1296405 1298421 1298422 1298423 1298424 1298425]
- [include] ib/core: Add subnet prefix to port info (kamal heib) [1275159 1296272 1296405 1298421 1298422 1298423 1298424 1298425]
- [infiniband] ib/mlx5: Fix decision on using MAD_IFC (kamal heib) [1275159 1296272 1296405 1298421 1298422 1298423 1298424 1298425]
- [include] IB/{core, ulp} Support above 32 possible device capability flags (kamal heib) [1275159 1296272 1296405 1298421 1298422 1298423 1298424 1298425]
- [infiniband] ib/core: Replace setting the zero values in ib_uverbs_ex_query_device (kamal heib) [1275159 1296272 1296405 1298421 1298422 1298423 1298424 1298425]
- [include] mlx5_core: Introduce offload arithmetic hardware capabilities�x��������������}�����X)#�fJj����p�����p������F�����z�����������������F�,I� Update litespeed from upstream to 7.4- EA-8514: Update scl-php72 from v7.2.18 to v7.2.19- ZC-5062: Add PLESK signal management to PHP-FPM- EA-8427: Update scl-php72 from v7.2.17 to v7.2.18- ZC-5036: Add find-latest-version (assumes PHP is checked out next ro ea-tools)- EA-8342: Update litespeed to new upstream update of 7.3- EA-8342: Update litespeed to 7.3- Updated to version 7.2.17 via update_pkg.pl (EA-8320)- EA-8280: Update opache.ini blacklist file location to match PHP version- Updated to version 7.2.16 via update_pkg.pl (EA-8271)- Updated to version 7.2.15 via update_pkg.pl (EA-8209)- EA-7397: Compile with Argon2 support- EA-8170: Update litespeed to the latest version (7.2)- Updated to version 7.2.14 via update_pkg.pl (EA-8129)- Updated to version 7.2.13 via update_pkg.pl (EA-8044)- Updated to version 7.2.12 via update_pkg.pl (EA-7999)- EA-7957: Added ea-apache24-mod_proxy_fcgi as a dependency of php-fpm.- Updated to version 7.2.11 via update_pkg.pl (EA-7908)- Updated to version 7.2.10 via update_pkg.pl (EA-7837)- Updated to version 7.2.9 via update_pkg.pl (EA-7781)- Fixed php-fpm installing directories it does not own (EA-7526)- Updated to version 7.2.8 via update_pkg.pl (EA-7703)- Updated to version 7.2.7 via update_pkg.pl (EA-7595)- EA-7359: Ensure ea-libxml2 is listed as a requirement for the php-xml package.- Updated to version 7.2.6 via update_pkg.pl (EA-7510)- Updated to version 7.2.5 via update_pkg.pl (EA-7430)- ZC-3605: Update litespeed to the latest version (7.1).- EA-7382: Update dependency on ea-openssl to require the latest version with versioned symbols.- EA-7343: Update to v7.2.4, drop v7.2.3- ZC-3552: Added versioning to ea-openssl and ea-libcurl requirements.- ZC-3475: Update for ea-openssl shared object- Updated to version 7.2.3 via update_pkg.pl (EA-7289)- Updated to version 7.2.2 via update_pkg.pl (EA-7208)- HB-3287: Increase open file limit for php-fpm by default- HB-3263: Ensure securetmp is done before starting FPM- EA-7044: Adjust PHPs to use ea-libxml2- HB-3061: Fix epoll bug.- Updated to version 7.2.1 via update_pkg.pl (EA-7074)- EA-6764: Add back systzdata now that they have a 7.2 version- EA-6992: Update 7.2.0 dropping from RC status- EA-3099: Update 7.2.0 from RC5 to RC6- EA-6812: build PHP against ea-openssl like Apache- EA-6923: Update 7.2.0 from RC3 to RC5- EA-6866: Update mail-header patch for segfaults under Apache- EA-4653: Update mail header patch for PHP 7.2- HB-2873: Added network-online.target to "After" in the service file- EA-6819: Patch to support libtidy 5.4.0- EA-6857: Update 7.2.0 from RC1 to RC3- EA-6757: Update 7.2.0 from beta3 to RC1
- fix version specific symlinks
- remove TZ patch for now (EA-6764 may re-add a version of it)
- Add patch to fix RC1 bug  https://bugs.php.net/bug.php?id=75149 until the next version- ZC-2827: Fix SRPM scl definition (thank you to JoyceBabu for bringing this to our attention)- ZC-2785: Initial packaginghou-2 17768067357.2.34-11.13.13.cpanel7.2.34-11.13.13.cpanel20-fileinfo.inifileinfo.so/opt/cpanel/ea-php72/root/etc/php.d//opt/cpanel/ea-php72/root/usr/lib64/php/modules/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1  -m64 -mtune=genericobs://private/EA4-production/CentOS_7/c6e55f27579a1e6cfe622dedb5b27205-scl-php72cpioxz2x86_64-redhat-linux-gnu�gж��r+��[s�p=?�����@�i��#x��~�|�K�4�G�����=+�)O}�$�o�ݮ[��)v�`���]<k�%`T�o�XJ�÷;H�sv���`RB[�<�M���In^X�F�����j�~Bj��”Kn�$FןP,���0HIb����>�5�@xU&�M���}�l��T�_Z�o:R���Wۊ0U^��G��M�޼��N�>B�,xſ/��6�z.)�Xg�K�� /��4��Ͳq��<$�6i�{�4����V���lm�D�J���gY!��V8o�V�ۚ�8���X8_̠z����oҜs���+�ѫ�]���_m��a��Z�2�L�̟�L�WV��TX\�m�3�bz���T�Oa�e��m��Sĝ���&ޕ��"W\�r�����BPZ�$*a�v�t��Zò�Z%@�6Lrs��E_�ޞ8��㘃��xI�@��r�{P�zȭ�Sw���[XIM��Nw�6wkm3�g��:)x�2��r`f�\%��x�������������Pm�����X�#rgJj�K����������m�����Y�����������������m��l��g��gd
�g? �g�@g6�f�L�f�X@fٝ@f�x�f�&@fa��f_�f�f�e�!@e��e��e��e���e�4@ez�@ed��Gary Stanley <gary.stanley@webpros.com> - 8.3.30-2Cory McIntire <cory.mcintire@webpros.com> - 8.3.30-1Dan Muey <daniel.muey@webpros.com> - 8.3.29-1Cory McIntire <cory.mcintire@webpros.com> - 8.3.28-1Chris Castillo <chris.castillo@webpros.com> - 8.3.27-2Cory McIntire <cory.mcintire@webpros.com> - 8.3.27-1Cory McIntire <cory.mcintire@webpros.com> - 8.3.26-1Jared Wright <jared.wright@webpros.com> - 8.3.25-1Dan Muey <daniel.muey@webpros.com> - 8.3.23-2Cory McIntire <cory.mcintire@webpros.com> - 8.3.23-1Cory McIntire <cory.mcintire@webpros.com> - 8.3.22-1Cory McIntire <cory.mcintire@webpros.com> - 8.3.21-1Cory McIntire <cory.mcintire@webpros.com> - 8.3.20-1Cory McIntire <cory.mcintire@webpros.com> - 8.3.19-1Cory McIntire <cory.mcintire@webpros.com> - 8.3.17-1Cory McIntire <cory@cpanel.net> - 8.3.16-1Cory McIntire <cory@cpanel.net> - 8.3.15-1Cory McIntire <cory@cpanel.net> - 8.3.14-1Julian Brown <julian.brown@cpanel.net> - 8.3.13-2Cory McIntire <cory@cpanel.net> - 8.3.13-1Cory McIntire <cory@cpanel.net> - 8.3.12-1Julian Brown <julian.brown@cpanel.net> - 8.3.11-1Dan Muey <dan@cpanel.net> - 8.3.10-2Cory McIntire <cory@cpanel.net> - 8.3.10-1Cory McIntire <cory@cpanel.net> - 8.3.9-1Cory McIntire <cory@cpanel.net> - 8.3.8-1Dan Muey <dan@cpanel.net> - 8.3.7-1Brian Mendoza <brian.mendoza@cpanel.net> - 8.3.6-2Cory McIntire <cory@cpanel.net> - 8.3.6-1Brian Mendoza <brian.mendoza@cpanel.net> - 8.3.4-2Cory McIntire <cory@cpanel.net> - 8.3.4-1Cory McIntire <cory@cpanel.net> - 8.3.3-1Cory McIntire <cory@cpanel.net> - 8.3.2-1Cory McIntire <cory@cpanel.net> - 8.3.1-1Travis Holloway <t.holloway@cpanel.net> - 8.3.0-4Julian Brown <julian.brown@cpanel.net> - 8.3.0-3Julian Brown <julian.brown@cpanel.net> - 8.3.0-2- EA4-230: Use system libxml2 in PHP 8.3- EA-13322: Update ea-php83 from v8.3.29 to v8.3.30- EA-13295: Update ea-php83 from v8.3.28 to v8.3.29
- Fixed GHSA-8xr5-qppj-gvwj (PDO quoting result null deref). (CVE-2025-14180)
- Fixed GHSA-h96m-rvf9-jgm2 (Heap buffer overflow in array_merge()). (CVE-2025-14178)
- Fixed GHSA-3237-qqm7-mfv7 (Information Leak of Memory in getimagesize). (CVE-2025-14177)- EA-13266: Update ea-php83 from v8.3.27 to v8.3.28- EA-13088: Update php-litespeed to 8.3- EA-13230: Update ea-php83 from v8.3.26 to v8.3.27- EA-13170: Update ea-php83 from v8.3.25 to v8.3.26- EA-13082: Update ea-php83 from v8.3.23 to v8.3.25- EA4-122: map u24 libodbc for PHP extension- EA-13000: Update ea-php83 from v8.3.22 to v8.3.23
- Fixed GHSA-hrwm-9436-5mv3 (pgsql extension does not check for errors during escaping). (CVE-2025-1735)
- Fixed GHSA-453j-q27h-5p8x (NULL Pointer Dereference in PHP SOAP Extension via Large XML Namespace Prefix). (CVE-2025-6491)
- Fixed GHSA-3cr5-j632-f35r (Null byte termination in hostnames). (CVE-2025-1220)- EA-12917: Update ea-php83 from v8.3.21 to v8.3.22- EA-12852: Update ea-php83 from v8.3.20 to v8.3.21- EA-12807: Update ea-php83 from v8.3.19 to v8.3.20- EA-12769: Update ea-php83 from v8.3.17 to v8.3.19
    - Fixed GHSA-hgf54-96fm-v528 (Stream HTTP wrapper header check might omit basic auth header). (CVE-2025-1736)
    - Fixed GHSA-52jp-hrpf-2jff (Stream HTTP wrapper truncate redirect location to 1024 bytes). (CVE-2025-1861)
    - Fixed GHSA-pcmh-g36c-qc44 (Streams HTTP wrapper does not fail for headers without colon). (CVE-2025-1734)
    - Fixed GHSA-v8xr-gpvj-cx9g (Header parser of `http` stream wrapper does not handle folded headers). (CVE-2025-1217)
    - Fixed GHSA-p3x9-6h7p-cgfc (libxml streams use wrong `content-type` header when requesting a redirected resource). (CVE-2025-1219)
    - Fixed GHSA-rwp7-7vc6-8477 (Reference counting in php_request_shutdown causes Use-After-Free). (CVE-2024-11235)- EA-12708: Update ea-php83 from v8.3.16 to v8.3.17- EA-12650: Update ea-php83 from v8.3.15 to v8.3.16- EA-12618: Update ea-php83 from v8.3.14 to v8.3.15- EA-12578: Update ea-php83 from v8.3.13 to v8.3.14
- (Single byte overread with convert.quot�x��������������\�����Xs#�gJj�����d������pe����`���������������������`vG�e a flat structure- DUCK-10175: Fix sitejet tracking bug after sitejet release 1.1.0-21- PH-20680: Patch mixpanel client to handle target tags in HTML- PH-20665: Update mixpanel js to 2.48.1- PH-20658: Remove cpsess from current_url- PH-20570: Update RPM build steps in README.- PH-19800: Send analytics RPM version to mixpanel- DUCK-9266: Add Sitejet Builder plugin data to analytics.- CPANEL-43416: Remove daily cronjob for summarize-api1-logs- CPANEL-43320: Remove logic to gather api1 logs- DUCK-8355: Add team user roles count in Accounts section.- DUCK-8583: Identify a team user to MixPanel using an Analytics ID- WPX-1078: Fix bug when enabling analytics on first onboarding.- PH-19688: Send user profile data to Mixpanel when using WHM and cPanel- PH-19803: update method of dev environment detection- PH-19679: add UUID for root user- PH-19887:
  Auto generate distinct_id in Mixpanel if a user account's UUID doesn't exist.- CPANEL-42822: filter out dummy user for building WHM chrome- WPX-632: Track WordPress websites managed by installatron and softaculous plugins.- WPX-632: Track installations of installatron and softaculous plugins.- WPX-679: Assure a public IP is used for main IP.- CPANEL-42389: "uninitialized value" from scripts/gather_update_log_stats
  Modified to more properly parse timestamps from error_log- PH-19555:
  Identify Company as a Mixpanel group.
  Associate users to their respective Company group.- PH-19799: send webmail user UUID to mixpanel- Track dedicated IP & Domain association- Track existence of /var/cpanel/elevate-noc-recommendations- PH-19779: always set distribution method- Catch errors resulting from API calls not returning a result object- PH-19610: track user migration data- ZC-10678: Include `ea4-` prefixed packages in EA4 data- Mixpanel implementation and additional event tracking.- Scan /etc/exim.conf.local for interesting keywords.- Restore output message when sending a tarball.- Validate the tarball after its generation.- Add alternate method to generate the tarball on failure.- Fix VirtualUsers _date2Epoch to prefer gmtime over localtime.- Fix Ubuntu package.- Check if SRS is enabled.- Fix some extra reported bugs
- Fix Customizations report when files missing or empty.
- Fix when fetching bandwidth statistics.- Fix some warnings from previous release.
- Fix unknown API 1 calls.
- Fix dnscluster reporting stats.- CPANEL-42018: Collect usage of cPanel LiveEngine.
- Multiple maintenance fixes:
  Remove errant calls to Logger causing reporting failures.
  Fix errors when gathering data due to missing functions.
  Add wrapper for API::1::Utils::Execute calls.
  Load on demand most cPanel packages.
  Fix testsuite.
- Enable warnings from Gatherer.
- Use function signature via Cpanel::UpdateGatherer::Std.- Gather statistics for total number of domains setup in httpd.conf.- CPANEL-41623: Report accesshash information- COBRA-14041: Collect enabled AutoSSL provider- Gather statistical information about non-standard cpanel accounts.- CPANEL-41513: Report Mailman information- CPANEL-41599: Track local user count cache.- CPANEL-41227: Fixed summarize-api1-logs to skip log files that have been corrupted- COBRA-13911: Collect server quota and bandwidth data.- DUCK-7123: Skip cl_edition reporting on older lve-utils.- CPANEL-41257: Remove identifiers from mail disk usage information- CPANEL-: Improve gather data mechanism by isolating each functions.- ZC-10099: Track arbitrary container instances created by ea-podman- CPANEL-40945: Report mail disk usage- DUCK-7112: Report the Team Manager feature.- BWG-3320: Add snapshot_prep plugin for analytics id.- ZC-10001: Track ea container instances created by ea-podman- CPANEL-41048: Collect cPanel ELevate blocker data- CPANEL-40938: Fix any existing cron.d files without a trailing new line.- CPANEL-40937: Assure cron.d files are generated with a trailing new line.- CPANEL-39489: Add license type to GA page hits in WHM- CPANEL-40718: Assure crontab is setup and run on debi�x�������������@L�����X�#BgJjxG�����������7������_����������������7�6�w0�netd
- put %{krb5prefix}/sbin in everyone's path, too (#504525)- add an auth stack to ksu's PAM configuration so that pam_setcred() calls
  won't just fail- make PAM support for ksu also set PAM_RUSER- extend PAM support to ksu: perform account and session management for the
  target user
- pull up and merge James Leddy's changes to also set PAM_RHOST in PAM-aware
  network-facing services- fix a typo in a ksu error message (Marek Mahut)
- "rev" works the way the test suite expects now, so don't disable tests
  that use it- add LSB-style init script info- explicitly run the pdf generation script using sh (part of #225974)- add patches for read overflow and null pointer dereference in the
  implementation of the SPNEGO mechanism (CVE-2009-0844, CVE-2009-0845)
- add patch for attempt to free uninitialized pointer in libkrb5
  (CVE-2009-0846)
- add patch to fix length validation bug in libkrb5 (CVE-2009-0847)
- put the krb5-user .info file into just -workstation and not also
  -workstation-clients- turn off krb4 support (it won't be part of the 1.7 release, but do it now)
- use triggeruns to properly shut down and disable krb524d when -server and
  -workstation-servers gets upgraded, because it's gone now
- move the libraries to /%{_lib}, but leave --libdir alone so that plugins
  get installed and are searched for in the same locations (#473333)
- clean up buildprereq/prereqs, explicit mktemp requires, and add the
  ldconfig for the -server-ldap subpackage (part of #225974)
- escape possible macros in the changelog (part of #225974)
- fixup summary texts (part of #225974)
- take the execute bit off of the protocol docs (part of #225974)
- unflag init scripts as configuration files (part of #225974)
- make the kpropd init script treat 'reload' as 'restart' (part of #225974)- libgssapi_krb5: backport fix for some errors which can occur when
  we fail to set up the server half of a context (CVE-2009-0845)- Rebuilt for https://fedoraproject.org/wiki/Fedora_11_Mass_Rebuild- rebuild- if we successfully change the user's password during an attempt to get
  initial credentials, but then fail to get initial creds from a non-master
  using the new password, retry against the master (#432334)- fix license tag- clear fuzz out of patches, dropping a man page patch which is no longer
  necessary
- quote %{__cc} where needed because it includes whitespace now
- define ASN1BUF_OMIT_INLINE_FUNCS at compile-time (for now) to keep building- build with -fno-strict-aliasing, which is needed because the library
  triggers these warnings
- don't forget to label principal database lock files
- fix the labeling patch so that it doesn't break bootstrapping- generate src/include/krb5/krb5.h before building
- fix conditional for sparcv9- ftp: use the correct local filename during mget when the 'case' option is
  enabled (#442713)- stop exporting kadmin keys to a keytab file when kadmind starts -- the
  daemon's been able to use the database directly for a long long time now
- belatedly add aes128,aes256 to the default set of supported key types- libgssapi_krb5: properly export the acceptor subkey when creating a lucid
  context (Kevin Coffman, via the nfs4 mailing list)- add fixes from MITKRB5-SA-2008-001 for use of null or dangling pointer
  when v4 compatibility is enabled on the KDC (CVE-2008-0062, CVE-2008-0063,
  - add fixes from MITKRB5-SA-2008-002 for array out-of-bounds accesses when
  high-numbered descriptors are used (CVE-2008-0947, #433596)
- add backport bug fix for an attempt to free non-heap memory in
  libgssapi_krb5 (CVE-2007-5901, #415321)
- add backport bug fix for a double-free in out-of-memory situations in
  libgssapi_krb5 (CVE-2007-5971, #415351)- rework file labeling patch to not depend on fragile preprocessor trickery,
  in another attempt at fixing #428355 and friends- ftp: add patch to fix "runique on" case when globbing fixes applied
- stop adding a redundant but harmless call to initialize the gssapi internals- add patch to suppress double-processing of /etc/krb5.conf when �x��������������;�����XR#�fJj������������x����;����������������������;�4?�
�"�-�6�	?�	u������	P\c(�X�Y�
�,h0mI0EXwatywEEANL8zal7BoTMc2Aq7BeRy4nJtAGSACrbb+gkhTxl63TDDHGdFEBw
8vnKWHtRxHaozyn5GifpRly1/j1mK5g0sEsC1Kdg626dKmazbDuE8SSKCm3tMtfu
509IRhaOJKNrjGKyCc3U08Lm2DGKfCXHUkewp6QnQLwq1x6atW1nZpE/ABEBAAG0
MFdvcmRQcmVzcyBUb29sa2l0IGZvciBjUGFuZWwgPHN1cHBvcnRAcGxlc2suY29t
PojOBBMBCAA4FiEE8y5Xzo8i0m0IZOPBujOKptkXD4AFAl8GrcsCGy8FCwkIBwIG
FQgJCgsCBBYCAwECHgECF4AACgkQujOKptkXD4APcAQA0jOcQkEp2sm0tqP0fUT9
P2WdaSsPPFIxdFAcA6fgI+xOup3yVSR47TX22c3ZpitHmrvUGLBj+cakBIuJUjXL
SgQeZMls92dyWRtBwP7qmU/M73YLpdolHYVBzeKA/WxM9mCV2moSZcYIoViUTUdl
obZu/boCCGKag2QU69odbkg=
gpg-pubkeyd9170f805f06adcbgpg(WordPress Toolkit for cPanel <support@plesk.com>)-----BEGIN PGP PUBLIC KEY BLOCK-----
Version: rpm-4.11.3 (NSS-3)

mI0EXwatywEEANL8zal7BoTMc2Aq7BeRy4nJtAGSACrbb+gkhTxl63TDDHGdFEBw
8vnKWHtRxHaozyn5GifpRly1/j1mK5g0sEsC1Kdg626dKmazbDuE8SSKCm3tMtfu
509IRhaOJKNrjGKyCc3U08Lm2DGKfCXHUkewp6QnQLwq1x6atW1nZpE/ABEBAAG0
MFdvcmRQcmVzcyBUb29sa2l0IGZvciBjUGFuZWwgPHN1cHBvcnRAcGxlc2suY29t
PojOBBMBCAA4FiEE8y5Xzo8i0m0IZOPBujOKptkXD4AFAl8GrcsCGy8FCwkIBwIG
FQgJCgsCBBYCAwECHgECF4AACgkQujOKptkXD4APcAQA0jOcQkEp2sm0tqP0fUT9
P2WdaSsPPFIxdFAcA6fgI+xOup3yVSR47TX22c3ZpitHmrvUGLBj+cakBIuJUjXL
SgQeZMls92dyWRtBwP7qmU/M73YLpdolHYVBzeKA/WxM9mCV2moSZcYIoViUTUdl
obZu/boCCGKag2QU69odbkg=
=EwtP
-----END PGP PUBLIC KEY BLOCK-----
_��localhostpubkeyWordPress Toolkit for cPanel <support@plesk.com>Public Keys(none)gpg(WordPress Toolkit for cPanel <support@plesk.com>)gpg(d9170f80)4.11.34:ba338aa6d9170f80-5f06adcb4:ba338aa6d9170f80-5f06adcb?����57a0bc98c112976b80f33587bf4cea9d5e792734bL�bL�rootrootrootrootrootea-libzip-1.8.0-1.1.10.cpanel.src.rpm������������ea-libzipea-libzip(x86-64)libzip.so.5()(64bit)@@@@@@@@@@


@
bzip2-libsea-openssl11libbz2.so.1()(64bit)libc.so.6()(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libcrypto-ea.so.1.1()(64bit)libcrypto-ea.so.1.1(OPENSSL_EA_1_1_0)(64bit)liblzma.so.5()(64bit)liblzma.so.5(XZ_5.0)(64bit)libz.so.1()(64bit)libzip.so.5()(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rtld(GNU_HASH)xzxz-libszlibrpmlib(PayloadIsXz)3.0.4-14.6.0-14.0-15.2-14.11.3`��`��_���_'�@_{�_��^��^��@^��@^|�@^p��^:�@Travis Holloway <t.holloway@cpanel.net> - 1.8.0-1Travis Holloway <t.holloway@cpanel.net> - 1.7.3-3Julian Brown <julian.brown@cpanel.net> - 1.7.3-2Cory McIntire <cory@cpanel.net> - 1.7.3-1Tim Mullin <tim@cpanel.net> - 1.7.1-4Tim Mullin <tim@cpanel.net> - 1.7.1-3Julian Brown <julian.brown@cpanel.net> - 1.7.1-2Cory McIntire <cory@cpanel.net> - 1.7.1-1Tim Mullin <tim@cpanel.net> - 1.7.0-1Julian Brown <julian.brown@cpanel.net> - 1.6.1-3Julian Brown <julian.brown@cpanel.net> - 1.6.1-2Julian Brown <julian.brown@cpanel.net> - 1.61.0-1- EA-9897: Update ea-libzip from v1.7.3 to v1.8.0- EA-9654: Require xz and xz-libs instead of lzma- ZC-8005: Replace ea-openssl11 with system openssl on C8- EA-9209: Update ea-libzip from v1.7.1 to v1.7.3- EA-9181: Patch CMakeLists file so the RPATH does not end with a colon- EA-9178: Remove trailing colon from library's RPATH- ZC-6844: ea-libzip fix problems for CentOS 8- EA-9127: Update ea-libzip from v1.7.0 to v1.7.1- EA-9101: Update from upstream to 1.7.0- ZC-6449: Was not generating all the libzip.so variants.- ZC-6348: Remove jury rigged build system- ZC-6083: Create ea-libzip package.hou-1 1647635354�1.8.0-1.1.10.cpanel1.8.0-1.1.10.cpanellibzip.solibzip.so.5libzip.so.5.4/opt/cpanel/ea-libzip/lib64/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong �x�������������0+�����X�#�gJj�{������6��������������������������������=��?��d����	�	6����� �+�6�?�	s�������	&
P��
(|�Nt��	@I(z8��9��:SB�G�DH��I��X�Y�\�(]�|^��	b��d��e��f��l����������H�PH
���������g��h��Calt-openldap112.4.4613.el7LDAP support librariesOpenLDAP is an open source suite of LDAP (Lightweight Directory Access
Protocol) applications and development tools. LDAP is a set of
protocols for accessing directory services (usually phone book style
information, but other information is possible) over the Internet,
similar to the way DNS (Domain Name System) information is propagated
over the Internet. The openldap package contains configuration files,
libraries, and documentation for OpenLDAP._�+buildfarm02.cloudlinux.com�CloudLinuxCloudLinuxOpenLDAPCloudLinux Packaging Team <packager@cloudlinux.com>Unspecifiedhttp://www.openldap.org/linuxx86_64��h�(A�p�k�
�	)�B�NA�A큤����������A�A큤����A큤������_�_�_�_��_�!_��_�!_��_�!_�_�!_�_�!Z��[Z��[Z��[_�!Z��[Z��[_�_�3bea281bbd267ed31c02249d9ce4c7659d764c6c36b0f0c81a39e4c810236eb27da420ee3fa2b558e18bad3ba6a5aa194a7ccc1c069ac55c47937903e48c020698c0436567f4f70470013e12d28234e346ab418dc51c2d675779f2a0352d4050d38e426c17bff3f3344c5dcda98e728e6a87c5b3d70a1118a0a99310b5b19e973ca10457421ba145b4175c7d1c076aedc62cb480beed677444341bdf78a78bd13603888ce349ecce20339a3e61567b09276994cd01354ef61572523270f9dc3d5a792b5de07584b3274ee0b60e6efa01553a45014fd59fdc46c9bf87e1c3f21229eedf7e7233357bb1fa5f36a21401695899ec67573261c37a8e8c4fa45be32da207b1dd64d275e3cbe0bed9ae5e8b05f410318984c4c84ca07c992808da4379310fe25c858a9515fc8c8d7d1f24a67c9496f84a91e0a0e41ea9975b1371e569ba8731ff8fcea4ccff4fa090790a036bf3cead0f6b0c5d6a09300d2034078a12eb6ac16aa5a3bc72b635fc44455c6a0f86dca475a287e956dc663014a89bd207liblber-2.4.so.2.10.9libldap-2.4.so.2.10.9libldap_r-2.4.so.2.10.9libslapi-2.4.so.2.10.9��rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootalt-openldap11-2.4.46-13.el7.src.rpm������������������������������������������������������������������������������������alt-openldap11alt-openldap11(x86-64)


@@@@@@@@@@@@@@
nss-toolsalt-openssl11rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(CompressedFileNames)libc.so.6()(64bit)libc.so.6(GLIBC_2.12)(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.3)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)liblber-2.4.so.2()(64bit)libpthread.so.0()(64bit)libpthread.so.0(GLIBC_2.2.5)(64bit)libpthread.so.0(GLIBC_2.3.2)(64bit)libresolv.so.2()(64bit)libresolv.so.2(GLIBC_2.2.5)(64bit)libsasl2.so.3()(64bit)rpmlib(PayloadIsXz)1.1.14.6.0-14.0-13.0.4-15.2-14.11.3_�@^�@^��]Y=�\��[��[H�@[?Y�[?Y�[<��[<��[3|@Z�2@Z�1@Z��@Z���Z�_@Z�0@Z}�@Zz�@Zz�@Zc/@Z'�Y�Z@Y�@Yy�Y_w�Y_w�Y3�@X�D�X��@X���X�*�X�*�X��x�������������������X#*fJj�������������1Y�����Y����������������1Y2Y�B��?�(d����	�	]������������	B�T�i�ox�	
8�	0
	H	�
 
�
�4555(w8��9<�:1��G��H�LI��X��Y��\��]�D^�Rb��d�[e�`f�cl�et�|u��v�<w��x�Xy�����$�8�<�T�d
�|�������g��h��Celfutils0.1765.el7A collection of utilities and DSOs to handle ELF files and DWARF dataElfutils is a collection of utilities, including stack (to show
backtraces), nm (for listing symbols from object files), size
(for listing the section sizes of an object or archive file),
strip (for discarding symbols), readelf (to see the raw ELF file
structures), elflint (to check for well-formed ELF files) and
elfcompress (to compress or decompress ELF sections)._vx86-02.bsys.centos.org��CentOSGPLv3+ and (GPLv2+ or LGPLv3+)CentOS BuildSystem <http://bugs.centos.org>Development/Toolshttp://elfutils.org/linuxx86_64^�����n��0N8_����NP��M�^�N`����OG�KF������������������A큤����A큤����_v_v_v_v_v_v_v�_v_v_v_v_v_v_v_v_v_v\f��\f��\f��_v\f��\f��\f��87501177f4a56c6a952ad6954cf0fcb6ddfc371fd6b75b84042e789085dbb30ba6cec82c759faa3116b1e01aacf83b33a8f289b1e52a464aa9ae569ac2a36ccb4ced3776eae3ea70592b9fdf4f9486f85ae0038ef16cb267e3858fd3f8bd54ac91de09dc95c64ae10d05f768f25227dcd11cc705c940d77d05b4dbea975cf926b8802701278a9b0a8b113c332ca696b2987c21df4fbbe4d47c5d4530132a8576113137bd7da4c5dd028b9633513d53e2b09aabf791ace5cdf2b5490ef835ba433b23682b1a18e7a2d31bb0590a5bb08675bb4d8c3a1ffa216d9ef644e1c4eec72a731af435dac922400793b9ebf2daa7ef40c45b850628a538595c3a058ed1385d497ffbf5ad6ec91f2c9aec73697bebf16a49eaf24e1b6b1fbb513cefdc6f9d1109ef5b05307be75e2576e181f076d253cdf156cc3309d3fabf10c2b17e485a6d61235129deff2c447b8c2c0a73e387e8bc3ce25f26f9ada8fa43646ee3b7570a1b4129e39d3bde3a150652795964ef007dc213ddaba9fca283147cf74334e53cc50aaf7cb03ddb2a5e743fd52d2fbf6b46b7ada58bc48e2e1fd00a15c84061ee59c208db79563898f3999771648877f2bc847305119f51d8aa4ad300b770bd4160f5b0de5af0432c3d2c04b53dc0ad25025419a0da0967cbd2ff99d1b3f2e84aa654e91e3e334d7fe3222bb706a4a43e6e1645119c0876a457f2da20e962b1a606c476f335b42734f394cb88338e68aa6db4b9eb78f7baa02f6d0c45fba03f8d19b9376872da8d3c3ba8a651b446c8fb7816f2cff1ca77f313e2fa63cda6c86870859dad32744427eeb4f7214928e46d3c21a7f79eb985ceb4e38687a183fa8ceb4b9ee5adedde47b31e975c1d90c73ad27b6b165a1dcd80c7c545eb65b9038177f97513213526df2cf6184d8ff986c675afb514d4e68a404010521b880643da7eabb7bafdf7d3ae5e9f223aa5bdc1eece45ac569dc21b3b037520b4464768���rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootelfutils-0.176-5.el7.src.rpm������������������������������������������������������������������������������������������������elfutilselfutils(x86-64)@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@�x������������� 
�����X�#`gJj�d�����������]y�����5����������������]y�D�?�T?��d����	/�	s��������+�	O�e�y���	�
��
4Rp���

W
(�8�-9
d-:<�-F��G��H��I��X��Y��\�(]�@^��b�nc�3d��e��f��l��z�������������
���<�@�Hg�Lh�PCea-php54-php-mbstring5.4.4581.82.14.cpanelA module for PHP applications which need multi-byte string handlingThe ea-php54-php-mbstring package contains a dynamic shared object that will add
support for multi-byte string handling to PHP.i���hou-1,��EA4-production / CentOS_7cPanel, Inc.PHP and LGPLv2 and BSD and OpenLDAPDevelopment/Languageshttp://www.php.net/linuxx86_649,X_EA�����A큤����i��i��i���i���i���i���2d7312563bcc11784d711e5055dd7450ce38b6cc91c9848899be0ddfd2afe9e2d3b91f190e4c54b0a9b68e83da977b26b28c70601bd54686e9aae142bcc59470eea173a556abac0370461e57e12aab266894ea6be3874c2be05fd87871f7544926b6fbd57dab3de16ae8b8f0abefb0cdeed6898ec2e5bc1a759b39a36ec55e6f3bbb1a49c318982a054416eeeee1c15c10666b44d7fcfa7455200836e2a0ee4frootrootrootrootrootrootrootrootrootrootrootrootea-php54-php-5.4.45-81.82.14.cpanel.src.rpm������������������������ea-php54-php-mbstringea-php54-php-mbstring(x86-64)


@@@@@@@
ea-php54-php-commonea-php54-php-clirpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(CompressedFileNames)libc.so.6()(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.3)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)rtld(GNU_HASH)rpmlib(PayloadIsXz)5.4.45-81.82.14.cpanel5.4.45-81.82.14.cpanel4.6.0-14.0-13.0.4-15.2-14.11.3h�;@f�)@e\��dd��d[�@b\@a�@`ٹ�`B@_�]@_R,@_�@^|�@^`�^^F�]��]��]z3@]5�@]#0@]�\��@\���\��\J�@[O+�[{@Z�3@ZԐ@Z���Z���Za�ZX�@ZWQ�ZT��Z)-@ZN�Y�@Y�Y�A@Y�o@Y�3�Yw2�YS�@YK�@Y;@Y�Y�@Yi@X�:@X��X�C�X��@X�e@X�*�XEV�X.�@X.�@X-��W�W��@W�@W��Wu	�Wg�W_�WYZ@WM|�WE��W�@V��V�&@V��V��@Vr��Vr��Vj��Vh�VE�V��U�U�@U�L@U�n�U�n�U�@Um��Ud`@U:�U@TH�TD�@T3�R��@R��@REs@R8D@R�Q��Q��Q��@Q��@Q��Qy�Qf��Q@j@P��@PѬ@P��P�@P�@P�*�P��@P��@P�)�P�)�P���P���P���P���P���P�5@P{��Px@Pl(�Pj�@Pi��Pi��Pe�@P`K@PY��PY��PY��PXb@PW�PS@P2&�P.2@P	H@O�@O�@O��O��@O�\@O�s@O��@O��@Ov�OtN�OpZ@OpZ@OP�@O?��O-�O�O�@O	�@N��N��N��@N��@N�@NoE�NS�@NL��N7@M���M��M���MT�Mt�Mk�@MfH@MR��M'@M�@M�@Mg�L�8�LΫ�Lʷ@L���LH2�K��@K��@K�C�K�@K
@K��K�@J��@JlE@J_@J_@J\s@JY�@J> �I�'@I��@I��I��@I��@I}��I|T@Iy�@IC��I>]�I:i@I9�I*�@I9@H˫@H�(�H{?�Hv@G��G�Z@Gt�@GV��GV��GV@F��Fڥ�F�@F�S@F�S@F�]�F��Fw�@FiD�FA��F@f@F; @F�@F@Eّ@E�K@E��E�3@Eu_@El$�El$�Ej�@E[@E[@EG:�E#�@D�,@D��@D�b�D�b�D�(@DtJ�Dla�D_2�DX�@D;@C�@C�C�Q@Cˊ�Cǖ@C�
@C��C�f@C�q�C� @C��@C�7@C��@Cs6@CoA�CgX�C(�B�i�B{\@Bwg�Bl�B]	�B]	�B]	�B[�@BZf�BQ,@BM7�BJ��BB��B�B	�@A�@A��A��A�_�A�_�A�_�AJ�AJ�AJ�A@E�A
@Ag@Chris Castillo <chris.castillo@webpros.com> - 5.4.45-81Julian Brown <julian.brown@cpanel.net> - 5.4.45-80Tim Mullin <tim@cpanel.net> - 5.4.45-79Julian Brown <julian.brown@cpanel.net> - 5.4.45-78Brian Mendoza <brian.mendoza@cpanel.net> - 5.4.45-77Travis Holloway <t.holloway@cpanel.net> - 5.4.45-76Dan Muey <dan@cpanel.net> - 5.4.45-75Travis Holloway <t.holloway@cpanel.net> - 5.4.45-74C�x��������������������X�#gJj�������	����¡�����*����������������¡áa��i Collet <rcollet@redhat.com> - 5.5.6-6Remi Collet <rcollet@redhat.com> - 5.5.6-5Remi Collet <rcollet@redhat.com> - 5.5.6-4Remi Collet <rcollet@redhat.com> 5.5.6-3Remi Collet <rcollet@redhat.com> 5.5.6-2Remi Collet <rcollet@redhat.com> 5.5.6-0Remi Collet <rcollet@redhat.com> 5.5.5-1Remi Collet <rcollet@redhat.com> 5.5.4-1Remi Collet <rcollet@redhat.com> 5.5.3-1Remi Collet <rcollet@redhat.com> 5.5.1-1Remi Collet <rcollet@redhat.com> 5.4.16-6Remi Collet <rcollet@redhat.com> 5.4.16-5Remi Collet <rcollet@redhat.com> 5.4.16-4Remi Collet <rcollet@redhat.com> - 5.4.16-3Remi Collet <rcollet@redhat.com> 5.4.16-2Remi Collet <rcollet@redhat.com> 5.4.16-1Remi Collet <rcollet@redhat.com> 5.4.14-3Remi Collet <rcollet@redhat.com> 5.4.14-2Remi Collet <rcollet@redhat.com> 5.4.14-1Remi Collet <rcollet@redhat.com> 5.4.13-1Remi Collet <rcollet@redhat.com> 5.4.11-1Remi Collet <rcollet@redhat.com> 5.4.10-1Remi Collet <rcollet@redhat.com> 5.4.9-1Remi Collet <rcollet@redhat.com> 5.4.8-7Remi Collet <rcollet@redhat.com> 5.4.8-6Remi Collet <rcollet@redhat.com> 5.4.8-5Remi Collet <rcollet@redhat.com> 5.4.8-6Remi Collet <rcollet@redhat.com> 5.4.8-4Remi Collet <rcollet@redhat.com> 5.4.8-4Remi Collet <rcollet@redhat.com> 5.4.8-3Joe Orton <jorton@redhat.com> - 5.4.8-2Remi Collet <rcollet@redhat.com> 5.4.8-3Remi Collet <rcollet@redhat.com> 5.4.8-2.1Remi Collet <rcollet@redhat.com> 5.4.8-2Remi Collet <rcollet@redhat.com> 5.4.8-1.2Remi Collet <rcollet@redhat.com> 5.4.8-1Remi Collet <rcollet@redhat.com> 5.4.7-4Remi Collet <rcollet@redhat.com> 5.4.7-3Remi Collet <rcollet@redhat.com> 5.4.7-2Remi Collet <rcollet@redhat.com> 5.4.7-1Remi Collet <remi@fedoraproject.org> 5.4.7-10Remi Collet <remi@fedoraproject.org> 5.4.7-9Remi Collet <rcollet@redhat.com> 5.4.7-8Remi Collet <rcollet@redhat.com> 5.4.7-7Remi Collet <rcollet@redhat.com> 5.4.7-6Remi Collet <rcollet@redhat.com> 5.4.7-5Remi Collet <rcollet@redhat.com> 5.4.7-4Remi Collet <rcollet@redhat.com> 5.4.7-3Remi Collet <remi@fedoraproject.org> 5.4.7-2Remi Collet <remi@fedoraproject.org> 5.4.7-1Remi Collet <remi@fedoraproject.org> 5.4.6-2Remi Collet <remi@fedoraproject.org> 5.4.6-1Remi Collet <remi@fedoraproject.org> 5.4.5-1Remi Collet <remi@fedoraproject.org> 5.4.4-4Remi Collet <remi@fedoraproject.org> 5.4.4-3Remi Collet <remi@fedoraproject.org> 5.4.4-2Remi Collet <remi@fedoraproject.org> 5.4.4-1Remi Collet <remi@fedoraproject.org> 5.4.3-1Remi Collet <remi@fedoraproject.org> 5.4.2-1Remi Collet <remi@fedoraproject.org> 5.4.1-1Joe Orton <jorton@redhat.com> - 5.4.0-6Remi Collet <remi@fedoraproject.org> 5.4.0-5Joe Orton <jorton@redhat.com> - 5.4.0-4Joe Orton <jorton@redhat.com> - 5.4.0-3Joe Orton <jorton@redhat.com> - 5.4.0-2Remi Collet <remi@fedoraproject.org> 5.4.0-1Remi Collet <remi@fedoraproject.org> 5.4.0-0.4.RC8Remi Collet <remi@fedoraproject.org> 5.4.0-0.3.RC7Remi Collet <remi@fedoraproject.org> 5.4.0-0.2.RC6Remi Collet <remi@fedoraproject.org> 5.4.0-0.1.RC6Remi Collet <remi@fedoraproject.org> 5.3.8-4.4Remi Collet <remi@fedoraproject.org> 5.3.8-4.3Adam Jackson <ajax@redhat.com> - 5.3.8-4.2Marcela Mašláňová <mmaslano@redhat.com> - 5.3.8-3.2Peter Schiffer <pschiffe@redhat.com> - 5.3.8-3.1Remi Collet <remi@fedoraproject.org> 5.3.8-3Remi Collet <remi@fedoraproject.org> 5.3.8-2Remi Collet <remi@fedoraproject.org> 5.3.8-1Remi Collet <remi@fedoraproject.org> 5.3.7-1Joe Orton <jorton@redhat.com> - 5.3.6-4Remi Collet <Fedora@famillecollet.com> 5.3.6-3Remi Collet <Fedora@famillecollet.com> 5.3.6-2Remi Collet <Fedora@famillecollet.com> 5.3.6-1Joe Orton <jorton@redhat.com> - 5.3.5-6Caolán McNamara <caolanm@redhat.com> 5.3.5-5Remi Collet <Fedora@famillecollet.com> 5.3.5-4Remi Collet <Fedora@famillecollet.com> 5.3.5-3Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 5.3.5-2Remi Collet <Fedora@famillecollet.com> 5.3.5-1Remi Collet <rpms@famillecollet.com> 5.3.4-2Remi Collet <rpms@famillecollet.com> 5.3.4-1.1Remi Collet <Fedora@famillecollet.com> 5.3.4-1Remi Collet <Fedora@famillecollet.com> �x�������������������X#�gJj�����d������P����+�����}����������������+��)�tempt to free initilized pointer (#717338)
- Fix leak on pem_CreateObject when given non-existing file name (#734760)
- Fix pem_Initialize to return CKR_CANT_LOCK on multi-treaded calls (#736410)- Update builtins certs to those from NSSCKBI_1_87_RTM- Update to NSS_3_12_11_RTM- Indicate the provenance of stripped source tarball (#688015)- Provide virtual -static package to meet guidelines (#609612).- Enable pluggable ecc support (#712556)
- Disable the nssdb write-access-on-read-only-dir tests when user is root (#646045)- make the testsuite non fatal on arm arches- Fix crmf hard-coded maximum size for wrapped private keys (#703656)- Update to NSS_3_12_10_RTM- Update to NSS_3_12_10_BETA1- Implement PEM logging using NSPR's own (#695011)- Update to NSS_3.12.9_WITH_CKBI_1_82_RTM- Short-term fix for ssl test suites hangs on ipv6 type connections (#539183)- Add a missing requires for pkcs11-devel (#675196)- Run the test suites in the check section (#677809)- Fix cms headers to not use c++ reserved words (#676036)
- Reenabling Bug 499444 patches
- Fix to swap internal key slot on fips mode switches- Revert patches for 499444 until all c++ reserved words are found and extirpated- Rebuilt for https://fedoraproject.org/wiki/Fedora_15_Mass_Rebuild- Fix cms header to not use c++ reserved word (#676036)
- Reenable patches for bug 499444- Revert patches for 499444 as they use a C++ reserved word and
  cause compilation of Firefox to fail- Fix the earlier infinite recursion patch (#499444)
- Remove a header that now nss-softokn-freebl-devel ships- Fix infinite recursion when encoding NSS enveloped/digested data (#499444)- Update the cacert trust patch per upstream review requests (#633043)- Fix to honor the user's cert trust preferences (#633043)
- Remove obsoleted patch- Update to 3.12.9- Rebuilt according to fedora pre-release package naming guidelines- Update to NSS_3_12_9_BETA2
- Fix libpnsspem crash when cacert dir contains other directories (#642433)- Update to NSS_3_12_9_BETA1- Update pem source tar with fixes for 614532 and 596674
- Remove no longer needed patches- Update PayPalEE.cert test certificate which had expired- Tell rpm not to verify md5, size, and modtime of configurations file- Fix certificates trust order (#643134)
- Apply nss-sysinit-userdb-first.patch last- Move triggerpostun -n nss-sysinit script ahead of the other ones (#639248)- Fix invalid %postun scriptlet (#639248)- Replace posttrans sysinit scriptlet with a triggerpostun one (#636787)
- Fix and cleanup the setup-nsssysinit.sh script (#636792, #636801)- Add posttrans scriptlet (#636787)- Update to 3.12.8
- Prevent disabling of nss-sysinit on package upgrade (#636787)
- Create pkcs11.txt with correct permissions regardless of umask (#636792) 
- Setup-nsssysinit.sh reports whether nss-sysinit is turned on or off (#636801)
- Added provides pkcs11-devel-static to comply with packaging guidelines (#609612)- NSS 3.12.8 RC0- Fix nss-util_version and nss_softokn_version required to be 3.12.7.99.3- NSS 3.12.8 Beta3
- Fix unclosed comment in renegotiate-transitional.patch- Change BuildRequries to available version of nss-util-devel- Define NSS_USE_SYSTEM_SQLITE and remove unneeded patch
- Add comments regarding an unversioned provides which triggers rpmlint warning
- Build requires nss-softokn-devel >= 3.12.7- Update to 3.12.7- Apply the patches to fix rhbz#614532- Removed pem sourecs as they are in the cache- Add support for PKCS#8 encoded PEM RSA private key files (#614532)- Fix nsssysinit to return userdb ahead of systemdb (#603313)- Require and BuildRequire >= the listed version not =- Require nss-softoken 3.12.6- Fix SIGSEGV within CreateObject (#596674)- Update pem source tar to pick up the following bug fixes:
- PEM - Allow collect objects to search through all objects
- PEM - Make CopyObject return a new shallow copy
- PEM - Fix memory leak in pem_mdCryptoOperationRSAPriv- Update the test cert in the setup phase- Add sed to sysinit requires as setup-nsssysinit.sh requires it (#57607�x��������������������X�#&gJj����؊�����������}P���������������������}P|P�?*�?&Hd����	+�	g�����6�C�	G�]�q�w��	�
��
$.8dl���(&80J9XJ:SJF$.G$@H$HI$PX$TY$\\$�]$�^$�b$�c%�d&e&f&l&z&3�&D&X&\(t(�
*��*�*�*�g*�h*�Cea-php80-php-posix8.0.3010.17.6.cpanelModules for PHP scripts that need access to POSIX functionsThe php-posix package adds a PHP interface to those functions defined
in the IEEE 1003.1 (POSIX.1) standards document which are not
accessible through other means.i��hou-1��EA4-production / CentOS_7cPanel, Inc.PHPDevelopment/Languageshttp://www.php.net/linuxx86_643ʸ����i���i���30eb80fac3f7f398d6a1aac09407f54d7c1cf06ff37ac48fa63baef8cfede484dbde205d9422fe3a1be7821af55225719674d03db9214c2c858aa3cb708ee52brootrootrootrootea-php80-php-8.0.30-10.17.6.cpanel.src.rpm��������ea-php80-php-posixea-php80-php-posix(x86-64)


@@@@@
ea-php80-php-common(x86-64)ea-php80-php-cli(x86-64)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(CompressedFileNames)libc.so.6()(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.4)(64bit)rtld(GNU_HASH)rpmlib(PayloadIsXz)8.0.30-10.17.6.cpanel8.0.30-10.17.6.cpanel4.6.0-14.0-13.0.4-15.2-14.11.3i`�h�@g}@g�@f�o@f�K�e�4@ehy@ee�@d��@d��du�@df@dd��dX�@d,@c�w�c��@c���c�E�cs@c[�@c6�@c5��c1�@c��b�b��b�2@b|��bY^@b3"�b\@b�@a�N�aՈ@a�@a�d�a���a�{�a���a�@aqV@an�@a]��aV�@aLl@a'�@a�@`�#@`ݮ@`ٹ�`��`� @`���`B@`@�`3@_���_��_���_�G@_��@_�i�_�#�_��@_��@_���_���_���_�"�_i�@_FN�_
�@Gary Stanley <gary.stanley@webpros.com> - 8.0.30-10Chris Castillo <chris.castillo@webpros.com> - 8.0.30-9Dan Muey <daniel.muey@webpros.com> - 8.0.30-8Julian Brown <julian.brown@cpanel.net> - 8.0.30-7Dan Muey <dan@cpanel.net> - 8.0.30-6Julian Brown <julian.brown@cpanel.net> - 8.0.30-5Travis Holloway <t.holloway@cpanel.net> - 8.0.30-4Tim Mullin <tim@cpanel.net> - 8.0.30-3Julian Brown <julian.brown@cpanel.net> - 8.0.30-2Cory McIntire <cory@cpanel.net> - 8.0.30-1Cory McIntire <cory@cpanel.net> - 8.0.29-1Travis Holloway <t.holloway@cpanel.net> - 8.0.28-6Julian Brown <julian.brown@cpanel.net> - 8.0.28-5Julian Brown <julian.brown@cpanel.net> - 8.0.28-4Brian Mendoza <brian.mendoza@cpanel.net> - 8.0.28-3Julian Brown <julian.brown@cpanel.net> - 8.0.28-2Cory McIntire <cory@cpanel.net> - 8.0.28-1Tim Mullin <tim@cpanel.net> - 8.0.27-2Cory McIntire <cory@cpanel.net> - 8.0.27-1Cory McIntire <cory@cpanel.net> - 8.0.26-1Travis Holloway <t.holloway@cpanel.net> - 8.0.25-2Cory McIntire <cory@cpanel.net> - 8.0.25-1Cory McIntire <cory@cpanel.net> - 8.0.24-1Julian Brown <julian.brown@cpanel.net> - 8.0.23-3Dan Muey <dan@cpanel.net> - 8.0.23-2Cory McIntire <cory@cpanel.net> - 8.0.23-1Cory McIntire <cory@cpanel.net> - 8.0.22-1Cory McIntire <cory@cpanel.net> - 8.0.21-1Cory McIntire <cory@cpanel.net> - 8.0.20-1Cory McIntire <cory@cpanel.net> - 8.0.19-1Cory McIntire <cory@cpanel.net> - 8.0.18-1Cory McIntire <cory@cpanel.net> - 8.0.17-1Travis Holloway <t.holloway@cpanel.net> - 8.0.16-2Cory McIntire <cory@cpanel.net> - 8.0.16-1Cory McIntire <cory@cpanel.net> - 8.0.15-1Julian Brown <julian.brown@cpanel.net> - 8.0.14-5Dan Muey <dan@cpanel.net> - 8.0.14-4�x�������������������Xw#fJj������������������9X�����Q����������������9X8X:X�ve when installing debuginfo (jmoskovc@redhat.com)
- lib/Plugins/CCpp.cpp: add build-ids to backtrace (vda.linux@googlemail.com)
- lib/Plugins/CCpp.cpp: do not use temp file for gdb commands - use -ex CMD instead (vda.linux@googlemail.com)
- GUI: added refresh button, added sanity check to plugin settings (jmoskovc@redhat.com)
- Initial man page for abrt-cli (kklic@redhat.com)
- Added --version, -V, --help, -? options. Fixed crash caused by unknown option. (kklic@redhat.com)
- Date/time honors current system locale (kklic@redhat.com)
- fixed saving/reading user config (jmoskovc@redhat.com)
- SPEC: added gnome-python2-gnomekeyring to requirements (jmoskovc@redhat.com)
- GUI: call Report() with the latest pluginsettings (jmoskovc@redhat.com)
- Fix Bug 526220 -  [abrt] crash detected in abrt-gui-0.0.9-2.fc12 (vda.linux@googlemail.com)
- removed unsecure reading/writting from ~HOME directory rhbz#522878 (jmoskovc@redhat.com)
- error checking added to archive creation (danny@rawhide.localdomain)
- try using pk-debuginfo-install before falling back to debuginfo-install (vda.linux@googlemail.com)
- abrt-gui: make "report" toolbar button work even if abrtd is not running (vda.linux@googlemail.com)
- set LIMIT_MESSAGE to 16k, typo fix and daemon now reads config information from dbus (npajkovs@redhat.com)
- add support for abrtd autostart (vda.linux@googlemail.com)
- GUI: reversed the dumplist, so the latest crashes are at the top (jmoskovc@redhat.com)
- rewrite FileTransfer to use library calls instead of commandline calls for compression (dnovotny@redhat.com)
- and many minor fixes ..- added bug-buddy to provides rhbz#524934- new version
- comments and how to reproduce are stored now (npajkovs@redhat.com)
- reduce verbosity a bit (vda.linux@googlemail.com)
- GUI: fixed word wrap in Comment field rhbz#524349 (jmoskovc@redhat.com)
- remove last vestives of dbus-c++ from build system (vda.linux@googlemail.com)
- GUI: added popup menu, fixed behaviour when run with root privs (jmoskovc@redhat.com)
- add dbus signalization when quota exceeded (npajkovs@redhat.com)
- Added cleaning of attachment variable, so there should not be mixed attachmetn anymore. (zprikryl@redhat.com)
- fixed closing of debug dump in case of existing backtrace (zprikryl@redhat.com)
- remove C++ dbus glue in src/CLI; fix a bug in --report (vda.linux@googlemail.com)
- new polkit action for installing debuginfo, default "yes" (danny@rawhide.localdomain)
- Polkit moved to Utils (can be used both in daemon and plugins) (danny@rawhide.localdomain)
- oops... remove stray trailing '\' (vda.linux@googlemail.com)
- GUI: added missing tooltips (jmoskovc@redhat.com)
- PYHOOK: ignore KeyboardInterrupt exception (jmoskovc@redhat.com)
- added ticket uploader plugin (gavin@redhat.com) (zprikryl@redhat.com)
- GUI: added UI for global settings (just preview, not usable!) (jmoskovc@redhat.com)
- Add checker if bugzilla login and password are filled in. (npajkovs@redhat.com)
- Add new config option InstallDebuginfo into CCpp.conf (npajkovs@redhat.com)
- translation updates
- many other fixes- new version
- APPLET: added about dialog, removed popup, if icon is not visible, fixed (trac#43) (jmoskovc@redhat.com)
- renamed abrt to abrtd, few minor spec file fixes (jmoskovc@redhat.com)
- Made abrt service start by deafult (jmoskovc@redhat.com)
- add gettext support for all plugins (npajkovs@redhat.com)
- APPLET: removed the warning bubble about not running abrt service (walters)
- APPLET: changed tooltip rhbz#520293 (jmoskovc@redhat.com)
- CommLayerServerDBus: rewrote to use dbus, not dbus-c++ (vda.linux@googlemail.com)
- fixed timeout on boot causing [ FAILED ] message (vda.linux@googlemail.com)
- and many other fixes- Change Conflicts: kerneloops to be an Obsoletes so we do the right thing
  on upgrades.  Also add an Obsoletes: bug-buddy.- new version
- resolved: Bug 518420 -  ordinary user's abrt-applet shows up for root owned crashes (npajkovs)
- GUI: added support for gettext (+part of czech translation) (jmoskovc)
- added support for saving setting�x�������������x������Xx#�fJj�����K������PQ�������j�����\�����������������j�j�p�t.com> 0.2.2-2Guenther Deschner <gdeschner@redhat.com> 0.2.1-2Guenther Deschner <gdeschner@redhat.com> 0.2.0-1Simo Sorce <simo@redhat.com> - 0.1.0-0Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 0.0.3-8Guenther Deschner <gdeschner@redhat.com> 0.0.3-7Guenther Deschner <gdeschner@redhat.com> 0.0.2-6Guenther Deschner <gdeschner@redhat.com> 0.0.2-5Guenther Deschner <gdeschner@redhat.com> 0.0.2-4Guenther Deschner <gdeschner@redhat.com> 0.0.2-3Guenther Deschner <gdeschner@redhat.com> 0.0.1-2Guenther Deschner <gdeschner@redhat.com> 0.0.1-1Simo Sorce <simo@redhat.com> - 0.0.2-0- Always free ciphertext data in gp_encrypt_buffer
- Resolves: #1887438- Make syslog of call status configurable
- Resolves: #1373421- Fix double free of popt context when querying version
- Resolves: #1752810- Update docs to reflect actual behavior of krb5_principal
- Resolves: #1553094- Avoid uninitialized free when allocating buffers
- Resolves: #1699331- Fix explicit NULL deref on some enctypes
- Resolves: #1699331- Add a safety timeout to epoll
- Resolves: #1687899- Use pthread keys for thread local storage
- Resolves: #1618375- Add hack to support read-only root
- Resolves: #1542567- Always choose highest requested debug level
- Resolves: #1505741- Clean up debug man page + behavior
- Resolves: #1554249- Always use the encype we selected
- Resolves: #1549684- Don't leak mech_type when CONTINUE_NEEDED from init_sec_context
- Resolves: #1553819- Conditionally reload kernel interface on SIGHUP
- Resolves: #1507817- Backport epoll() logic
- Resolves: #1507817- Properly initialize ccaches before storing into them
- Resolves: #1488629- Properly locate credentials in collection caches in mechglue
- Resolves: #1488629- Handle outdated encrypted ccaches
- Resolves: #1488629- Handle outdated encrypted ccaches
- Resolves: #1488629- Fix error message handling in gp_config_from_dir()
- Resolves: #1458913- Fix concurrency issue around server socket handling
- Resolves: #1462974- Log useful warning and merge when config file has duplicate sections
- Resolves: #1458913- Add Conflicts: line for old selinux-policy
- Resolves: #1458850- Backport NFS-related gssproxy.service changes
- Resolves: #1326440- Fix segfault when no config files are present
- Resolves: #1451255- Backport hardening improvements
- Resolves: #1462974- Make proc file failure loud but nonfatal
- Resolves: #1449238- Stop shipping NFS server snippet (nfs-utils takes it instead)
- Resolves: #1379836- Fix credential handling with mod_auth_gssapi that we broke
- Resolves: #1379836- New upstream version - 0.7.0
- Resolves: #1379836- Include fixes for NULL-termination
- Resolves: #1379836- Document debug_level option
- Resolves: #1379836- Enable running the test suite
- Resolves: #1379836- Rebase to latest version since we have krb5-1.15
- Resolves: #1379836
- Resolves: #1344518
- Resolves: #1366782
- Resolves: #1379005
- Resolves: #1379482
- Resolves: #1379616
- Resolves: #1380490
- Resolves: #1378600
- Resolves: #1285012
- Resolves: #1333813- Third try is the charm
- Resolves: #1092515- Restore _FORTIFY_SOURCE behavior
- Resolves: #1092515- Actually harden build with PIE and RELRO
- Resolves: #1092515- Fix behavior with multiple keys in a keytab
- Resolves: #1285012- Re-open socket in mechglue if client forks/changes privilege
- Resolves: #1340259- Make GSS-Proxy work with krb5-1.14
- resolves: #1292487- Fix loop cause by imporper EINTR handling
- resolves: #1266564- Remove extra whitespaces from #1208640/#1194299 patches
- spec file cleanup
related: #1208640 #1194299- Carry service/HTTP default conf section
- resolves: #1208640- Set default rcache location patch
- resolves: #1194299- Bug #1213852 ("[gssproxy] NFS clients cannot mount with
  sec=krb5 if the NFS server is running gssproxy") was
  fixed by the rebase to 0.4.1 in bug ("[RFE] Rebase
  gssproxy to the latest to match expectations of other
  projects").
  Note that the same bug was also fixed in the kernel with
  "9507271 svcrpc: fix potential GS�x�������������������X#�fJj�c������������j�����]�����������������j�j�j�gssrpc_4_MIT)(64bit)libini_configlibini_config.so.3()(64bit)libini_config.so.3(INI_CONFIG_1.1.0)(64bit)libini_config.so.3(INI_CONFIG_1.2.0)(64bit)libk5crypto.so.3()(64bit)libk5crypto.so.3(k5crypto_3_MIT)(64bit)libkrb5.so.3()(64bit)libkrb5.so.3(krb5_3_MIT)(64bit)libpopt.so.0()(64bit)libpopt.so.0(LIBPOPT_0)(64bit)libpthread.so.0()(64bit)libpthread.so.0(GLIBC_2.2.5)(64bit)libpthread.so.0(GLIBC_2.3.2)(64bit)libref_array.so.1()(64bit)libref_array.so.1(REF_ARRAY_0.1.1)(64bit)libselinux.so.1()(64bit)libverto-module-baselibverto.so.1()(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rtld(GNU_HASH)systemd-unitssystemd-unitssystemd-unitsrpmlib(PayloadIsXz)0.7.0-30.el7_91.151.3.1-313.0.4-14.6.0-14.0-15.2-1selinux-policy3.13.1-166.el7.noarch4.11.3`�Z�^��]�m�]5�@\Ɋ@\�8�\��@\��\��[o�Z��Z��Z��Z1@Z/�Z'�Z!D@Y�e�Y�e�Y�@Y��Y��Y�*@Yé�Y�z�Y��@Y.�@X�P@X��@X•@X�f@X��X�+�X��@Wί�Wί�Wί�WZ��WV�@V���V
}@U�@U�o�U�o�U��@U�b@U�b@Uq�@T�7�S L@R�U�R��R�k�R�<�R��R�R�Rg�@Ra"�Q�Q�y�Q���Q��Q��@Q��@Q��Qw�@QYv�Q�P���P4�P�@P@P
�O�@Or�@N��Robbie Harwood <rharwood@redhat.com> 0.7.0-30Robbie Harwood <rharwood@redhat.com> 0.7.0-29Robbie Harwood <rharwood@redhat.com> 0.7.0-28Robbie Harwood <rharwood@redhat.com> 0.7.0-27Robbie Harwood <rharwood@redhat.com> 0.7.0-26Robbie Harwood <rharwood@redhat.com> 0.7.0-25Robbie Harwood <rharwood@redhat.com> 0.7.0-24Robbie Harwood <rharwood@redhat.com> 0.7.0-23Robbie Harwood <rharwood@redhat.com> 0.7.0-22Robbie Harwood <rharwood@redhat.com> 0.7.0-21Robbie Harwood <rharwood@redhat.com> 0.7.0-20Robbie Harwood <rharwood@redhat.com> 0.7.0-19Robbie Harwood <rharwood@redhat.com> 0.7.0-18Robbie Harwood <rharwood@redhat.com> 0.7.0-17Robbie Harwood <rharwood@redhat.com> 0.7.0-16Robbie Harwood <rharwood@redhat.com> 0.7.0-15Robbie Harwood <rharwood@redhat.com> 0.7.0-14Robbie Harwood <rharwood@redhat.com> 0.7.0-13Robbie Harwood <rharwood@redhat.com> 0.7.0-12Robbie Harwood <rharwood@redhat.com> 0.7.0-11Robbie Harwood <rharwood@redhat.com> 0.7.0-10Robbie Harwood <rharwood@redhat.com> 0.7.0-9Robbie Harwood <rharwood@redhat.com> 0.7.0-8Robbie Harwood <rharwood@redhat.com> 0.7.0-7Robbie Harwood <rharwood@redhat.com> 0.7.0-6Robbie Harwood <rharwood@redhat.com> 0.7.0-5Robbie Harwood <rharwood@redhat.com> 0.7.0-4Robbie Harwood <rharwood@redhat.com> 0.7.0-3Robbie Harwood <rharwood@redhat.com> 0.7.0-2Robbie Harwood <rharwood@redhat.com> 0.7.0-1Robbie Harwood <rharwood@redhat.com> 0.6.2-4Robbie Harwood <rharwod@redhat.com> 0.6.2-3Robbie Harwood <rharwood@redhat.com> 0.6.2-2Robbie Harwood <rharwood@redhat.com> 0.6.2-1Robbie Harwood <rharwood@redhat.com> 0.4.1-13Robbie Harwood <rharwood@redhat.com> 0.4.1-12Robbie Harwood <rharwood@redhat.com> 0.4.1-11Robbie Harwood <rharwood@redhat.com> 0.4.1-10Robbie Harwood <rharwood@redhat.com> 0.4.1-9Robbie Harwood <rharwood@redhat.com> 0.4.1-8Simo Sorce <simo@redhat.com> 0.4.1-7Roland Mainz <rmainz@redhat.com> 0.4.1-6Robbie Harwood <rharwood@redhat.com> 0.4.1-5Robbie Harwood <rharwood@redhat.com> 0.4.1-4Roland Mainz <rmainz@redhat.com> 0.4.1-3Roland Mainz <rmainz@redhat.com> 0.4.1-2Roland Mainz <rmainz@redhat.com> 0.4.1-1Roland Mainz <rmainz@redhat.com> 0.4.1-0Simo Sorce <ssorce@redhat.com> 0.3.0-10Guenther Deschner <gdeschner@redhat.com> 0.3.0-9Daniel Mach <dmach@redhat.com> - 0.3.0-8Guenther Deschner <gdeschner@redhat.com> 0.3.0-7Daniel Mach <dmach@redhat.com> - 0.3.0-6Guenther Deschner <gdeschner@redhat.com> 0.3.0-5Guenther Deschner <gdeschner@redhat.com> 0.3.0-4Guenther Deschner <gdeschner@redhat.com> 0.3.0-3Guenther Deschner <gdeschner@redhat.com> 0.3.0-0Guenther Deschner <gdeschner@redhat.com> 0.2.3-8Guenther Deschner <gdeschner@redhat.com> 0.2.3-6Guenther Deschner <gdeschner@redhat.com> 0.2.3-5Guenther Deschner <gdeschner@redhat.com> 0.2.2-5Guenther Deschner <gdeschner@redhat.com> 0.2.2-4Guenther Deschner <gdeschner@redhat.com> 0.2.2-3Guenther Deschner <gdeschner@redha�x�������������h������X#�fJj����hL������0�����
;�����b����������������
;	;�Bd?�d����	�	^�P�T�l�p�w���	�������	$		6	
H	l	�	
�	�		>d	���(�8�9:	UG	H8	I\	XhYt\�	]�	^b
d
�e
�f
�l
�t
�	u
�	v wL	xp	y������
�HL	Xg\h`Cperl-Data-Dumper2.1453.el7Stringify perl data structures, suitable for printing and evalGiven a list of scalars or reference variables, writes out their contents
in perl syntax. The references can also be objects. The content of each
variable is output in a single Perl statement. Handles self-referential
structures correctly.S��worker1.bsys.centos.org��CentOSGPL+ or ArtisticCentOS BuildSystem <http://bugs.centos.org>Development/Librarieshttp://search.cpan.org/dist/Data-Dumper/linuxx86_64�V�X"<%�A큤A�A��A큤����S��QB�S��S��S��S��QB�~N��S��ef4e2cdf008d49e50122b136f6389d29338c2cfbcf628246c064f401bf2643a663d5bc0299fb9d2cb2ed0364d65c6d0476aebee7d6541d61cecd10518d5a36f654cb516714d74178d3848bcf6eae54fd3007947d8ca24e5650afcb40b034f395d782ecc8442ceb1b1639b645f95a76c5fd9c219d115189e36fd69bf5139442c316e31f0764a75ca49af373ad1f38027fed80b50d8626bdf04618a9d92da371a9rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootperl-Data-Dumper-2.145-3.el7.src.rpm������������������������������������perl(Data::Dumper)perl-Data-Dumperperl-Data-Dumper(x86-64)@@@@@@@@@@


@
libc.so.6()(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)perlperl(:MODULE_COMPAT_5.16.3)perl(B::Deparse)perl(Carp)perl(Exporter)perl(Scalar::Util)perl(XSLoader)perl(bytes)perl(constant)perl(overload)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rtld(GNU_HASH)rpmlib(PayloadIsXz)0:5.006_0013.0.4-14.6.0-14.0-15.2-14.11.1R�U�R�k�QG�Q/F�Q�P�q�Pn�P7l�P(�@P	H@O�F@O� �Daniel Mach <dmach@redhat.com> - 2.145-3Daniel Mach <dmach@redhat.com> - 2.145-2Petr Pisar <ppisar@redhat.com> - 2.145-1Petr Pisar <ppisar@redhat.com> - 2.143-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2.139-2Petr Pisar <ppisar@redhat.com> - 2.139-1Petr Pisar <ppisar@redhat.com> - 2.136-1Petr Pisar <ppisar@redhat.com> - 2.135.07-241Marcela Mašláňová <mmaslano@redhat.com> - 2.135.07-240Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2.131-3Petr Pisar <ppisar@redhat.com> - 2.131-2Petr Pisar <ppisar@redhat.com> 2.131-1- Mass rebuild 2014-01-24- Mass rebuild 2013-12-27- 2.145 bump- 2.143 bump- Rebuilt for https://fedoraproject.org/wiki/Fedora_19_Mass_Rebuild- 2.139 bump- 2.136 bump- Disable tests on bootstrap- update the version to override the module from perl.srpm
- bump release to override sub-package from perl.spec- Rebuilt for https://fedoraproject.org/wiki/Fedora_18_Mass_Rebuild- Perl 5.16 rebuild- Specfile autogenerated by cpanspec 1.78.	�2.1452.145-3.el72.145-3.el7DataD�x�������������������XF#�fJj������������B���5e�����]����������������5e4e6e�h
- ease Autokey setup (#139673)
  - change default keysdir to /etc/ntp/crypto
  - set crypto password in /etc/ntp/crypto/pw
  - don't use randfile if /dev/urandom is used by OpenSSL
- change default statsdir to /var/log/ntpstats/, use statistics type
  as default filename
- package more doc files- update to 4.2.4p2- fix interface updates with -I or -L option (#240254)
- accept multiple -I options
- fix broadcast client/server to accept/allow sending
  broadcasts on 255.255.255.255 (#226958)
- fix return codes in init script (#240120)
- exit with nonzero code if ntpd -q did not set clock (#240134)
- drop revert452 patch, fixed in kernel 2.6.19
- make with _smp_mflags- compile with crypto support on 64bit architectures (#239576)
- update sleep patch- update to 4.2.4p0
- fix init script
  - don't add second -g to ntpd options (#228424)
  - update getopts
  - skip all refclocks when parsing ntp.conf
- spec cleanup- don't wake up every second (#204748)
- add option to enable memory locking (#195617)
- fix broadcast client
- use option values in ntp-keygen
- improve man pages- disable autoopts option preset mechanisms for ntpd
- document -I option of ntpd
- generate makewhatis friendly man pages- update to 4.2.4 (#146884)
- don't use local clock in default config
- autogenerate man pages from HTML
- clean up spec a bit- pass additional options to ntpdate (#202204)- update to 4.2.2p4
- fix buffer overflow in WWV Audio driver (#216309)
- don't mark init script as config- use adjtime when offset is more than 0.5s (#154625)- link ntpd with -ffast-math on ia64 (#147980)- update to 4.2.2p1
- add more examples to ntp.conf- fix manycast support in ntpdate (#194329)
- reply to manycast requests with null refid
- enable mlockall (#195617)
- correct threshold value in ntpdate manpage- update initscript, ntp.conf, man pages
- package sntp- update to ntp-4.2.2
- drop drift file upgrade script
- use proper CFLAGS for ntpstat- modify ntp.conf, change default restrict, remove broadcastdelay,
  use fedora.pool.ntp.org (#189667)
- don't install drift file
- remove unsupported options from ntptrace manpage (#137717)
- fix default paths in manpages for ntp-keygen and ntpdate- add option to sync hwclock after ntpdate (#179571)- fix initscript:
  - replace -U with -u in getopts (#187003)
  - don't pass group to ntpdate -U argument and ignore -i in options (#142926)
  - set ntpconf for -c
  - remove -p 8 from ntpdate arguments
  - don't call ntpdate when step-tickers doesn't contain anything useful
    and -x isn't in options
- fix default keyfile for ntpdate (#183196)- update man pages (#153195, #162856)
- drop C-Frame-121, vsnprintf, minusTi and loconly patch
- prevent segfault when loopback interface is not configured (#159056)
- spec cleanup- bump again for double-long bug on ppc(64)- rebuilt for new gcc4.1 snapshot and glibc changes- rebuilt- ntpd does not submit his local clock (if there is no peer).
  ntpdate->ntpd #163862 , Patch13: ntp-stable-4.2.0a-20050816-loconly.patch- Wrong parameter -T   -i
- Patch ntp-stable-4.2.0a-20050816-minusTi.patch- A similar patch as ntp-4.0.99j-vsnprintf.patch in FEDORA CORE 4
- (current patch is ntp-stable-4.2.0a-20050816-vsnprintf.patch)- Fix fails on upgrade, if ntpd is disabled (#166773)
- A cosmetic patch. There are some comments and braces '{' '}' added.
- One unprintable character was converted to octal-form .
- It can be removed anytime (conversion of the cvs-projets for C-Frame 121,
- (auto-debug, auto-trace for cfr-printnet server).- update to the latest stable 4.2.0.a.20050816
- drop upstreamed .gcc4, .vsnprintf patches
- remove obsolete .autofoo patch
- make patch numbering less chaotic
- don't package backup for .droproot patch- fixed gid setting when ntpd started with -u flag (#147743)- removed -Werror
- patched for gcc4 and rebuilt- Rebuilt for new readline.- patched ntp to build with -D_FORTIFYSOURCE=2 -Wall -Wextra -Werror- removed firewall hole punching from the initscript; rely on iptables
  ESTABLISHED,RELATED or manual firewall co�x�������������Xu�����XH#�fJj���������c����j�����^�����������������j�j�KC�??8d����	�	'�P�T�l�p�w�{�	��������h9�4	T
t��
��$t��3�3
�3`ds(�8�L9�L:qL>7�?7�@7�G7�H8I8TX8dY8p\8�]8�^9�
b:�d;%e;*f;-l;/t;Hu;�v;�w=�x>,y>l2�?4?H?LAdAt
C��C�C�C�gC�hC�Cgssproxy0.7.030.el7_9GSSAPI ProxyA proxy for GSSAPI credential handling`���x86-01.bsys.centos.org�CentOSMITCentOS BuildSystem <http://bugs.centos.org>System Environment/Librarieshttps://pagure.io/gssproxylinuxx86_64
if [ $1 -eq 1 ] ; then 
        # Initial installation 
        systemctl preset gssproxy.service >/dev/null 2>&1 || : 
fi
if [ $1 -eq 0 ] ; then 
        # Package removal, not upgrade 
        systemctl --no-reload disable gssproxy.service > /dev/null 2>&1 || : 
        systemctl stop gssproxy.service > /dev/null 2>&1 || : 
fi
systemctl daemon-reload >/dev/null 2>&1 || : 
if [ $1 -ge 1 ] ; then 
        # Package upgrade, not uninstall 
        systemctl try-restart gssproxy.service >/dev/null 2>&1 || : 
fi����
�``��A큀���������A큤������A�A�A�`���`���`���`���`���`���`���`���`���W���`���`���`���`���`���`���5161a2f363053663ec3e03e215d3f9b95d97a1fc512d23f198b9f8f01230ae31712cf6d953944c98dfb2a4ec2d64cb6bc4dead6d53bad05759667d7d7125f834db5af5485c3f7b5c9fc5defc097e905c8c6dedb6b05e6df9bc3ef8844a1196114c79cab6cd72be5646905c52aa141c33687fa60a1f62c635c08f62109aac9133e38e7cd77bfe8a5d617f1b96e3e24e69837fd3a4ee0a8a00d5fd8ffa2719050c7113f13e9958763fe0acdea665918ba96393b0797b70f82d7d7f794cf6061dc3cc05b7378b743b79ea310c35984e027c47b402a270603dc0bcc28f4bea5083f56f2cc9148277dde25f1e58788c27f97284a518c28dc3ed1292771bd30cda0f30875b89b25ad8e1f42a6c61930ed6a003039eebff351585482083014ef3c78f628120fb264bc726e7ca11eeaaba357de3f1374405b7b5a300b6f23995e91c91450423f9cb94111aaed1f01bcbccd9ff345c15a42a065f4f557722eaabb6489469rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootgssproxy-0.7.0-30.el7_9.src.rpm����������������������������������������������������������������config(gssproxy)gssproxygssproxy(x86-64)	@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@


@
/bin/sh/bin/sh/bin/shconfig(gssproxy)keyutils-libskrb5-libsld-linux-x86-64.so.2()(64bit)ld-linux-x86-64.so.2(GLIBC_2.3)(64bit)libbasicobjects.so.0()(64bit)libc.so.6()(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.17)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.3)(64bit)libc.so.6(GLIBC_2.3.2)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libc.so.6(GLIBC_2.8)(64bit)libc.so.6(GLIBC_2.9)(64bit)libcollection.so.2()(64bit)libcom_err.so.2()(64bit)libgssapi_krb5.so.2()(64bit)libgssapi_krb5.so.2(gssapi_krb5_2_MIT)(64bit)libgssrpc.so.4()(64bit)libgssrpc.so.4(�x��������������d�����XQ#�gJj����������������w�����w����������������w�
���������������xsgbVQE@4/#
���������������ythcWRFA50$�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
z
u
i
d
X
S
G
B
6
1
%
 



���������������{vjeYTHC72&!���������������|wkfZUID83'"�
�
�
�
�
�
�
�
�
�
�
�
�
�
}
x
l
g
[
V
J
E
9
4
(
#




�	�	�	�	�	�	�	�	�	�	�	�	�	�	~	y	m	h	\	W	K	F	:	5	)	$					��������������zni]XLG;6*%���������������{oj^YMH<7+&	���������������|pk_ZNI=8,'
���������������}ql`[OJ>9-(���������������~rma\PK?�F�1�'�F�1�'�F�1�'�F�1�'�F�1�'�F�1�'k�<��k�<����#���#���#�C8���C8���C8���C8���C8���C8���C8���C8���C8���C8���C8���C8���C8���C8���C8���C8���C8���C8���C8���C8���C8���C8���C8���C8���C8���C8�����#���#���#�9�<��>�0����
�(R.�8��mȫ��L
�)@JX1�3t\	�*�i���<�4�X���0�� �n�����=���'���O�(��2��:h�)]yL��bu��*�C�(ߧ�<$��6��0��	�(1����|}P�.ѩLv��)ġ��Ъ	M4
�*���6��0'>�	�(�;��2�)t42���(��*�T�6d�0�C�4�8�@X'����\f�b����(��
;��%v�
�)DrT3��QK�	�*��.��j�H�0�y<��t�������b/e����94
�(���;b�`,P
�)'��:��Ov	�*J8*�����E+�1��cP$�����(�|	�)t�*���u(
�*�T��Q�KT&�b1Y�����/���:�
�)4}X+��UM�
�*%X(px{�Bv8w/�
q)D��p����
p*0?�og�(#o��n�u<Ck�NV�h�u
a)�4��`��-P4`*�_�^ƚ�[��P� [+9U�Xä :S����Q�t/�Q)#eP�P��0�	P*>x)K���YI�SHH�*`A)yp�@��/x@*��@>|�l1;� N�;+�L1)e$�0�jNP0*/NX.{>�2+��Qp_++�))�
�(b3\J&Z�#[�u!)
�x� ��/	 *:Bi�)=���+��7 +x4�/_�3�7�Iܱ�
1�
*��
7,7
��,�6��8�+�>$`
��\\	��p)a<�D��(�*�x�������������HT�����X#�gJj����(�������������=�����s�����������������=�=�=�ewall-config: use string.ascii_letters instead of string.letters
- dbus_to_python(): handle non-ascii chars in dbus.String.
- Modernize old syntax constructions.
- dict.keys() in Python 3 returns a "view" instead of list
- Use gettext.install() to install _() in builtins namespace.
- Allow non-ascii chars in 'short' and 'description'
- README: More information for "Working With The Source Repository"
- Build environment fixes
- firewalld.spec: Added missing checks for rhel > 6 for pygobject3-base
- firewall-applet: New setting show-inactive
- Don't stop on reload when lockdown already enabled (RHBZ#987403)
- firewall-cmd: --lockdown-on/off did not touch firewalld.conf
- FirewallApplet.gschema.xml: Dropped unused sender-info setting
- doc/firewall-applet.xml: Added information about gsettings
- several debug and log message fixes
- Add chain for sources so they can be checked before interfaces (RHBZ#903222)
- Add dhcp and proxy-dhcp services (RHBZ#986947)
- io/Zone(): don't error on deprecated family attr of source elem
- Limit length of zone file name (to 12 chars) due to Netfilter internals.
- It was not possible to overload a zone with defined source(s).
- DEFAULT_ZONE_TARGET: {chain}_ZONE_{zone} -> {chain}_{zone}
- New runtime get<X>Settings for services and icmptypes, fixed policies callbacks
- functions: New functions checkUser, checkUid and checkCommand
- src/firewall/client: Fixed lockdown-whitelist-updated signal handling
- firewall-cmd(1): move firewalld.richlanguage(5) reference in --*-rich-rule
- Rich rule service: Only add modules for accept action
- firewall/core/rich: Several fixes and enhanced checks
- Fixed reload of direct rules
- firewall/client: New functions to set and get the exception handler
- firewall-config: New and enhanced UI to handle lockdown and rich rules
- zone's immutable attribute is redundant
- Do not allow to set settings in config for immutable zones.
- Ignore deprecated 'immutable' attribute in zone files.
- Eviscerate 'immutable' completely.
- FirewallDirect.query_rule(): fix it
- permanent direct: activate firewall.core.io.direct:Direct reader
- core/io/*: simplify getting of character data
- FirewallDirect.set_config(): allow reloading- Remove migrating to a systemd unit file from a SysV initscript
- Remove pointless "ExclusiveOS" tag- Fixed rich rule check for use in D-Bus- new service files
- relicensed logger.py under GPLv2+
- firewall-config: sometimes we don't want to use client's exception handler
- When removing Service/IcmpType remove it from zones too (RHBZ#958401)
- firewall-config: work-around masquerade_check_cb() being called more times
- Zone(IO): add interfaces/sources to D-Bus signature
- Added missing UNKNOWN_SOURCE error code
- fw_zone.check_source: Raise INVALID_FAMILY if family is invalid
- New changeZoneOfInterface method, marked changeZone as deprecated
- Fixed firewall-cmd man page entry for --panic-on
- firewall-applet: Fixed possible problems of unescaped strings used for markup
- New support to bind zones to source addresses and ranges (D-BUS, cmd, applet
- Cleanup of unused variables in FirewallD.start
- New firewall/fw_types.py with LastUpdatedOrderedDict
- direct.chains, direct.rules: Using LastUpdatedOrderedDict
- Support splitted zone files
- New reader and writer for stored direct chains and rules
- LockdownWhitelist: fix write(), add get_commands/uids/users/contexts()
- fix service_writer() and icmptype_writer() to put newline at end of file
- firewall-cmd: fix --list-sources
- No need to specify whether source address family is IPv4 or IPv6
- add getZoneOfSource() to D-Bus interface
- Add tests and bash-completion for the new "source" operations
- Convert all input args in D-Bus methods
- setDefaultZone() was calling accessCheck() *after* the action
- New uniqify() function to remove duplicates from list whilst preserving order
- Zone.combine() merge also services and ports
- config/applet: silence DBusException during start when FirewallD is not running (RHBZ#966518)
- firewall-applet: more fixes to make the address s�x��������������C�����X�#yfJj�������������������;�����d�����������������;�;�;�  in general is elinks-0.12pre1 considered better than 0.11.4
- dropped patches negotiate-auth, chunkedgzip - included in 0.12pre1,
  modified few others due source code changes- new stable upstream release- new upstream release candidate marked stable- fixed broken output for gzipped chunked pages(#410801)- used -D_GNU_SOURCE instead of ugly hack/patch to 
  have NI_MAXPATH defined- new version marked stable by upstream 0.11.4rc0
- enabled experimental bittorent support(#426702)- rebuilt because of new OpenSSL- generalized text-www-browser requirements(#174566)- rebuilt because of expat 2.0- rebuilt for F8
- changed license tag to GPLv2- fix of open macro(new glibc) by Joe Orton- cleanup of duplicates in buildreq, added license file to doc 
- (package review by Tyler Owen(#225725))- update to new upstream version
- removed patch for #210103 , included in upstream release
- updated patch elinks-0.11.1-negotiate.patch to pass build- update to new upstream version
- cleanup spec file- fix #210103 - elinks crashes when given bad HTTP_PROXY- rebuild- improved negotiate-auth patch (faster now)- added negotiate-auth (GSSAPI) support -- EXPERIMENTAL!- update to new upstream version- add buildrequires bzip2-devel, expat-devel,libidn-devel- bump again for double-long bug on ppc(64)- rebuilt for new gcc4.1 snapshot and glibc changes- use upstream version of srcdir.patch- update to new upstream version
- fix 0.11.0 build system (srcdir.patch)
- regenerate patches:
     elinks-0.11.0-getaddrinfo.patch, 
     elinks-0.11.0-ssl-noegd.patch,
     elinks-0.11.0-sysname.patch,
     elinks-0.11.0-union.patch- rebuilt- rebuild (against new openssl)- update to new upstream version- fix #157300 - Strange behavior on ppc64 (patch by Miloslav Trmac)- Fix checking for numeric command prefix (#152953, patch by Jonas Fonseca)
- Fix invalid C causing assertion errors on ppc and ia64 (#156647)- sync with upstream; stable 0.10.3- rebuilt- sync with upstream; stable 0.10.2- sync with upstream; stable 0.10.1- the "Linux" driver seems better than "VT100" for xterm (#128105)- upload new upstream tarball with stable 0.9.2 release- 0.9.2rc7.
- changed summary in spec to get rid of #41732, #61499- Avoid symbol clash (bug #131170).- 0.9.2rc4.- Fix elinks -dump -stdin (bug #127624).- 0.9.2rc2.- rebuilt- Build with LFS support (bug #125064).- Use UTF-8 by default (bug #76445).- 0.9.1.
- Use %find_lang.- rebuilt- 0.4.3.
- Updated pkgconfig patch.- Rebuilt.- Don't require XFree86-libs (bug #102072).- rebuild- Rebuilt.- Make getaddrinfo call use AI_ADDRCONFIG.
- Don't put so much information in the user-agent header string (bug #97273).- rebuilt- Rebuild again.- Rebuild.- Prevent crash when HOME is unset (bug #90663).- use relative symlinks to elinks- 0.4.2 (bug #83273).- rebuilt- Fix URL (bug #81987).- rebuild- Fix bug #62368.- use openssl's pkg-config data, if available- rebuild on all arches- update to 0.3.2 to fix the DNS Ctrl-C segfaults
- update URLs, the project moved
- include man page- automated rebuild- automated rebuild- rebuilt against new openssl- automated rebuild- cookie fix- Save some more space in rescue mode- Add the links manual from links.sourceforge.net (RFE #49228)- update to 0.96- actually run make in build phase- rebuild in new environment- rebuild in new environment- 0.95- 0.94 final- pre9- Upgraded to pre8.- 0.94pre7
- Minor fixes to the specfile (s/Copyright:/License:/)
- merge rescue stuff- 0.94pre5- 0.94pre4- 0.94pre1- 0.92 (needed - prior versions won't display XHTML properly)- rebuild in new environment to work around bugs- automatic rebuild- 0.84- provides virtual package webclient.- initial RPM/bin/sh/bin/sh/bin/shlinks	

�x�������������83�����XZ#�gJj�������������F����R.�����:����������������R.���C4�?/�d����	(�	P����$�(�/�7�?�	m�������#P#	�#
�#h#
K#

p#
�#�#Z�#,RtRBR(�8��9!�:j�G�#H
�#I#X8Y@\x#]#^qb�dIeNfQlStl#u�#v�w"�#x#@#y#���/�/�/�6226
4L�4x4|#4�g4�h4�Cnss-tools3.90.02.el7_9.tuxcare.els4Tools for the Network Security ServicesNetwork Security Services (NSS) is a set of libraries designed to
support cross-platform development of security-enabled client and
server applications. Applications built with NSS can support SSL v2
and v3, TLS, PKCS #5, PKCS #7, PKCS #11, PKCS #12, S/MIME, X.509
v3 certificates, and other security standards.

Install the nss-tools package if you need command-line tools to
manipulate the NSS certificate and key database.i��Wbuildfarm12-new.corp.cloudlinux.com#�CentOSTuxCareMPLv2.0TuxCare Packaging Team <packager@tuxcare.com>System Environment/Basehttp://www.mozilla.org/projects/security/pki/nss/linuxx86_64��`�� =���h٨,�,�hHW��Px
���� ���H`0�(��6B	!K�(�+�$
;0�x����������������������큤������������������������i��Vi��Vi��Vi��Vi��Vi��Vi��Vi��Vi��Vi��Vi��Vi��Vi��Vi��Vi��Vi��Vi��Vi��Vi��Vi��Vi��Vi��Vi��Ii��Ii��Ii��Ii��Ii��Ii��Ii��Ii��Ii��Ii��Ii��Ii��I91fcdcca5af8de59031dcd8c28a404cfb65c2bcc6d407df037cc6649b0338b439e7aaa56e8cf493509bec441cbc05844ce082193e79a34a9089c990beeefcd53fc1932219ea16f8cb1bd077e55f9e98c4c9ca22d1d4673984bc29347c854a1a2a5e1a49d99c9f2d73bada1b71be37467dcb4d67abf4eef7b892b530f5c27278d3032095cefd484e4b26c8ae5a287591541c86eedf1eea621a0979c4a44b0bc52e42e7a305f930fd414481901dd473702360e63b50cc692ceff6dfe1b9aec0a9f2bc06db6a0938bede44237c58cb33f98da9d6a8b788fd74a76e457d3da7b186efcae7142c3963743c5d9b614c9e96826b0ee648a725f6634c350908bd2abf8551b40424dea1a4009646d1d5fd692e25ced4bcb1d9398f99cac92034c7658ae92703c73762517517fe8b95f60dcf489b02d04d9211a87eb1a7f6707fdc283bcb3837d4c5002e44522ca501ab84995dc0a922bde1069a7d62cfff0e97b0a1ede8b9c1ff147212666905fe2ba447211223b8c76f569510aa3009195b0fb6694be459989a574689fccf40b34239bc9cf8a139f257b55ab0c1ab85b62846273e844dd7c152a1a62a5e2a88deca6ae8edf3e9db0db407b63172d2232f659d549092939e2d08923cb5498f88b220b1922dd10649479456099639016bc580c479a659cb2654d760a02e5c209b33b1e5b92f736b1c33e9c1098045f3b6d1a87ffcb65483a77a7d35777933131a0a14dfafc07a8633208606064008ef35feaf142e21d5c6849233c5ec77116a15a0c93e4d79514913440d7da858f98b114f57ade93b0f829540a925d818372fdb5d88f928524c1741116d976058036d6f53def38a188002fac04131c6cf4ddf51f77ff7bc95c6693db38e9b0d1fcd396203a5c6f4d5770fac6e931878c85145435e27a02e757d5ea2eb93b424bbe028d3e7c24934685027d277161d21f5932a5d7d6075e66d390903a2c897db0e893e41a11a0ee675f90898bd946a919b52be40462e3e10cf349599dce8a1931cd6ad29848e4b7c251f3a57716ff5df6dbd5fd2438b73eb1d07abbf0202bc7982221fd743bc634bacce3e2744e73daa3d7711cea733d0765f6e660590ff0cc60ec0e1c6184496bd97c40024cea0aad1b3ff7a400f4a57d892a49a7ea0badaf7df8cccf28ecd686fc8105389c1b128dcbd8ecd92a62c62b9b22c8c7d7f1244e7da941ef7963fbd329b0135e678d3585259641f47870a5f6135ee69b4804781ba068b7197604551098ff2bf4ce60c37a2d81f692c3814b673cbf4b03e4525d2e9f�x��������������"�����X�#�gJj��������?����
)�����b����������������
)	)�
1RRRPR>R2R7R5R-R*RRRRRRRRR!RR&RRR	R$R#RR R)R/R0RR;R3RR:R1RRRPR>R2R5R-R*RRRRRRRRR!R&RR#RR	R$RR R)R/R0RR;R3RR:R1RRRPR2R5R-R*RRRRRRGRBRERDR>RHRFR=RIRAR<RRRR!R&RR#RRR	R$RR R)R/R0RR;R3RR:R1RRRPR>R2R-R,R*R7R9R5R6RRRRRRR
RRR&RR#R!RR	R$R RR)R/R0RR;R3RR:R1RRRKRPR2R5R-R*RRRRRR>RHRFR?R<RARRRR!R&RR#RR	R$RR R)R/R0RR;R3RR:R1RRRPR>R2R5R-R*RRRRRRR
RRR!RR#R&R	R$RRR R)R/R0RR;R3RR:R1RRRPR2R5R-R*RRRRRRGRCR@RERDRHR=RFRJR?R>RIR<RARRRR'R!R&RR#RRR	R$RRR R)R/R0RR;R3RR:R1RRRPRR"RR'R2R*RRRRRR)R/R0RR;R3RR:R1RRRPR>R2R5R-R*RRRRRRRRR!R&R#RRR	R$RRR R)R/R0RR;R3RR:R1RRRPR2R5R-R*RRRRRR>RARRRR!R&RR#RR	R$RR R)R/R0RR;R3RR:R1RRRP?���p�(�3!�ׅ���s�z����{�P�fi�
�
	�{�P�f���aщ0'*�c`�6s���f��y�`v�L�b@��v�i^��+o�T�yI�C�d}c�s;>��Q֮��v�Q��݂e����13a�H
���7���X��e�o:`}���X'\��蜮�vӂ��
�B�$~�cU�d{��7���%�!X���_���0��.�eu�x,*sB㭓�i;Q.;����>���c�w�J!��9�\��CO�=�e�\�,�x(��"��J���LU�k�
?�F�J��ʠ�VP� �!k��$������.F�:��_*_�]Q�Ca㑗_mwn�_U�C��g��2�,�C�~y�Z�[�}�F3LIP����Mr]NS�}w���1�q��A�F�{��K�q
U���6�GyA%��~	��+^xO��G$�%m���'�	
L��̓.u�ZEո�GC�xD�.�&�����?-���Y+���Ob�XS��T'����6��a�գ�&��ʓ��-1qn�@�Nb\��BZ�Ҙ�~����잋���3!�ׅ���s�z����{�P�fi�
�
	�{�P�f���v�i�]�s���]��g,�{@�����b�S�O�E�`�����ޢZ�PaUk�j�G��#Az��G�!�'������O;{7��y+�����h�{|�G�
�	^<[g�.›�=�lWov,&�/��o�v�_.E�K��An����F$�k�Ȯ�(�3u9���J�饾��#?�}�K�\�P�2���c�J,k�
u�6��?��i�~���2�&��x ��%�`��k��
�D��߀cJ,�'5s�y��ҟ`h�ͬc}d�:�T�@�ڵu�4$-5�+Q���[�WdU�]B|��>������`I�}��
���'�%suy5��9�/�`K�Q�"�+�~��k=VBS+�Q`u�@4�Fo�Ƌ�N�3}�R�@Ǵ�oz}��&��6�o�Fk�̀���B?�|:� 6�󛸤������Y�@n��_$qB�
��������*@,��t�4�oSn�r��4��|�>x��c�[� �Qe�Y����557dda0f778f5f2b9b7278ef41b81b6c0986b0f1i�B5#&pi�B4 debugfs functions (Mike Snitzer) [1105703]
- [block] blk-mq: fix RHEL kABI breakage (Mike Snitzer) [1105204]
- [block] blk-mq: blk_mq_start_hw_queue() should use blk_mq_run_hw_queue() (Mike Snitzer) [1105204]
- [block] add support for limiting gaps in SG lists (Mike Snitzer) [1105204]
- [block] blk-mq: bitmap tag, fix races in bt_get() function (Mike Snitzer) [1105204]
- [block] blk-mq: bitmap tag, fix race on blk_mq_bitmap_tags::wake_cnt (Mike Snitzer) [1105204]
- [block] blk-mq: bitmap tag, fix races on shared ::wake_index fields (Mike Snitzer) [1105204]
- [block] blk_max_size_offset() should check ->max_sectors (Mike Snitzer) [1105204]
- [block] null_blk: fix softirq completions for queue_mode == 1 (Mike Snitzer) [1105204]
- [block] blk-mq: merge blk_mq_drain_queue and __blk_mq_drain_queue (Mike Snitzer) [1105204]
- [block] blk-mq: properly drain stopped queues (Mike Snitzer) [1105204]
- [block] blk-mq: for_each_* macro correctness (Mike Snitzer) [1105204]
- [scsi] reintroduce scsi_driver.init_command (Mike Snitzer) [1105204]
- [scsi] remove scsi_end_request (Mike Snitzer) [1105204]
- [scsi] explicitly release bidi buffers (Mike Snitzer) [1105204]
- [scsi] don't reference freed command in scsi_prep_return (Mike Snitzer) [1105204]
- [scsi] don't reference freed command in scsi�x�������������(�����X>#�gJj��������8$����[������3����������������[��r��xpression
  (incomplete fix for CVE-2013-7345). CVE-2014-3538
- fileinfo: cdf_check_stream_offset insufficient boundary
  check. CVE-2014-3479
- fileinfo: cdf_count_chain insufficient boundary check
  CVE-2014-3480
- fileinfo: fix mconvert incorrect handling of truncated
  pascal string size. CVE-2014-3478
- fileinfo: cdf_read_property_info insufficient boundary
  check. CVE-2014-3487
- fileinfo: fix cdf_read_property_info
  (incomplete fix for CVE-2012-1571). CVE-2014-3587- fileinfo: fix out-of-bounds memory access CVE-2014-2270
- fileinfo: fix extensive backtracking CVE-2013-7345- gd: fix NULL deref in imagecrop CVE-2013-7327
- gd: drop vpx support, fix huge memory consumption #1075201- fix patch name
- fix memory leak introduce in patch for CVE-2014-1943
- fix heap-based buffer over-read in DateInterval CVE-2013-6712- fix infinite recursion in fileinfo CVE-2014-1943- fix heap overflow vulnerability in imagecrop CVE-2013-7226- allow multiple paths in ini_scan_dir #1058161- add security fix for CVE-2013-6420- rebuild- rebuild with test enabled
- add dependency on php-pecl-jsonc- update to PHP 5.5.6
- buildstrap build- update to PHP 5.5.5
- mod_php only for httpd24- update to PHP 5.5.4
- improve security, use specific soap.wsdl_cache_dir
  use /var/lib/php/wsdlcache for mod_php and php-fpm
- sync short_tag comments in php.ini with upstream
- relocate RPM macro- update to PHP 5.5.3
- improve system libzip patch
- fix typo and add missing entries in php.ini- update to PHP 5.5.1 for php55 SCL- rebuild for new httpd-mmn value- remove ZTS conditional stuf for ligibility
- add mod_php for apache 2.4 (from httpd24 collection)- improve mod_php, pgsql and ldap description
- add missing man pages (phar, php-cgi)
- add provides php(pdo-abi) for consistency with php(api) and php(zend-abi)
- use %__isa_bits instead of %__isa in ABI suffix #985350- add security fix for CVE-2013-4113
- add missing ASL 1.0 license- run tests during build- rebase to 5.4.16
- fix hang in FindTishriMolad(), #965144
- patch for upstream Bug #64915 error_log ignored when daemonize=0
- patch for upstream Bug #64949 Buffer overflow in _pdo_pgsql_error, #969103
- patch for upstream bug #64960 Segfault in gc_zval_possible_root- remove wrappers in /usr/bin (#966407)- rebuild for libjpeg (instead of libjpeg_turbo)
- fix unowned dir %{_datadir}/fpm and %{_libdir}/httpd (#956221)- update to 5.4.14
- clean old deprecated options- update to 5.4.13
- security fixes for CVE-2013-1635 and CVE-2013-1643
- make php-mysql package optional (and disabled)
- make ZTS build optional (and disabled)
- always try to load mod_php (apache warning is usefull)
- Hardened build (links with -z now option)
- Remove %config from /etc/rpm/macros.php- update to 5.4.11
- fix php.conf to allow MultiViews managed by php scripts- update to 5.4.10
- remove patches merged upstream
- drop "Configure Command" from phpinfo output
- prevent php_config.h changes across (otherwise identical)
  rebuilds- update to 5.4.9- fix php.conf- filter private shared in _httpd_modir
- improve system libzip patch to use pkg-config
- use _httpd_contentdir macro and fix php.gif path
- switch back to upstream generated scanner/parser
- use system pcre only when recent enough- improves php.conf, no need to be relocated- clarify Licenses
- missing provides xmlreader and xmlwriter
- change php embedded library soname version to 5.4- fix mysql_sock macro definition- fix standard build (non scl)- fix installed headers- use libldap_r for ldap extension- add missing scl_prefix in some provides/requires- make php-enchant optionnal, not available on RHEL-5
- make php-recode optionnal, not available on RHEL-5
- disable t1lib on RHEL-5- enable tidy on RHEL-6 only
- re-enable unit tests- minor macro fixes for RHEL-5 build
- update autotools workaround for RHEL-5
- use readline when libedit not available (RHEL-5)- update to 5.4.8
- define both session.save_handler and session.save_path
- fix possible segfault in libxml (#828526)
- use SKIP_ONLINE_TEST during make te�x�������������������X_#<fJj��������p����x���������������������x�T�kHFuJ404+G6ETd0owwxq64jLIcsp/GBZHGU0RKKAo9DRL
H7rpQ7PVlnw8TDNlOtWt5EJlBXFcPL+NgWbqkADAyA/XSNeWlqonvPlYfmasnAHA
pMd9NhPQhC7hJTjCiAwG8UyWpV8Dj07DHFQ5xBbkTnKH2OrJtguPqSNYtTASbsWz
09S8ujoTDXFT17NbFM2dMIiq0a4VQB3SzH13H2io9Cbg/TzJrJGmwgoXgwARAQAB
tDZNeVNRTCBSZWxlYXNlIEVuZ2luZWVyaW5nIDxteXNxbC1idWlsZEBvc3Mub3Jh
Y2xlLmNvbT6JAlQEEwEIAD4WIQS8pDQXw7SF3RKOxtS3s7eIqNN4XAUCZTas2gIb
AwUJA8JnAAULCQgHAgYVCgkICwIEFgIDAQIeAQIXgAAKCRC3s7eIqNN4XLzoD/9P
lpWtfHlI8eQTHwGsGIwFA+fgipyDElapHw3MO+K9VOEYRZCZSuBXHJe9kjGEVCGU
DrfImvgTuNuqYmVUV+wyhP+w46W/cWVkqZKAW0hNp0TTvu3eDwap7gdk80VF24Y2
Wo0bbiGkpPiPmB59oybGKaJ756JlKXIL4hTtK3/hjIPFnb64Ewe4YLZyoJu0fQOy
A8gXuBoalHhUQTbRpXI0XI3tpZiQemNbfBfJqXo6LP3/LgChAuOfHIQ8alvnhCwx
hNUSYGIRqx+BEbJw1X99Az8XvGcZ36VOQAZztkW7mEfH9NDPz7MXwoEvduc61xwl
MvEsUIaSfn6SGLFzWPClA98UMSJgF6sKb+JNoNbzKaZ8V5w13msLb/pq7hab72HH
99XJbyKNliYj3+KA3q0YLf+Hgt4Y4EhIJ8x2+g690Np7zJF4KXNFbi1BGloLGm78
akY1rQlzpndKSpZq5KWw8FY/1PEXORezg/BPD3Etp0AVKff4YdrDlOkNB7zoHRfF
HAvEuuqti8aMBrbRnRSG0xunMUOEhbYS/wOOTl0g3bF9NpAkfU1Fun57N96Us2T9
gKo9AiOY5DxMe+IrBg4zaydEOovgqNi2wbU0MOBQb23Puhj7ZCIXcpILvcx9ygjk
ONr75w+XQrFDNeux4Znzay3ibXtAPqEykPMZHsZ2sbkCDQRlNqzaARAAsdvBo8WR
qZ5WVVk6lReD8b6Zx83eJUkV254YX9zn5t8KDRjYOySwS75mJIaZLsv0YQjJk+5r
t10tejyCrJIFo9CMvCmjUKtVbgmhfS5+fUDRrYCEZBBSa0Dvn68EBLiHugr+SPXF
6o1hXEUqdMCpB6oVp6X45JVQroCKIH5vsCtw2jU8S2/IjjV0V+E/zitGCiZaoZ1f
6NG7ozyFep1CSAReZu/sssk0pCLlfCebRd9Rz3QjSrQhWYuJa+eJmiF4oahnpUGk
txMD632I9aG+IMfjtNJNtX32MbO+Se+cCtVc3cxSa/pR+89a3cb9IBA5tFF2Qoek
hqo/1mmLi93Xn6uDUhl5tVxTnB217dBT27tw+p0hjd9hXZRQbrIZUTyh3+8EMfmA
jNSIeR+th86xRd9XFRr9EOqrydnALOUr9cT7TfXWGEkFvn6ljQX7f4RvjJOTbc4j
JgVFyu8K+VU6u1NnFJgDiNGsWvnYxAf7gDDbUSXEuC2anhWvxPvpLGmsspngge4y
l+3nv+UqZ9sm6LCebR/7UZ67tYz3p6xzAOVgYsYcxoIUuEZXjHQtsYfTZZhrjUWB
J09jrMvlKUHLnS437SLbgoXVYZmcqwAWpVNOLZf+fFm4IE5aGBG5Dho2CZ6ujngW
9Zkn98T1d4N0MEwwXa2V6T1ijzcqD7GApZUAEQEAAYkCPAQYAQgAJhYhBLykNBfD
tIXdEo7G1Lezt4io03hcBQJlNqzaAhsMBQkDwmcAAAoJELezt4io03hcXqMP/01a
PT3A3Sg7oTQoHdCxj04ELkzrezNWGM+YwbSKrR2LoXR8zf2tBFzc2/Tl98V0+68f
/eCvkvqCuOtq4392Ps23j9W3r5XG+GDOwDsx0gl0E+Qkw07pwdJctA6efsmnRkjF
2YVO0N9MiJA1tc8NbNXpEEHJZ7F8Ri5cpQrGUz/AY0eae2b7QefyP4rpUELpMZPj
c8Px39Fe1DzRbT+5E19TZbrpbwlSYs1iCzS5YGFmpCRyZcLKXo3zS6N22+82cnRB
SPPipiO6WaQawcVMlQO1SX0giB+3/DryfN9VuIYd1EWCGQa3O0MVu6o5KVHwPgl9
R1P6xPZhurkDpAd0b1s4fFxin+MdxwmG7RslZA9CXRPpzo7/fCMW8sYOH15DP+Yf
UckoEreBt+zezBxbIX2CGGWEV9v3UBXadRtwxYQ6sN9bqW4jm1b41vNA17b6CVH6
sVgtU3eN+5Y9an1e5jLD6kFYx+OIeqIIId/TEqwS61csY9aav4j4KLOZFCGNU0FV
ji7NQewSpepTcJwfJDOzmtiDP4vol1ApJGLRwZZZ9PB6wsOgDOoP6sr0YrDI/NNX
2RyXXbglnQ1yJZVSH3/3eo6knG2qTthUKHCRDNKdy9Qqc1x4WWWtSRjh+zX8AvJK
2q1rVLH2/3ilxe9wcAZUlaj3id3TxquAlud4lWDz
=h5nH
-----END PGP PUBLIC KEY BLOCK-----
e6��localhostpubkeyMySQL Release Engineering <mysql-build@oss.oracle.com>Public Keys(none)gpg(MySQL Release Engineering <mysql-build@oss.oracle.com>)gpg(a8d3785c)4.11.34:b7b3b788a8d3785c-6536acda4:b7b3b788a8d3785c-6536acda?����7e4fee21d95c249b48a76a81a3a3ab4db5bb5e42er��er��ayloadIsXz)rpmlib(TildeInVersions)3.0.4-14.6.0-14.0-15.2-14.10.0-14.11.1b�2@`�_*�@^=Q@]µ�\b�@Z��@X<@X<@Nicolas Rochelemagne <nicolas.rochelemagne@cpanel.net> - 3.38.5-1.cp108~el7Nicolas Rochelemagne <nicolas.rochelemagne@cpanel.net> - 3.32.3-1.cp1198Tim Mullin <tim@cpanel.net> - 3.32.3-1.cp1186Stephen Bee <stephen@cpanel.net> - 3.31.1-1.cp1186Nicolas Rochelemagne <nicolas.rochelemagne@cpanel.net> - 3.27.1-1.cp1186Alexandra Hrefna Hilmisdóttir <xan@cpanel.net> - 3.27.1-1.cp1170J. Nick Koston <nick@cpanel.net> - 3.22.0-1.cp1162Chris Lindee <chris.lindee@cpanel.net> - 3.10.2-1.cp1162Chris Lindee <chris.lindee@cpanel.net> - 3.7.17-1.cp1162- Upstream update to 3.38.5
- Add Ubuntu 22 & RedHat 9 support- Add Ubuntu support- New upstream release- New upstream release- Add CentOS 8 support- Upstream update- Upstream update- Upstream update- Initial creation/sbin/ldconfig/sbin/ldconfigsandbox-cl7.openstack.build 1655150354�3.38.5-1.cp108~el73.38.5-1.cp108~��������x�������������������XK#,fJj������������*���3Y�����[����������������3Y2Y4Y�ata@redhat.com> - 0.154-4Mark Wielaard <mjw@redhat.com> 0.154-3Mark Wielaard <mjw@redhat.com> 0.154-2Karsten Hopp <karsten@redhat.com> 0.154-1.1Mark Wielaard <mjw@redhat.com> - 0.154-1Mark Wielaard <mark@klomp.org> - 0.153-2Mark Wielaard <mjw@redhat.com> - 0.153-1Mark Wielaard <mjw@redhat.com> - 0.152-3Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 0.152-2Roland McGrath <roland@redhat.com> - 0.152-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 0.151-2Roland McGrath <roland@redhat.com> - 0.151-1Roland McGrath <roland@redhat.com> - 0.150-2Roland McGrath <roland@redhat.com> - 0.150-1jkeating - 0.149-2Roland McGrath <roland@redhat.com> - 0.149-1Roland McGrath <roland@redhat.com> - 0.148-1Roland McGrath <roland@redhat.com> - 0.147-1Roland McGrath <roland@redhat.com> - 0.146-1Roland McGrath <roland@redhat.com> - 0.145-1Roland McGrath <roland@redhat.com> - 0.144-2Roland McGrath <roland@redhat.com> - 0.144-1Roland McGrath <roland@redhat.com> - 0.143-1Roland McGrath <roland@redhat.com> - 0.142-1Roland McGrath <roland@redhat.com> - 0.141-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 0.140-2Roland McGrath <roland@redhat.com> - 0.140-1Roland McGrath <roland@redhat.com> - 0.139-1Roland McGrath <roland@redhat.com> - 0.138-2Roland McGrath <roland@redhat.com> - 0.138-1Roland McGrath <roland@redhat.com> - 0.137-3Roland McGrath <roland@redhat.com> - 0.137-2Tom "spot" Callaway <tcallawa@redhat.com> - 0.135-2Roland McGrath <roland@redhat.com> - 0.135-1Roland McGrath <roland@redhat.com> - 0.134-1Roland McGrath <roland@redhat.com> - 0.133-2Roland McGrath <roland@redhat.com> - 0.132-3Roland McGrath <roland@redhat.com> - 0.131-1Roland McGrath <roland@redhat.com> - 0.130-3Roland McGrath <roland@redhat.com> - 0.130-1Roland McGrath <roland@redhat.com> - 0.129-2Roland McGrath <roland@redhat.com> - 0.129-1Roland McGrath <roland@redhat.com> - 0.128-2Roland McGrath <roland@redhat.com> - 0.127-1Roland McGrath <roland@redhat.com> - 0.126-1Roland McGrath <roland@redhat.com> - 0.125-3Roland McGrath <roland@redhat.com> - 0.125-1Roland McGrath <roland@redhat.com> - 0.124-1Roland McGrath <roland@redhat.com> 0.123-1Roland McGrath <roland@redhat.com> - 0.122-4Roland McGrath <roland@redhat.com> - 0.122-3Roland McGrath <roland@redhat.com> - 0.121-1Jeremy Katz <katzj@redhat.com> - 0.120-3Roland McGrath <roland@redhat.com> - 0.120-2Jesse Keating <jkeating@redhat.com> - 0.119-1.2.1Jesse Keating <jkeating@redhat.com> - 0.119-1.2Roland McGrath <roland@redhat.com> - 0.119-1Jesse Keating <jkeating@redhat.com>Roland McGrath <roland@redhat.com> - 0.118-1Roland McGrath <roland@redhat.com> - 0.117-2Roland McGrath <roland@redhat.com> - 0.116-1Roland McGrath <roland@redhat.com> - 0.115-3Roland McGrath <roland@redhat.com> - 0.115-2Roland McGrath <roland@redhat.com> - 0.114-1Roland McGrath <roland@redhat.com> - 0.113-2Roland McGrath <roland@redhat.com> - 0.112-1Roland McGrath <roland@redhat.com> - 0.111-2Roland McGrath <roland@redhat.com> - 0.111-1Roland McGrath <roland@redhat.com> - 0.110-1Roland McGrath <roland@redhat.com> - 0.109-2Roland McGrath <roland@redhat.com> - 0.108-5Roland McGrath <roland@redhat.com> - 0.108-3Roland McGrath <roland@redhat.com> - 0.108-2Roland McGrath <roland@redhat.com> - 0.108-1Roland McGrath <roland@redhat.com> - 0.107-2Roland McGrath <roland@redhat.com> - 0.107-1Roland McGrath <roland@redhat.com> - 0.106-3Roland McGrath <roland@redhat.com> - 0.106-2Roland McGrath <roland@redhat.com> - 0.106-1Roland McGrath <roland@redhat.com> - 0.104-2Jakub Jelinek <jakub@redhat.com> 0.103-2Jakub Jelinek <jakub@redhat.com> 0.101-2Jeff Johnson <jbj@redhat.com> 0.99-2Jeff Johnson <jbj@redhat.com> 0.97-3Jakub Jelinek <jakub@redhat.com> 0.95-5Jakub Jelinek <jakub@redhat.com> 0.95-4Elliot Lee <sopwith@redhat.com>Jeff Johnson <jbj@redhat.com> 0.95-2Elliot Lee <sopwith@redhat.com>Elliot Lee <sopwith@redhat.com>Jakub Jelinek <jakub@redhat.com> 0.94-1Jakub Jelinek <jakub@redhat.com> 0.93-1Jakub Jelinek <jase

Sindbad File Manager Version 1.0, Coded By Sindbad EG ~ The Terrorists